Check DNS, Urls + Redirects, Certificates and Content of your Website




I

Content problems - mixed content, missing files etc.

Checked:
03.12.2019 00:06:47


Older results

No older results found


1. IP-Addresses

HostTIP-Addressis auth.∑ Queries∑ Timeout
blog.coroico.mx
A
35.188.81.178
Ashburn/Virginia/United States (US) - Google LLC
Hostname: 178.81.188.35.bc.googleusercontent.com
yes
1
0

AAAA

yes


www.blog.coroico.mx
A
35.188.81.178
Ashburn/Virginia/United States (US) - Google LLC
Hostname: 178.81.188.35.bc.googleusercontent.com
yes
1
0

AAAA

yes



2. DNSSEC

Zone (*)DNSSEC - Informations (beta)

Zone: (root)
(root)
1 DS RR published



Status: Valid because published



2 DNSKEY RR found



Public Key with Algorithm 8, KeyTag 20326, Flags 257 (SEP = Secure Entry Point)



Public Key with Algorithm 8, KeyTag 22545, Flags 256



1 RRSIG RR to validate DNSKEY RR found



Algorithm: 8, 0 Labels, original TTL: 172800 sec, Signature-expiration: 21.12.2019, 00:00:00, Signature-Inception: 30.11.2019, 00:00:00, KeyTag 20326, Signer-Name: (root)



Status: Good - Algorithmus 8 and DNSKEY with KeyTag 20326 used to validate the DNSKEY RRSet



Status: Valid Chain of trust. Parent-DS with Algorithm 8, KeyTag 20326, DigestType 2 and Digest "4G1EuAuPHTmpXAsNfGXQhFjogECbvGg0VxBCN8f47I0=" validates local Key with the same values, Key ist Secure Entry Point (SEP) of the zone

Zone: mx
mx
1 DS RR in the parent zone found



1 RRSIG RR to validate DS RR found



Algorithm: 8, 1 Labels, original TTL: 86400 sec, Signature-expiration: 15.12.2019, 17:00:00, Signature-Inception: 02.12.2019, 16:00:00, KeyTag 22545, Signer-Name: (root)



Status: Good - Algorithmus 8 and DNSKEY with KeyTag 22545 used to validate the DS RRSet in the parent zone



2 DNSKEY RR found



Public Key with Algorithm 8, KeyTag 25156, Flags 256



Public Key with Algorithm 8, KeyTag 61382, Flags 257 (SEP = Secure Entry Point)



2 RRSIG RR to validate DNSKEY RR found



Algorithm: 8, 1 Labels, original TTL: 86400 sec, Signature-expiration: 01.01.2020, 00:00:00, Signature-Inception: 02.12.2019, 00:00:00, KeyTag 25156, Signer-Name: mx



Algorithm: 8, 1 Labels, original TTL: 86400 sec, Signature-expiration: 31.01.2020, 15:00:00, Signature-Inception: 02.12.2019, 15:00:00, KeyTag 61382, Signer-Name: mx



Status: Good - Algorithmus 8 and DNSKEY with KeyTag 25156 used to validate the DNSKEY RRSet



Status: Good - Algorithmus 8 and DNSKEY with KeyTag 61382 used to validate the DNSKEY RRSet



Status: Valid Chain of trust. Parent-DS with Algorithm 8, KeyTag 61382, DigestType 2 and Digest "D6RCBnPxtyj4YSxh88Il3x5kQABERoWB3Yyn3K/cpmM=" validates local Key with the same values, Key ist Secure Entry Point (SEP) of the zone

Zone: coroico.mx
coroico.mx
0 DS RR in the parent zone found



DS-Query in the parent zone has a valid NSEC3 RR as result with the hashed domain name between the hashed NSEC3-owner and the hashed NextOwner. So the parent zone confirmes the non-existence of a DS RR.



0 DNSKEY RR found





Zone: blog.coroico.mx
blog.coroico.mx
0 DS RR in the parent zone found



0 DNSKEY RR found





Zone: www.blog.coroico.mx
www.blog.coroico.mx
0 DS RR in the parent zone found


3. Name Servers

DomainNameserverNS-IP
www.blog.coroico.mx
  ns45.domaincontrol.com / p11

blog.coroico.mx
  ns45.domaincontrol.com / p11
97.74.102.23
Scottsdale/Arizona/United States (US) - GoDaddy.com, LLC


 
2603:5:2162::17
New York/United States (US) - GoDaddy.com, LLC

coroico.mx
  ns45.domaincontrol.com / p09


  ns46.domaincontrol.com / p06

mx
  c.mx-ns.mx


  e.mx-ns.mx / 1.ber.pch


  i.mx-ns.mx


  m.mx-ns.mx


  o.mx-ns.mx


  x.mx-ns.mx


4. SOA-Entries


Domain:mx
Primary:m.mx-ns.mx
Mail:hostmaster.nic.mx
Serial:1575327051
Refresh:900
Retry:900
Expire:604800
TTL:1800
num Entries:6


Domain:coroico.mx
Primary:ns45.domaincontrol.com
Mail:dns.jomax.net
Serial:2019061801
Refresh:28800
Retry:7200
Expire:604800
TTL:600
num Entries:2


Domain:blog.coroico.mx
Primary:ns45.domaincontrol.com
Mail:dns.jomax.net
Serial:2019061801
Refresh:28800
Retry:7200
Expire:604800
TTL:600
num Entries:2


Domain:www.blog.coroico.mx
Primary:ns45.domaincontrol.com
Mail:dns.jomax.net
Serial:2019061801
Refresh:28800
Retry:7200
Expire:604800
TTL:600
num Entries:1


5. Url-Checks


:

:
Domainname Http-StatusredirectSec.G
• http://blog.coroico.mx/
35.188.81.178
301
https://blog.coroico.mx/
Html is minified: 100.00 %
0.254
A
Date: Mon, 02 Dec 2019 23:07:24 GMT
Server: Apache
Location: https://blog.coroico.mx/
Content-Length: 232
Connection: close
Content-Type: text/html; charset=iso-8859-1

• http://www.blog.coroico.mx/
35.188.81.178
301
http://blog.coroico.mx/
0.347
D
Date: Mon, 02 Dec 2019 23:07:24 GMT
Server: Apache
X-Redirect-By: WordPress
Location: http://blog.coroico.mx/
Content-Length: 0
Connection: close
Content-Type: text/html; charset=UTF-8

• https://www.blog.coroico.mx/
35.188.81.178
301
https://blog.coroico.mx/
4.966
B
Date: Mon, 02 Dec 2019 23:07:31 GMT
Server: Apache
X-Redirect-By: WordPress
Location: https://blog.coroico.mx/
Content-Length: 0
Connection: close
Content-Type: text/html; charset=UTF-8

• https://blog.coroico.mx/
35.188.81.178 GZip used - 11234 / 59283 - 81.05 %
Inline-JavaScript (∑/total): 8/8188 Inline-CSS (∑/total): 4/390
200

Html is minified: 139.36 %
5.320
I
Date: Mon, 02 Dec 2019 23:07:25 GMT
Server: Apache
Link: <https://blog.coroico.mx/wp-json/>; rel="https://api.w.org/"
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 11234
Connection: close
Content-Type: text/html; charset=UTF-8

• http://blog.coroico.mx/.well-known/acme-challenge/check-your-website-dot-server-daten-dot-de
35.188.81.178
Inline-JavaScript (∑/total): 0/0 Inline-CSS (∑/total): 0/0
301
https://blog.coroico.mx/.well-known/acme-challenge/check-your-website-dot-server-daten-dot-de
Html is minified: 100.00 %
0.247
A
Visible Content: Moved Permanently The document has moved here .
Date: Mon, 02 Dec 2019 23:07:36 GMT
Server: Apache
Location: https://blog.coroico.mx/.well-known/acme-challenge/check-your-website-dot-server-daten-dot-de
Content-Length: 301
Connection: close
Content-Type: text/html; charset=iso-8859-1

• http://www.blog.coroico.mx/.well-known/acme-challenge/check-your-website-dot-server-daten-dot-de
35.188.81.178
301
http://blog.coroico.mx/.well-known/acme-challenge/check-your-website-dot-server-daten-dot-de
0.350
D
Visible Content:
Date: Mon, 02 Dec 2019 23:07:36 GMT
Server: Apache
Expires: Wed, 11 Jan 1984 05:00:00 GMT
Cache-Control: no-cache, must-revalidate, max-age=0
X-Redirect-By: WordPress
Location: http://blog.coroico.mx/.well-known/acme-challenge/check-your-website-dot-server-daten-dot-de
Content-Length: 0
Connection: close
Content-Type: text/html; charset=UTF-8

• https://blog.coroico.mx/.well-known/acme-challenge/check-your-website-dot-server-daten-dot-de

Inline-JavaScript (∑/total): 8/8293 Inline-CSS (∑/total): 4/390
404

Html is minified: 160.76 %
5.157
A
Not Found
Visible Content: Inicio Blog Page Not Found You can search for what you are looking. Síguenos facebook youtube mail Subscripción a noticias Registra tus datos para que te envíemos información nueva. Email * : e23423 COROICO 2019 Top
Info: Html-Content with meta and/or script, may be a problem creating a Letsencrypt certificate using http-01 validation
<!doctype html> <html lang="es-MX" class="is-menu-fixed"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <title>Página no encontrada - COROICO</title> <!-- This site is optimized with the Yoast SEO plugin v11.2.1 - https://yoast.com/wordpress/plugins/seo/ --> <meta name="robots" content="noindex,follow"/> <meta property="og:locale" content="es_MX" /> <meta property="og:type" content="object" /> <meta property="og:title" content="Página no encontrada - COROICO" /> <meta property="og:site_name" content="COROICO" /> <meta name="twitter:card" content="summary_large_image" /> <meta name="twitter:title" content="Página no encontrada - COROICO" /> <script type='application/ld+json' class='yoast-schema-graph yoast-schema-graph--main'>{"@context":"https://schema.org","@graph":[{"@type":"Organization","@id":"https://blog.coroico.mx/#organization","name":"COROICO","url":"https://blog.coroico.mx/","sameAs":[],"logo":{"@type":"ImageObject","@id":"https://blog.coroico.mx/#logo","url":"https://blog.coroico.mx/wp-content/uploads/2019/05/COROICO_LOGO-04-small-1.png","width":800,"height":151,"caption":"COROICO"},"image":{"@id":"https://blog.coroico.mx/#logo"}},{"@type":"WebSite","@id":"https://blog.coroico.mx/#website","url":"https://blog.coroico.mx/","name":"COROICO - Calidad en Tu Laboratorio Cl\u00ednico","publisher":{"@id":"https://blog.coroico.mx/#organization"},"potentialAction":{"@type":"SearchAction","target":"https://blog.coroico.mx/?s={search_term_string}","query-input":"required name=search_term_string"}}]}</script> <!-- / Yoast SEO plugin. --> <link rel='dns-prefetch' href='//ajax.googleapis.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="COROICO &raquo; Feed" href="https://blog.coroico.mx/feed/" /> <link rel="alternate" type="application/rss+xml" title="COROICO &raquo; RSS de los comentarios" href="https://blog.coroico.mx/comments/feed/" /> <meta property="og:site_name" content="COROICO" /> <meta property="og:description" content="Blog del Laboratorio Clínico" /> <meta property="og:type" content="website" /><!-- This site uses the Google Analytics by MonsterInsights plugin v7.10.0 - Using Analytics tracking - https://www.monsterinsights.com/ --> <script type="text/javascript" data-cfasync="false"> var mi_version = '7.10.0'; var mi_track_user = true; var mi_no_track_reason = ''; var disableStr = 'ga-disable-UA-140811556-1'; /* Function to detect opted out users */ function __gaTrackerIsOptedOut() { return document.cookie.indexOf(disableStr + '=true') > -1; } /* Disable tracking if the opt-out cookie exists. */ if ( __gaTrackerIsOptedOut() ) { window[disableStr] = true; } /* Opt-out function */ function __gaTrackerOptout() { document.cookie = disableStr + '=true; expires=Thu, 31 Dec 2099 23:59:59 UTC; path=/'; window[disableStr] = true; } if ( mi_track_user ) { (function(i,s,o,g,r,a,m){i['GoogleAnalyticsObject']=r;i[r]=i[r]||function(){ (i[r].q=i[r].q||[]).push(arguments)},i[r].l=1*new Date();a=s.createElement(o), m=s.getElementsByTagName(o)[0];a.async=1;a.src=g;m.parentNode.insertBefore(a,m) })(window,document,'script','//www.google-analytics.com/analytics.js','__gaTracker'); __gaTracker('create', 'UA-140811556-1', 'auto'); __gaTracker('set', 'forceSSL', true); __gaTracker('require', 'displayfeatures'); __gaTracker('send','pageview','/404.html?page=' + document.location.pathname + document.location.search + '&from=' + document.referrer); } else { console.log( "" ); (function() { /* https://developers.google.com/analytics/devguides/collection/analyticsjs/ */ var noopfn = function() { return null; }; var noopnullfn = function() { return null; }; var Tracker = function() { return null; }; var p = Tracker.prototype; p.get = noopfn; p.set = noopfn; p.send = noopfn; var __gaTracker = function() { var len = arguments.length; if ( len === 0 ) { return; } var f = arguments[len-1]; if ( typeof f !== 'object' || f === null || typeof f.hitCallback !== 'function' ) { console.log( 'Not running function __gaTracker(' + arguments[0] + " ....) because you are not being tracked. " + mi_no_track_reason ); return; } try { f.hitCallback(); } catch (ex) { } }; __gaTracker.create = function() { return new Tracker(); }; __gaTracker.getByName = noopnullfn; __gaTracker.getAll = function() { return []; }; __gaTracker.remove = noopfn; window['__gaTracker'] = __gaTracker; })(); } </script> <!-- / Google Analytics by MonsterInsights --> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/blog.coroico.mx\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.2.4"}}; !function(a,b,c){function d(a,b){var c=String.fromCharCode;l.clearRect(0,0,k.width,k.height),l.fillText(c.apply(this,a),0,0);var d=k.toDataURL();l.clearRect(0,0,k.width,k.height),l.fillText(c.apply(this,b),0,0);var e=k.toDataURL();return d===e}function e(a){var b;if(!l||!l.fillText)return!1;switch(l.textBaseline="top",l.font="600 32px Arial",a){case"flag":return!(b=d([55356,56826,55356,56819],[55356,56826,8203,55356,56819]))&&(b=d([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]),!b);case"emoji":return b=d([55357,56424,55356,57342,8205,55358,56605,8205,55357,56424,55356,57340],[55357,56424,55356,57342,8203,55358,56605,8203,55357,56424,55356,57340]),!b}return!1}function f(a){var c=b.createElement("script");c.src=a,c.defer=c.type="text/javascript",b.getElementsByTagName("head")[0].appendChild(c)}var g,h,i,j,k=b.createElement("canvas"),l=k.getContext&&k.getContext("2d");for(j=Array("flag","emoji"),c.supports={everything:!0,everythingExceptFlag:!0},i=0;i<j.length;i++)c.supports[j[i]]=e(j[i]),c.supports.everything=c.supports.everything&&c.supports[j[i]],"flag"!==j[i]&&(c.supports.everythingExceptFlag=c.supports.everythingExceptFlag&&c.supports[j[i]]);c.supports.everythingExceptFlag=c.supports.everythingExceptFlag&&!c.supports.flag,c.DOMReady=!1,c.readyCallback=function(){c.DOMReady=!0},c.supports.everything||(h=function(){c.readyCallback()},b.addEventListener?(b.addEventListener("DOMContentLoaded",h,!1),a.addEventListener("load",h,!1)):(a.attachEvent("onload",h),b.attachEvent("onreadystatechange",function(){"complete"===b.readyState&&c.readyCallback()})),g=c.source||{},g.concatemoji?f(g.concatemoji):g.wpemoji&&g.twemoji&&(f(g.twemoji),f(g.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link property="stylesheet" rel='stylesheet' id='wp-block-library-css' href='https://blog.coroico.mx/wp-includes/css/dist/block-library/style.min.css?ver=5.2.4' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='contact-form-7-css' href='https://blog.coroico.mx/wp-content/plugins/contact-form-7/includes/css/styles.css?ver=5.1.3' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='jquery-ui-theme-css' href='https://ajax.googleapis.com/ajax/libs/jqueryui/1.11.4/themes/smoothness/jquery-ui.min.css?ver=1.11.4' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='jquery-ui-timepicker-css' href='https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/jquery-ui-timepicker-addon.min.css?ver=5.2.4' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='trx_addons-icons-css' href='https://blog.coroico.mx/wp-content/plugins/trx_addons/css/font-icons/css/trx_addons_icons-embedded.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='swiperslider-css' href='https://blog.coroico.mx/wp-content/plugins/trx_addons/js/swiper/swiper.min.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='magnific-popup-css' href='https://blog.coroico.mx/wp-content/plugins/trx_addons/js/magnific/magnific-popup.min.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='trx_addons-css' href='https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='trx_addons-animation-css' href='https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.animation.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='my-open-sans-css' href='//fonts.googleapis.com/css?family=Open+Sans:300italic,400italic,600italic,700italic,800italic,400,800,700,600,300&#038;subset=latin' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='droid-serif-css' href='//fonts.googleapis.com/css?family=Droid+Serif:400,700,700italic,400italic&#038;subset=latin' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='bootstrap-css' href='https://blog.coroico.mx/wp-content/themes/editor-wp/css/bootstrap.min.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='fontello-css' href='https://blog.coroico.mx/wp-content/themes/editor-wp/css/fonts/fontello/css/fontello.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='uniform-css' href='https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.uniform/uniform.default.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='fluidbox-css' href='https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fluidbox/fluidbox.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='owl-carousel-css' href='https://blog.coroico.mx/wp-content/themes/editor-wp/js/owl-carousel/owl.carousel.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='selection-sharer-css' href='https://blog.coroico.mx/wp-content/themes/editor-wp/js/selection-sharer/selection-sharer.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='elastislide-css' href='https://blog.coroico.mx/wp-content/themes/editor-wp/js/responsive-image-gallery/elastislide.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='main-css' href='https://blog.coroico.mx/wp-content/themes/editor-wp/css/main.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='768-css' href='https://blog.coroico.mx/wp-content/themes/editor-wp/css/768.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='992-css' href='https://blog.coroico.mx/wp-content/themes/editor-wp/css/992.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='wp-fix-css' href='https://blog.coroico.mx/wp-content/themes/editor-wp/css/wp-fix.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='theme-style-css' href='https://blog.coroico.mx/wp-content/themes/editor-wp/style.css' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='socicon-css' href='https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/socicon.css?ver=20181009' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='genericons-css' href='https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/genericons.css?ver=20180625' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='academicons-css' href='https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/academicons.min.css?ver=20190406' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='fontawesome-css' href='https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/font-awesome.min.css?ver=20180625' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='dashicons-css' href='https://blog.coroico.mx/wp-includes/css/dashicons.min.css?ver=5.2.4' type='text/css' media='all' /> <link property="stylesheet" rel='stylesheet' id='trx_addons-responsive-css' href='https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.responsive.css' type='text/css' media='all' /> <script type='text/javascript'> /* <![CDATA[ */ var monsterinsights_frontend = {"js_events_tracking":"true","download_extensions":"doc,pdf,ppt,zip,xls,docx,pptx,xlsx","inbound_paths":"[{\"path\":\"\\\/go\\\/\",\"label\":\"affiliate\"},{\"path\":\"\\\/recommend\\\/\",\"label\":\"affiliate\"}]","home_url":"https:\/\/blog.coroico.mx","hash_tracking":"false"}; /* ]]> */ </script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/plugins/google-analytics-for-wordpress/assets/js/frontend.min.js?ver=7.10.0'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-includes/js/jquery/jquery.js?ver=1.12.4-wp'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-includes/js/jquery/jquery-migrate.min.js?ver=1.4.1'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/modernizr.min.js'></script> <link rel='https://api.w.org/' href='https://blog.coroico.mx/wp-json/' /> <link rel="EditURI" type="application/rsd+xml" title="RSD" href="https://blog.coroico.mx/xmlrpc.php?rsd" /> <link rel="wlwmanifest" type="application/wlwmanifest+xml" href="https://blog.coroico.mx/wp-includes/wlwmanifest.xml" /> <meta name="generator" content="WordPress 5.2.4" /> <div id="fb-root"></div> <script async defer crossorigin="anonymous" src="https://connect.facebook.net/en_US/sdk.js#xfbml=1&version=v3.3"></script><style type="text/css">0</style> <script> (function(h,o,t,j,a,r){ h.hj=h.hj||function(){(h.hj.q=h.hj.q||[]).push(arguments)}; h._hjSettings={hjid:1339894,hjsv:5}; a=o.getElementsByTagName('head')[0]; r=o.createElement('script');r.async=1; r.src=t+h._hjSettings.hjid+j+h._hjSettings.hjsv; a.appendChild(r); })(window,document,'//static.hotjar.com/c/hotjar-','.js?sv='); </script> <!-- Body Font --> <link rel="stylesheet" type="text/css" href="//fonts.googleapis.com/css?family=Open+Sans:400,700,400italic,700italic&subset=latin"> <style type="text/css"> body, input, textarea, select, button { font-family: "Open Sans"; } </style> <!--[if lt IE 9]> <script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/ie.js"></script> <![endif]--> <link rel="icon" href="https://blog.coroico.mx/wp-content/uploads/2019/05/cropped-COROICO_LOGO-04-small-1-1-32x32.png" sizes="32x32" /> <link rel="icon" href="https://blog.coroico.mx/wp-content/uploads/2019/05/cropped-COROICO_LOGO-04-small-1-1-192x192.png" sizes="192x192" /> <link rel="apple-touch-icon-precomposed" href="https://blog.coroico.mx/wp-content/uploads/2019/05/cropped-COROICO_LOGO-04-small-1-1-180x180.png" /> <meta name="msapplication-TileImage" content="https://blog.coroico.mx/wp-content/uploads/2019/05/cropped-COROICO_LOGO-04-small-1-1-270x270.png" /> <style type="text/css" id="wp-custom-css"> .site-title img{ width: 30%; } </style> </head> <body class="error404"> <div id="page" class="hfeed site"> <header id="masthead" class="site-header" role="banner"> <nav id="primary-navigation" class="site-navigation primary-navigation" role="navigation"> <a class="menu-toggle"><span class="lines"></span></a> <div class="nav-menu"> <ul id="nav" class="menu-custom"><li id="menu-item-10" class="menu-item menu-item-type-custom menu-item-object-custom menu-item-10"><a href="http://coroico.mx/">Inicio</a></li> <li id="menu-item-14" class="menu-item menu-item-type-custom menu-item-object-custom menu-item-home menu-item-14"><a href="http://blog.coroico.mx">Blog</a></li> </ul> </div> <div class="social-container"> </div> </nav> <h1 class="site-title"> <a href="https://coroico.mx/" rel="home"> <img alt="COROICO" src="http://blog.coroico.mx/wp-content/uploads/2019/05/COROICO_LOGO-04-small-1.png"> </a> </h1> </header> <div id="main" class="site-main"> <div id="primary" class="content-area"> <div id="content" class="site-content" role="main"> <div class="layout-medium"> <article class="hentry page page-404"> <header class="entry-header"> <h1 class="entry-title">Page Not Found</h1> </header> <div class="entry-content"> <div class="http-alert"> <h1> <i class="pw-icon-paper-plane"></i> </h1> </div> <p>You can search for what you are looking.</p> <form method="get" action="https://blog.coroico.mx/"> <input type="text" id="search-big" name="s" placeholder="enter keyword"> </form> </div> </article> </div> </div> </div> </div> <footer id="colophon" class="site-footer" role="contentinfo"> <div class="layout-medium"> <div class="footer-social"> <span style="display: none;">Síguenos</span> <ul class="zoom-social-icons-list zoom-social-icons-list--with-canvas zoom-social-icons-list--rounded zoom-social-icons-list--no-labels"> <li class="zoom-social_icons-list__item"> <a class="zoom-social_icons-list__link" href="https://www.facebook.com/Coroico-2242068165870172" target="_blank" > <span class="screen-reader-text">facebook</span> <span class="zoom-social_icons-list-span socicon socicon-facebook" data-hover-rule="background-color" data-hover-color="#3b5998" style="background-color : #3b5998; font-size: 18px; padding:8px"></span> </a> </li> <li class="zoom-social_icons-list__item"> <a class="zoom-social_icons-list__link" href="https://www.youtube.com/channel/UC9_CGY043vdzRto5JJ2Azjw" target="_blank" > <span class="screen-reader-text">youtube</span> <span class="zoom-social_icons-list-span socicon socicon-youtube" data-hover-rule="background-color" data-hover-color="#e02a20" style="background-color : #e02a20; font-size: 18px; padding:8px"></span> </a> </li> <li class="zoom-social_icons-list__item"> <a class="zoom-social_icons-list__link" href="mailto:info@atlatlgroup.com" target="_blank" > <span class="screen-reader-text">mail</span> <span class="zoom-social_icons-list-span socicon socicon-mail" data-hover-rule="background-color" data-hover-color="#000000" style="background-color : #000000; font-size: 18px; padding:8px"></span> </a> </li> </ul> </div> <div class="footer-sidebar widget-area" role="complementary"> <aside id="sendgrid_nlvx_widget-3" class="widget widget_sendgrid_nlvx_widget"><h3 class="widget-title">Subscripción a noticias</h3><p class="sendgrid_widget_text">Registra tus datos para que te envíemos información nueva.</p><form method="post" id="sendgrid_mc_email_form" class="mc_email_form" action="#sendgrid_mc_email_subscribe" style="padding-top: 10px;"><div class="sendgrid_mc_fields" style="padding: 10px 0px 0px 0px;"> <div class="sendgrid_mc_label_div"> <label for="sendgrid_mc_email" class="sendgrid_mc_label sendgrid_mc_label_email">Email<sup>*</sup> :</label> </div> <div class="sendgrid_mc_input_div"> <input class="sendgrid_mc_input sendgrid_mc_input_email" id="sendgrid_mc_email" name="sendgrid_mc_email" type="text" value="" required/> </div></div><div class="sendgrid_mc_button_div"> <input style="margin: 10px 0px 0px 0px;" class="sendgrid_mc_button" type="submit" id="sendgrid_mc_email_submit" value="SUBSCRIBIRTE" /></div></form></aside> </div> </div> <div class="site-info"> <div class="layout-medium"> <div id="text-5" class="widget_text"><span style="display: none;">e23423</span> <div class="textwidget"><p>COROICO 2019</p> </div> </div> </div> </div> </footer> </div> <a href="#" class="trx_addons_scroll_to_top trx_addons_icon-up" title="Scroll to top"><span>Top</span></a><script src="https://tools.pinpoll.com/global.js" async></script><script type='text/javascript'> /* <![CDATA[ */ var wpcf7 = {"apiSettings":{"root":"https:\/\/blog.coroico.mx\/wp-json\/contact-form-7\/v1","namespace":"contact-form-7\/v1"}}; /* ]]> */ </script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/plugins/contact-form-7/includes/js/scripts.js?ver=5.1.3'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-includes/js/jquery/ui/core.min.js?ver=1.11.4'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-includes/js/jquery/ui/datepicker.min.js?ver=1.11.4'></script> <script type='text/javascript'> jQuery(document).ready(function(jQuery){jQuery.datepicker.setDefaults({"closeText":"Cerrar","currentText":"Hoy","monthNames":["enero","febrero","marzo","abril","mayo","junio","julio","agosto","septiembre","octubre","noviembre","diciembre"],"monthNamesShort":["Ene","Feb","Mar","Abr","May","Jun","Jul","Ago","Sep","Oct","Nov","Dic"],"nextText":"Siguiente","prevText":"Previo","dayNames":["domingo","lunes","martes","mi\u00e9rcoles","jueves","viernes","s\u00e1bado"],"dayNamesShort":["dom","lun","mar","mi\u00e9","jue","vie","s\u00e1b"],"dayNamesMin":["D","L","M","X","J","V","S"],"dateFormat":"d MM, yy","firstDay":1,"isRTL":false});}); </script> <script type='text/javascript' src='https://ajax.googleapis.com/ajax/libs/jqueryui/1.11.4/i18n/datepicker-es.min.js?ver=1.11.4'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/jquery-ui-timepicker-addon.min.js?ver=5.2.4'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/i18n/jquery-ui-timepicker-es.js?ver=5.2.4'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-includes/js/jquery/ui/widget.min.js?ver=1.11.4'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-includes/js/jquery/ui/mouse.min.js?ver=1.11.4'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-includes/js/jquery/ui/slider.min.js?ver=1.11.4'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-includes/js/jquery/ui/button.min.js?ver=1.11.4'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-sliderAccess.js?ver=5.2.4'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/plugins/trx_addons/js/swiper/swiper.jquery.min.js'></script> <script type='text/javascript'> /* <![CDATA[ */ var su_magnific_popup = {"close":"Close (Esc)","loading":"Loading...","prev":"Previous (Left arrow key)","next":"Next (Right arrow key)","counter":"%curr% of %total%","error":"Failed to load this link. <a href=\"%url%\" target=\"_blank\"><u>Open link<\/u><\/a>."}; /* ]]> */ </script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/plugins/trx_addons/js/magnific/jquery.magnific-popup.min.js'></script> <script type='text/javascript'> /* <![CDATA[ */ var TRX_ADDONS_STORAGE = {"ajax_url":"https:\/\/blog.coroico.mx\/wp-admin\/admin-ajax.php","ajax_nonce":"ec648afe01","site_url":"https:\/\/blog.coroico.mx","post_id":"306","vc_edit_mode":"0","popup_engine":"magnific","animate_inner_links":"0","menu_collapse":"1","menu_collapse_icon":"trx_addons_icon-ellipsis-vert","user_logged_in":"0","email_mask":"^([a-zA-Z0-9_\\-]+\\.)*[a-zA-Z0-9_\\-]+@[a-z0-9_\\-]+(\\.[a-z0-9_\\-]+)*\\.[a-z]{2,6}$","msg_ajax_error":"Invalid server answer!","msg_magnific_loading":"Loading image","msg_magnific_error":"Error loading image","msg_error_like":"Error saving your like! Please, try again later.","msg_field_name_empty":"The name can't be empty","msg_field_email_empty":"Too short (or empty) email address","msg_field_email_not_valid":"Invalid email address","msg_field_text_empty":"The message text can't be empty","msg_search_error":"Search error! Try again later.","msg_send_complete":"Send message complete!","msg_send_error":"Transmit failed!","msg_validation_error":"Error data validation!","msg_name_empty":"The name can't be empty","msg_name_long":"Too long name","msg_email_empty":"Too short (or empty) email address","msg_email_long":"E-mail address is too long","msg_email_not_valid":"E-mail address is invalid","msg_text_empty":"The message text can't be empty","ajax_views":"","menu_cache":[],"login_via_ajax":"1","msg_login_empty":"The Login field can't be empty","msg_login_long":"The Login field is too long","msg_password_empty":"The password can't be empty and shorter then 4 characters","msg_password_long":"The password is too long","msg_login_success":"Login success! The page should be reloaded in 3 sec.","msg_login_error":"Login failed!","msg_not_agree":"Please, read and check 'Terms and Conditions'","msg_password_not_equal":"The passwords in both fields are not equal","msg_registration_success":"Registration success! Please log in!","msg_registration_error":"Registration failed!","shapes_url":""}; /* ]]> */ </script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/plugins/trx_addons/js/trx_addons.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/fastclick.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fitvids.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.validate.min.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.uniform/jquery.uniform.min.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-includes/js/imagesloaded.min.js?ver=3.2.0'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.isotope.min.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fluidbox/jquery.fluidbox.min.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/owl-carousel/owl.carousel.min.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/readingTime.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/selection-sharer/selection-sharer.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/responsive-image-gallery/r-gallery.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/socialstream.jquery.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/main.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/themes/editor-wp/js/wp-fix.js'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/js/social-icons-widget-frontend.js?ver=20170209'></script> <script type='text/javascript' src='https://blog.coroico.mx/wp-includes/js/wp-embed.min.js?ver=5.2.4'></script> </body> </html>
Date: Mon, 02 Dec 2019 23:07:37 GMT
Server: Apache
Expires: Wed, 11 Jan 1984 05:00:00 GMT
Cache-Control: no-cache, must-revalidate, max-age=0
Link: <https://blog.coroico.mx/wp-json/>; rel="https://api.w.org/"
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

6. Comments (GZip / Html minfied / Cache-Control is beta)

Aname "blog.coroico.mx" is subdomain, public suffix is "mx", top-level-domain-type is "country-code", Country is Mexico, tld-manager is "NIC-Mexico ITESM - Campus Monterrey"
Agood: All ip addresses are public addresses
Agood: No asked Authoritative Name Server had a timeout
Agood: destination is https
Agood - only one version with Http-Status 200
Agood: one preferred version: non-www is preferred
HSTS-Preload-Status: unknown. Domain never included in the Preload-list. Check https://hstspreload.org/ to learn some basics about the Google-Preload-List.
AGood: All urls with http status 200/404 have a complete Content-Type header (MediaType / MediaSubType + correct charset)
Ahttp://blog.coroico.mx/ 35.188.81.178
301
https://blog.coroico.mx/
correct redirect http - https with the same domain name
Bhttps://blog.coroico.mx/ 35.188.81.178
200

Missing HSTS-Header
Bhttps://www.blog.coroico.mx/ 35.188.81.178
301

Missing HSTS-Header
Dhttp://www.blog.coroico.mx/ 35.188.81.178
301
http://blog.coroico.mx/
Wrong redirect one domain http to other domain http. First redirect to https without changing the domain, so no new dns query is required. So the server can send the HSTS header. That's fundamental using HSTS (Http Strict Transport Security). First step: Add correct redirects http ⇒ https. Perhaps in your port 80 vHost something like "RewriteEngine on" + "RewriteRule ^ https://%{SERVER_NAME}%{REQUEST_URI} [END,QSA,R=permanent]" (two rows, without the "). Don't add this in your port 443 vHost, that would create a loop. Then recheck your domain, should be Grade C. There is the rule to select one https version as preferred version.
Dhttp://www.blog.coroico.mx/.well-known/acme-challenge/check-your-website-dot-server-daten-dot-de 35.188.81.178
301
http://blog.coroico.mx/.well-known/acme-challenge/check-your-website-dot-server-daten-dot-de
Wrong redirect one domain http to other domain http. First redirect to https without changing the domain, so no new dns query is required. So the server can send the HSTS header. That's fundamental using HSTS (Http Strict Transport Security). First step: Add correct redirects http ⇒ https. Perhaps in your port 80 vHost something like "RewriteEngine on" + "RewriteRule ^ https://%{SERVER_NAME}%{REQUEST_URI} [END,QSA,R=permanent]" (two rows, without the "). Don't add this in your port 443 vHost, that would create a loop. Then recheck your domain, should be Grade C. There is the rule to select one https version as preferred version.
Ihttps://blog.coroico.mx/ 35.188.81.178
200

Content problems or problems with resources included - http links, files doesn't exist, different Content-Type definitions
Ihttps://blog.coroico.mx/.well-known/acme-challenge/check-your-website-dot-server-daten-dot-de
404

Content problems or problems with resources included - http links, files doesn't exist, different Content-Type definitions. Not used to calculate the result because it's a http or /.well-known/acme-challenge - check. But listet so you should fix it.
AGood: Nameserver supports TCP connections: 2 good Nameserver
AGood: Nameserver supports Echo Capitalization: 2 good Nameserver
AGood: Nameserver supports EDNS with max. 512 Byte Udp payload, message is smaller: 2 good Nameserver
AGood: Nameserver has passed 10 EDNS-Checks (OP100, FLAGS, V1, V1OP100, V1FLAGS, DNSSEC, V1DNSSEC, NSID, COOKIE, CLIENTSUBNET): 1 good Nameserver
Nameserver doesn't pass all EDNS-Checks: ns45.domaincontrol.com / 2603:5:2162::17: OP100: ok. FLAGS: ok. V1: ok. V1OP100: ok. V1FLAGS: ok. DNSSEC: ok. V1DNSSEC: ok. NSID: no result. COOKIE: ok. CLIENTSUBNET: ok.
AGood: All SOA have the same Serial Number
Warning: No CAA entry with issue/issuewild found, every CAA can create a certificate. Read https://en.wikipedia.org/wiki/DNS_Certification_Authority_Authorization to learn some basics about the idea of CAA. Your name server must support such an entry. Not all dns providers support CAA entries.
AGood: All checks /.well-known/acme-challenge/random-filename without redirects answer with the expected http status 404 - Not Found. Creating a Letsencrypt certificate via http-01 challenge should work. If it doesn't work: Check your vHost configuration (apachectl -S, httpd -S, nginx -T). Every combination of port and ServerName / ServerAlias (Apache) or Server (Nginx) must be unique. Merge duplicated entries in one vHost. If you use an IIS, extensionless files must be allowed in the /.well-known/acme-challenge subdirectory. Create a web.config in that directory. Content: <configuration><system.webServer><staticContent><mimeMap fileExtension="." mimeType="text/plain" /></staticContent></system.webServer></configuration>. If you have a redirect http ⇒ https, that's ok, Letsencrypt follows such redirects to port 80 / 443 (same or other server). There must be a certificate. But the certificate may be expired, self signed or with a not matching domain name. Checking the validation file Letsencrypt ignores such certificate errors. Trouble creating a certificate? Use https://community.letsencrypt.org/ to ask.
AGood: Every https result with status 200 supports GZip.
https://blog.coroico.mx/ 35.188.81.178
200

Warning: Https + http status 200 + Inline CSS / JavaScript found. Don't use inline CSS / JavaScript. These are compiled and re-used ressources, save these with a long Cache-Control max-age - header.
https://blog.coroico.mx/ 35.188.81.178
200

Warning: Https result with status 200 found, Html-Content is too big. Should be max. 110 %. May contain inline CSS / JavaScript, too much comments or white space. Re-used ressources - create files with a long Cache-Control max-age header. Remove comments and white space.
https://blog.coroico.mx/ 35.188.81.178
200

Warning: Https connections (Standard Port 443) found without support of the http/2 protocol via ALPN. Http/2 is the new Http-Version (old: http 1.1) with some important new features. Update your server software so http/2 is available. Only one TCP-connection per Server (that's a performance boost), Header-Compression and Server Pushs are available. Domain Sharding and Inline-CSS/Javascript shouldn't used with http/2.
AGood: All CSS / JavaScript files are sent with GZip. That reduces the content of the files. 132 external CSS / JavaScript files found
AGood: All images with internal compression not sent via GZip. Images (.png, .jpg) are already compressed, so an additional GZip isn't helpful. 47 images (type image/png, image/jpg) found without additional GZip. Not required because these images are already compressed
Warning: CSS / JavaScript files with a missing or too short Cache-Control header found. Browsers should cache and re-use these files. 118 external CSS / JavaScript files without Cache-Control-Header, 0 with Cache-Control, but no max-age, 10 with Cache-Control max-age too short (minimum 7 days), 4 with Cache-Control long enough, 132 complete.
Warning: Images with a missing or too short Cache-Control header found. Browsers should cache and re-use these files. 68 image files without Cache-Control-Header, 0 with Cache-Control, but no max-age, 0 with Cache-Control max-age too short (minimum 7 days), 0 with Cache-Control long enough, 68 complete.
AGood: Domainname is not on the "Specially Designated Nationals And Blocked Persons List" (SDN). That's an US-list of individuals and companies owned or controlled by, or acting for or on behalf of, targeted countries. It also lists individuals, groups, and entities, such as terrorists and narcotics traffickers designated under programs that are not country-specific. Collectively, such individuals and companies are called "Specially Designated Nationals" or "SDNs." Their assets are blocked and U.S. persons are generally prohibited from dealing with them. So if a domain name is on that list, it's impossible to create a Letsencrypt certificate with that domain name. Check the list manual - https://www.treasury.gov/resource-center/sanctions/sdn-list/pages/default.aspx
https://blog.coroico.mx/.well-known/acme-challenge/check-your-website-dot-server-daten-dot-de
404
5.157 seconds
Warning: 404 needs more then one second
ADuration: 230240 milliseconds, 230.240 seconds


7. Connections (http/2- and additional Tls.1.0/1.1/1.2 checks are BETA)

DomainIPPortCert.ProtocolKeyExchangeStrengthCipherStrengthHashAlgorithmOCSP stapling
Domain/KeyExchangeIP/StrengthPort/CipherCert./StrengthProtocol/HashAlgorithmOCSP stapling
blog.coroico.mx
35.188.81.178
443
ok
Tls12
ECDH Ephermal
256
Aes256
256
Sha384
error checking OCSP stapling
ok
blog.coroico.mx
35.188.81.178
443
ok
Tls12

ECDH Ephermal
256
Aes256
256
Sha384
error checking OCSP stapling
ok
no http/2 via ALPN Tls.1.2
Tls.1.1
Tls.1.0
no http/2 via ALPN Tls.1.2
Tls.1.1
Tls.1.0
Chain (complete)
1CN=blog.coroico.mx

2CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
www.blog.coroico.mx
35.188.81.178
443
ok
Tls12
ECDH Ephermal
256
Aes256
256
Sha384
error checking OCSP stapling
ok
www.blog.coroico.mx
35.188.81.178
443
ok
Tls12

ECDH Ephermal
256
Aes256
256
Sha384
error checking OCSP stapling
ok
no http/2 via ALPN Tls.1.2
Tls.1.1
Tls.1.0
no http/2 via ALPN Tls.1.2
Tls.1.1
Tls.1.0
Chain (complete)
1CN=blog.coroico.mx

2CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
blog.coroico.mx
blog.coroico.mx
443
ok
Tls12
ECDH Ephermal
256
Aes256
256
Sha384
error checking OCSP stapling
ok
blog.coroico.mx
blog.coroico.mx
443
ok
Tls12

ECDH Ephermal
256
Aes256
256
Sha384
error checking OCSP stapling
ok
no http/2 via ALPN Tls.1.2
Tls.1.1
Tls.1.0
no http/2 via ALPN Tls.1.2
Tls.1.1
Tls.1.0
Chain (complete)
1CN=blog.coroico.mx

2CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US


8. Certificates

1.
1.
CN=blog.coroico.mx
22.09.2019
21.12.2019
expires in 11 days
blog.coroico.mx, vlog.coroico.mx, www.blog.coroico.mx - 3 entries
1.
1.
CN=blog.coroico.mx
22.09.2019

21.12.2019
expires in 11 days
blog.coroico.mx, vlog.coroico.mx, www.blog.coroico.mx - 3 entries

KeyalgorithmRSA encryption (2048 bit)
Signatur:SHA256 With RSA-Encryption
Serial Number:03243932178CFCC1F7318C4A41E5FE1C411A
Thumbprint:5ACF626A15187984BB6F058899DB64CDFE3291CF
SHA256 / Certificate:Znv19enUXfkQpA1SwIKMPIOljalPRuVXEOheGKp9aWg=
SHA256 hex / Cert (DANE * 0 1):e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855
SHA256 hex / PublicKey (DANE * 1 1):b02d2ac1f199784ac61f98e72964d82e4fd1171cf00c2ca20ff0d4c0d902f3b2
OCSP - Url:http://ocsp.int-x3.letsencrypt.org
OCSP - must staple:no
Certificate Transparency:yes


2.
CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
17.03.2016
17.03.2021
expires in 463 days


2.
CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
17.03.2016

17.03.2021
expires in 463 days


KeyalgorithmRSA encryption (2048 bit)
Signatur:SHA256 With RSA-Encryption
Serial Number:0A0141420000015385736A0B85ECA708
Thumbprint:E6A3B45B062D509B3382282D196EFE97D5956CCB
SHA256 / Certificate:JYR9Zo608E/dQLErawdAxWfafQJDCOtsLJb+QdneIY0=
SHA256 hex / Cert (DANE * 0 1):25847d668eb4f04fdd40b12b6b0740c567da7d024308eb6c2c96fe41d9de218d
SHA256 hex / PublicKey (DANE * 1 1):60b87575447dcba2a36b7d11ac09fb24a9db406fee12d2cc90180517616e8a18
OCSP - Url:http://isrg.trustid.ocsp.identrust.com
OCSP - must staple:no
Certificate Transparency:no


3.
CN=DST Root CA X3, O=Digital Signature Trust Co.
30.09.2000
30.09.2021
expires in 660 days


3.
CN=DST Root CA X3, O=Digital Signature Trust Co.
30.09.2000

30.09.2021
expires in 660 days


KeyalgorithmRSA encryption (2048 bit)
Signatur:SHA-1 with RSA Encryption
Serial Number:44AFB080D6A327BA893039862EF8406B
Thumbprint:DAC9024F54D8F6DF94935FB1732638CA6AD77C13
SHA256 / Certificate:BocmAzGnJAPZCfEF5pvPDTLhvSST/8bZIG0RvNZ3Bzk=
SHA256 hex / Cert (DANE * 0 1):0687260331a72403d909f105e69bcf0d32e1bd2493ffc6d9206d11bcd6770739
SHA256 hex / PublicKey (DANE * 1 1):563b3caf8cfef34c2335caf560a7a95906e8488462eb75ac59784830df9e5b2b
OCSP - Url:
OCSP - must staple:no
Certificate Transparency:no



9. Last Certificates - Certificate Transparency Log Check

1. Source CertSpotter - active certificates

Issuerlast 7 daysactivenum Certs
CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
0
3
3

CertSpotter-IdIssuernot beforenot afterDomain namesLE-Duplicatenext LE
1260912507
leaf cert
CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
2019-11-22 09:33:07
2020-02-20 09:33:07
blog.coroico.mx, www.blog.coroico.mx - 2 entries


1144610606
leaf cert
CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
2019-09-22 17:03:52
2019-12-21 17:03:52
blog.coroico.mx, vlog.coroico.mx, www.blog.coroico.mx - 3 entries


1144602299
leaf cert
CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
2019-09-22 16:59:38
2019-12-21 16:59:38
blog.coroico.mx, www.blog.coroico.mx - 2 entries



2. Source crt.sh - old and new certificates, sometimes very slow (currently no newer certificates - read Crt.sh has stopped - Letsencrypt-forum - may work next week again - 2019-12-02 - but I must check the code).

Issuerlast 7 daysactivenum Certs
CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
0 /0 new
3
6

CRT-IdIssuernot beforenot afterDomain namesLE-Duplicatenext LE
2140789382
precert
CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
2019-11-22 08:33:07
2020-02-20 08:33:07
blog.coroico.mx, www.blog.coroico.mx
2 entries


1922170936
leaf cert
CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
2019-09-22 15:03:52
2019-12-21 16:03:52
blog.coroico.mx, vlog.coroico.mx, www.blog.coroico.mx
3 entries


1946262595
leaf cert
CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
2019-09-22 14:59:38
2019-12-21 15:59:38
blog.coroico.mx, www.blog.coroico.mx
2 entries


1598240664
leaf cert
CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
2019-06-18 14:33:53
2019-09-16 14:33:53
blog.coroico.mx, vlog.coroico.mx, www.blog.coroico.mx
3 entries


1618971287
leaf cert
CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
2019-06-18 13:56:02
2019-09-16 13:56:02
blog.coroico.mx, vlog.coroico.mx
2 entries


1500355563
leaf cert
CN=Let's Encrypt Authority X3, O=Let's Encrypt, C=US
2019-05-20 21:21:59
2019-08-18 21:21:59
blog.coroico.mx
1 entries



10. Html-Content - Entries

Summary

Subresource Integrity (SRI)
DomainnameHtmlElementrel/property∑ size∑ problems∑ int.∑ ext.∑ Origin poss.∑ SRI ParseErrors∑ SRI valid∑ SRI missing
https://blog.coroico.mx/
35.188.81.178
a

74

0







form

3
33,702 Bytes
0
3
0





img

12
1,464,114 Bytes
1
56
0





link
alternate
2

0







link
dns-prefetch
3

0







link
stylesheet
30
157,957 Bytes
0
26
4
4
0
0
-4

link
other
8
32,844 Bytes
0
4
0





meta
og
9
11,234 Bytes
0
1
0





meta
twitter
3

0







meta
other
5
38,026 Bytes
0
1
0





script

36
215,952 Bytes
0
33
3
2
0
0
-2

style-attribute

5
1,111,154 Bytes
0
5
0




https://blog.coroico.mx/.well-known/acme-challenge/check-your-website-dot-server-daten-dot-de
a

8

0







form

2
11,234 Bytes
1
2
0





img

1

1







link
alternate
2

0







link
dns-prefetch
3

0







link
stylesheet
30
157,957 Bytes
0
26
4
4
0
0
-4

link
other
6
32,844 Bytes
0
4
0





meta
og
7

0







meta
twitter
2

0







meta
other
5
38,026 Bytes
0
1
0





script

36
215,952 Bytes
0
33
3
2
0
0
-2

Details (GZip part is BETA, may be wrong / incomplete)

DomainnameHtml-Elementname/equiv/ property/relhref/src/contentHttpStatusmsgStatus
https://blog.coroico.mx/
35.188.81.178
a




1
ok








a

#


1
ok








a

http://blog.coroico.mx


1
ok








a

http://coroico.mx/


1
ok








a

https://blog.coroico.mx/category/acreditacion/


1
ok








a

https://blog.coroico.mx/category/administracion/


3
ok








a

https://blog.coroico.mx/category/certificacion/


1
ok








a

https://blog.coroico.mx/category/control-de-calidad/


4
ok








a

https://blog.coroico.mx/category/direccion/


10
ok








a

https://blog.coroico.mx/category/entrega-de-resultados/


1
ok








a

https://blog.coroico.mx/category/recursos-humanos/


1
ok








a

https://blog.coroico.mx/category/toma-de-muestra/


2
ok








a

https://blog.coroico.mx/como-creo-mi-procedimiento-de-toma-de-muestra/


2
ok








a

https://blog.coroico.mx/como-creo-mi-procedimiento-de-toma-de-muestra/#respond


1
ok








a

https://blog.coroico.mx/como-hacer-mi-manual-para-el-manejo-de-los-residuos-peligrosos/


4
ok








a

https://blog.coroico.mx/como-hacer-mi-manual-para-el-manejo-de-los-residuos-peligrosos/#comments


1
ok








a

https://blog.coroico.mx/como-hacer-un-foda-para-mi-laboratorio/


4
ok








a

https://blog.coroico.mx/como-hacer-un-foda-para-mi-laboratorio/#respond


1
ok








a

https://blog.coroico.mx/como-seleccionar-un-nuevo-analizador-para-mi-laboratorio/


4
ok








a

https://blog.coroico.mx/como-seleccionar-un-nuevo-analizador-para-mi-laboratorio/#respond


1
ok








a

https://blog.coroico.mx/como-uso-las-reglas-de-westgard/


2
ok








a

https://blog.coroico.mx/como-uso-las-reglas-de-westgard/#respond


1
ok








a

https://blog.coroico.mx/con-que-frecuencia-debo-correr-los-controles-en-tu-laboratorio/


2
ok








a

https://blog.coroico.mx/con-que-frecuencia-debo-correr-los-controles-en-tu-laboratorio/#respond


1
ok








a

https://blog.coroico.mx/el-secreto-para-crecer-tu-laboratorio-clinico/


4
ok








a

https://blog.coroico.mx/el-secreto-para-crecer-tu-laboratorio-clinico/#respond


1
ok








a

https://blog.coroico.mx/page/2/


1
ok








a

https://blog.coroico.mx/reglas-de-westgard-ejemplos/


2
ok








a

https://blog.coroico.mx/reglas-de-westgard-ejemplos/#respond


1
ok








a

https://blog.coroico.mx/sabes-si-tu-software-de-laboratorio-es-un-gasto-o-una-inversion/


2
ok








a

https://blog.coroico.mx/sabes-si-tu-software-de-laboratorio-es-un-gasto-o-una-inversion/#respond


1
ok








a

https://blog.coroico.mx/tecnica-de-los-5-por-ques/


4
ok








a

https://blog.coroico.mx/tecnica-de-los-5-por-ques/#respond


1
ok








a

https://coroico.mx/


2
ok








a

https://www.facebook.com/Coroico-2242068165870172


1
ok








a

https://www.facebook.com/Coroico-2242068165870172/


1
ok








a

https://www.youtube.com/channel/UC9_CGY043vdzRto5JJ2Azjw


1
ok








a

mailto:info@atlatlgroup.com


1
ok








form
post
#sendgrid_mc_email_subscribe
200
text/html; charset=UTF-8

2
ok

11234 Bytes






form
get
https://blog.coroico.mx/
200
text/html; charset=UTF-8

1
ok

11234 Bytes






img
src
http://blog.coroico.mx/wp-content/uploads/2019/05/COROICO_LOGO-04-small-1.png


1
http-link, change to https








img
src
https://blog.coroico.mx/wp-content/uploads/2019/06/Winslow-Badminton1-300x250.png
200
image/png

1
ok

No Cache-Control header
No GZip - 74869 Bytes






img
src
https://blog.coroico.mx/wp-content/uploads/2019/06/16-500x281.png
200
image/png

1
ok

No Cache-Control header
No GZip - 55607 Bytes





srcset
https://blog.coroico.mx/wp-content/uploads/2019/06/16-500x281.png 500w, https://blog.coroico.mx/wp-content/uploads/2019/06/16-300x169.png 300w, https://blog.coroico.mx/wp-content/uploads/2019/06/16.png 560w


1
ok


https://blog.coroico.mx/wp-content/uploads/2019/06/16-300x169.png 300w
200
image/png

1
ok

No Cache-Control header
No GZip - 22435 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/06/16-500x281.png 500w
200
image/png

1
ok

No Cache-Control header
No GZip - 55607 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/06/16.png 560w
200
image/png

1
ok

No Cache-Control header
No GZip - 32879 Bytes




img
src
https://blog.coroico.mx/wp-content/uploads/2019/06/17-500x281.png
200
image/png

1
ok

No Cache-Control header
No GZip - 68566 Bytes





srcset
https://blog.coroico.mx/wp-content/uploads/2019/06/17-500x281.png 500w, https://blog.coroico.mx/wp-content/uploads/2019/06/17-300x169.png 300w, https://blog.coroico.mx/wp-content/uploads/2019/06/17.png 560w


1
ok


https://blog.coroico.mx/wp-content/uploads/2019/06/17-300x169.png 300w
200
image/png

1
ok

No Cache-Control header
No GZip - 28235 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/06/17-500x281.png 500w
200
image/png

1
ok

No Cache-Control header
No GZip - 68566 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/06/17.png 560w
200
image/png

1
ok

No Cache-Control header
No GZip - 43825 Bytes




img
src
https://blog.coroico.mx/wp-content/uploads/2019/07/20-500x281.png
200
image/png

1
ok

No Cache-Control header
No GZip - 80998 Bytes





srcset
https://blog.coroico.mx/wp-content/uploads/2019/07/20-500x281.png 500w, https://blog.coroico.mx/wp-content/uploads/2019/07/20-300x169.png 300w, https://blog.coroico.mx/wp-content/uploads/2019/07/20.png 560w


1
ok


https://blog.coroico.mx/wp-content/uploads/2019/07/20-300x169.png 300w
200
image/png

1
ok

No Cache-Control header
No GZip - 38475 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/20-500x281.png 500w
200
image/png

1
ok

No Cache-Control header
No GZip - 80998 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/20.png 560w
200
image/png

1
ok

No Cache-Control header
No GZip - 40264 Bytes




img
src
https://blog.coroico.mx/wp-content/uploads/2019/07/23-500x281.png
200
image/png

1
ok

No Cache-Control header
No GZip - 41775 Bytes





srcset
https://blog.coroico.mx/wp-content/uploads/2019/07/23-500x281.png 500w, https://blog.coroico.mx/wp-content/uploads/2019/07/23-300x169.png 300w, https://blog.coroico.mx/wp-content/uploads/2019/07/23.png 560w


1
ok


https://blog.coroico.mx/wp-content/uploads/2019/07/23-300x169.png 300w
200
image/png

1
ok

No Cache-Control header
No GZip - 16440 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/23-500x281.png 500w
200
image/png

1
ok

No Cache-Control header
No GZip - 41775 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/23.png 560w
200
image/png

1
ok

No Cache-Control header
No GZip - 24210 Bytes




img
src
https://blog.coroico.mx/wp-content/uploads/2019/07/24-500x281.png
200
image/png

1
ok

No Cache-Control header
No GZip - 303837 Bytes





srcset
https://blog.coroico.mx/wp-content/uploads/2019/07/24-500x281.png 500w, https://blog.coroico.mx/wp-content/uploads/2019/07/24-300x169.png 300w, https://blog.coroico.mx/wp-content/uploads/2019/07/24-370x208.png 370w, https://blog.coroico.mx/wp-content/uploads/2019/07/24-270x152.png 270w, https://blog.coroico.mx/wp-content/uploads/2019/07/24.png 560w


1
ok


https://blog.coroico.mx/wp-content/uploads/2019/07/24-270x152.png 270w
200
image/png

1
ok

No Cache-Control header
No GZip - 103583 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/24-300x169.png 300w
200
image/png

1
ok

No Cache-Control header
No GZip - 125108 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/24-370x208.png 370w
200
image/png

1
ok

No Cache-Control header
No GZip - 181046 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/24-500x281.png 500w
200
image/png

1
ok

No Cache-Control header
No GZip - 303837 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/24.png 560w
200
image/png

1
ok

No Cache-Control header
No GZip - 392384 Bytes




img
src
https://blog.coroico.mx/wp-content/uploads/2019/07/26-500x281.png
200
image/png

1
ok

No Cache-Control header
No GZip - 314259 Bytes





srcset
https://blog.coroico.mx/wp-content/uploads/2019/07/26-500x281.png 500w, https://blog.coroico.mx/wp-content/uploads/2019/07/26-300x169.png 300w, https://blog.coroico.mx/wp-content/uploads/2019/07/26-370x208.png 370w, https://blog.coroico.mx/wp-content/uploads/2019/07/26-270x152.png 270w, https://blog.coroico.mx/wp-content/uploads/2019/07/26.png 560w


1
ok


https://blog.coroico.mx/wp-content/uploads/2019/07/26-270x152.png 270w
200
image/png

1
ok

No Cache-Control header
No GZip - 98790 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/26-300x169.png 300w
200
image/png

1
ok

No Cache-Control header
No GZip - 120993 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/26-370x208.png 370w
200
image/png

1
ok

No Cache-Control header
No GZip - 179411 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/26-500x281.png 500w
200
image/png

1
ok

No Cache-Control header
No GZip - 314259 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/26.png 560w
200
image/png

1
ok

No Cache-Control header
No GZip - 426844 Bytes




img
src
https://blog.coroico.mx/wp-content/uploads/2019/07/29-500x281.png
200
image/png

1
ok

No Cache-Control header
No GZip - 147563 Bytes





srcset
https://blog.coroico.mx/wp-content/uploads/2019/07/29-500x281.png 500w, https://blog.coroico.mx/wp-content/uploads/2019/07/29-300x169.png 300w, https://blog.coroico.mx/wp-content/uploads/2019/07/29-370x208.png 370w, https://blog.coroico.mx/wp-content/uploads/2019/07/29-270x152.png 270w, https://blog.coroico.mx/wp-content/uploads/2019/07/29.png 560w


1
ok


https://blog.coroico.mx/wp-content/uploads/2019/07/29-270x152.png 270w
200
image/png

1
ok

No Cache-Control header
No GZip - 49640 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/29-300x169.png 300w
200
image/png

1
ok

No Cache-Control header
No GZip - 60191 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/29-370x208.png 370w
200
image/png

1
ok

No Cache-Control header
No GZip - 87797 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/29-500x281.png 500w
200
image/png

1
ok

No Cache-Control header
No GZip - 147563 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/29.png 560w
200
image/png

1
ok

No Cache-Control header
No GZip - 196441 Bytes




img
src
https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-500x333.jpg
200
image/jpeg

1
ok

No Cache-Control header
No GZip - 17097 Bytes





srcset
https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-500x334.jpg 500w, https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-300x200.jpg 300w, https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-768x512.jpg 768w, https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-1024x683.jpg 1024w, https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-1000x667.jpg 1000w, https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-1400x933.jpg 1400w, https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-770x513.jpg 770w, https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-370x247.jpg 370w


1
ok


https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-300x200.jpg 300w
200
image/jpeg

1
ok

No Cache-Control header
No GZip - 8382 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-370x247.jpg 370w
200
image/jpeg

1
ok

No Cache-Control header
No GZip - 11299 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-500x334.jpg 500w
200
image/jpeg

1
ok

No Cache-Control header
No GZip - 17062 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-768x512.jpg 768w
200
image/jpeg

1
ok

No Cache-Control header
No GZip - 31067 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-770x513.jpg 770w
200
image/jpeg

1
ok

No Cache-Control header
No GZip - 31601 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-1000x667.jpg 1000w
200
image/jpeg

1
ok

No Cache-Control header
No GZip - 45277 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-1024x683.jpg 1024w
200
image/jpeg

1
ok

No Cache-Control header
No GZip - 46930 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-1400x933.jpg 1400w
200
image/jpeg

1
ok

No Cache-Control header
No GZip - 74041 Bytes




img
src
https://blog.coroico.mx/wp-content/uploads/2019/08/30-500x281.png
200
image/png

1
ok

No Cache-Control header
No GZip - 206457 Bytes





srcset
https://blog.coroico.mx/wp-content/uploads/2019/08/30-500x281.png 500w, https://blog.coroico.mx/wp-content/uploads/2019/08/30-300x169.png 300w, https://blog.coroico.mx/wp-content/uploads/2019/08/30-370x208.png 370w, https://blog.coroico.mx/wp-content/uploads/2019/08/30-270x152.png 270w, https://blog.coroico.mx/wp-content/uploads/2019/08/30.png 560w


1
ok


https://blog.coroico.mx/wp-content/uploads/2019/08/30-270x152.png 270w
200
image/png

1
ok

No Cache-Control header
No GZip - 67732 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/08/30-300x169.png 300w
200
image/png

1
ok

No Cache-Control header
No GZip - 82280 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/08/30-370x208.png 370w
200
image/png

1
ok

No Cache-Control header
No GZip - 119787 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/08/30-500x281.png 500w
200
image/png

1
ok

No Cache-Control header
No GZip - 206457 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/08/30.png 560w
200
image/png

1
ok

No Cache-Control header
No GZip - 276307 Bytes




img
src
https://blog.coroico.mx/wp-content/uploads/2019/08/33-500x281.png
200
image/png

1
ok

No Cache-Control header
No GZip - 153086 Bytes





srcset
https://blog.coroico.mx/wp-content/uploads/2019/08/33-500x281.png 500w, https://blog.coroico.mx/wp-content/uploads/2019/08/33-300x169.png 300w, https://blog.coroico.mx/wp-content/uploads/2019/08/33-370x208.png 370w, https://blog.coroico.mx/wp-content/uploads/2019/08/33-270x152.png 270w, https://blog.coroico.mx/wp-content/uploads/2019/08/33.png 560w


1
ok


https://blog.coroico.mx/wp-content/uploads/2019/08/33-270x152.png 270w
200
image/png

1
ok

No Cache-Control header
No GZip - 51929 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/08/33-300x169.png 300w
200
image/png

1
ok

No Cache-Control header
No GZip - 62769 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/08/33-370x208.png 370w
200
image/png

1
ok

No Cache-Control header
No GZip - 90725 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/08/33-500x281.png 500w
200
image/png

1
ok

No Cache-Control header
No GZip - 153086 Bytes





https://blog.coroico.mx/wp-content/uploads/2019/08/33.png 560w
200
image/png

1
ok

No Cache-Control header
No GZip - 180495 Bytes




link
alternate
https://blog.coroico.mx/comments/feed/


1
ok








link
alternate
https://blog.coroico.mx/feed/


1
ok








link
apple-touch-icon-precomposed
https://blog.coroico.mx/wp-content/uploads/2019/05/cropped-COROICO_LOGO-04-small-1-1-180x180.png
200
image/png

1
ok

No Cache-Control header
No GZip - 18350 Bytes






link
canonical
https://blog.coroico.mx/


1
ok








link
dns-prefetch
//ajax.googleapis.com


1
ok








link
dns-prefetch
//fonts.googleapis.com


1
ok








link
dns-prefetch
//s.w.org


1
ok








link
EditURI
https://blog.coroico.mx/xmlrpc.php?rsd


1
ok








link
https://api.w.org/
https://blog.coroico.mx/wp-json/


1
ok








link
icon
https://blog.coroico.mx/wp-content/uploads/2019/05/cropped-COROICO_LOGO-04-small-1-1-192x192.png
200
image/png

1
ok

No Cache-Control header
No GZip - 13110 Bytes






link
icon
https://blog.coroico.mx/wp-content/uploads/2019/05/cropped-COROICO_LOGO-04-small-1-1-32x32.png
200
image/png

1
ok

No Cache-Control header
No GZip - 924 Bytes






link
next
http://blog.coroico.mx/page/2/


1
ok








link
stylesheet
//fonts.googleapis.com/css?family=Droid+Serif:400,700,700italic,400italic&subset=latin
200
text/css; charset=utf-8

1
ok

GZip: 297/1025 Bytes




Server-Header Access-Control-Allow-Origin: *
Cross-Origin Resource Sharing (CORS) supported

missing crossorigin=anonymous|use-credentials and integrity - attribute, possible hash-values:

sha256-C7hO0IaoXKQROg5HlO1JFasP4wChwjc1BpuCjEeD/Qc=
sha384-MzH4ZTn2xb+mN53vqj2+wSMogz+1QvK0asztA1sn79bFr4paCZee8d3SQjyrTE49
sha512-QRn8yZYAVQSfrBhVJ3PcOWPzRLsyLG8kSzVOnJ+qGWXDEKTa7IzBEBGZxxhbyiazpzZS7khg/4PqX7zBGmZbmA==

<link rel="stylesheet" href="//fonts.googleapis.com/css?family=Droid+Serif:400,700,700italic,400italic&subset=latin" crossorigin="anonymous" integrity="sha256-C7hO0IaoXKQROg5HlO1JFasP4wChwjc1BpuCjEeD/Qc=" />



Content loaded via url("...")

https://fonts.gstatic.com/s/droidserif/v10/tDbI2oqRg1oM3QBjjcaDkOr9rAA.ttf1
https://fonts.gstatic.com/s/droidserif/v10/tDbK2oqRg1oM3QBjjcaDkOr4nAfcGw.ttf1
https://fonts.gstatic.com/s/droidserif/v10/tDbV2oqRg1oM3QBjjcaDkOJGiRD7OwQ.ttf1
https://fonts.gstatic.com/s/droidserif/v10/tDbX2oqRg1oM3QBjjcaDkOr4lLz5CwOnTQ.ttf1

link
stylesheet
//fonts.googleapis.com/css?family=Open+Sans:300italic,400italic,600italic,700italic,800italic,400,800,700,600,300&subset=latin
200
text/css; charset=utf-8

1
ok

GZip: 384/2509 Bytes




Server-Header Access-Control-Allow-Origin: *
Cross-Origin Resource Sharing (CORS) supported

missing crossorigin=anonymous|use-credentials and integrity - attribute, possible hash-values:

sha256-W6Xk1HvyNBdn/WoHy1yuPCbdNZVfg0bsOpdLmgkZCIU=
sha384-nVv5N4RVydSPG//SIiKyYeJ5iuvAfDC6unimo9z/qB3LS92pKST/uR4+tOyflFh8
sha512-MsIqWZ/DrB1fs+Mr/pOC2XvYal8DsvfBugt16yeY2yTdFDRkoiWA0xCpIqF48WZB5ZYV+qUuaTYYelQDswjdAg==

<link rel="stylesheet" href="//fonts.googleapis.com/css?family=Open+Sans:300italic,400italic,600italic,700italic,800italic,400,800,700,600,300&subset=latin" crossorigin="anonymous" integrity="sha256-W6Xk1HvyNBdn/WoHy1yuPCbdNZVfg0bsOpdLmgkZCIU=" />



Content loaded via url("...")

https://fonts.gstatic.com/s/opensans/v17/mem5YaGs126MiZpBA-UN_r8OUuhs.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem5YaGs126MiZpBA-UN7rgOUuhs.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem5YaGs126MiZpBA-UN8rsOUuhs.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem5YaGs126MiZpBA-UNirkOUuhs.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem6YaGs126MiZpBA-UFUK0Zdcg.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem8YaGs126MiZpBA-UFVZ0e.ttf1
https://fonts.gstatic.com/s/opensans/v17/memnYaGs126MiZpBA-UFUKWiUNhrIqY.ttf1
https://fonts.gstatic.com/s/opensans/v17/memnYaGs126MiZpBA-UFUKW-U9hrIqY.ttf1
https://fonts.gstatic.com/s/opensans/v17/memnYaGs126MiZpBA-UFUKWyV9hrIqY.ttf1
https://fonts.gstatic.com/s/opensans/v17/memnYaGs126MiZpBA-UFUKXGUdhrIqY.ttf1

link
stylesheet
//fonts.googleapis.com/css?family=Open+Sans:400,700,400italic,700italic&subset=latin
200
text/css; charset=utf-8

1
ok

GZip: 287/981 Bytes




Server-Header Access-Control-Allow-Origin: *
Cross-Origin Resource Sharing (CORS) supported

missing crossorigin=anonymous|use-credentials and integrity - attribute, possible hash-values:

sha256-RZfP4jCci7vHEMfOoU/0+SyyTLlyKKBz+dWDvKxOvRo=
sha384-ZjJ0ucZlkxxmnUl9VDId9ciQ4T0hSUwgZwUGsuhvP/6HWT7WZfJsMCHKegQWdqUk
sha512-GqEvfuTD/46S78ShHbOiZvcS/rB6RPIFg39DzQGgB0nukt6cVwKJTOw1Zsj+n/Ubp0Z5BeETatqpqQOvsI+8NQ==

<link rel="stylesheet" href="//fonts.googleapis.com/css?family=Open+Sans:400,700,400italic,700italic&subset=latin" crossorigin="anonymous" integrity="sha256-RZfP4jCci7vHEMfOoU/0+SyyTLlyKKBz+dWDvKxOvRo=" />



Content loaded via url("...")

https://fonts.gstatic.com/s/opensans/v17/mem5YaGs126MiZpBA-UN7rgOUuhs.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem6YaGs126MiZpBA-UFUK0Zdcg.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem8YaGs126MiZpBA-UFVZ0e.ttf1
https://fonts.gstatic.com/s/opensans/v17/memnYaGs126MiZpBA-UFUKWiUNhrIqY.ttf1

link
stylesheet
https://ajax.googleapis.com/ajax/libs/jqueryui/1.11.4/themes/smoothness/jquery-ui.min.css?ver=1.11.4
200
text/css; charset=UTF-8

1
ok

Cache-Control: public, max-age=31536000, stale-while-revalidate=2592000 - with long duration found.
GZip: 7320/30021 Bytes




Server-Header Access-Control-Allow-Origin: *
Cross-Origin Resource Sharing (CORS) supported

missing crossorigin=anonymous|use-credentials and integrity - attribute, possible hash-values:

sha256-iWTx/iC9IoKaoSKD5+WVFef8ZYNIgQ4AxVpMbBw2hig=
sha384-A/CgvDCSM2jOpa4G++hlEtzweAjg53uGXJLUnen/qb5faVDcN+vaHrL5czAdzhK8
sha512-vljQ8u3XOuV0u0GLG6ZRToEi2ZKCWeJwezv27POKmq/s1MIRiSv32m5MKZaquL4WIdh3A0wE+HChNH+s6psFFQ==

<link rel="stylesheet" href="https://ajax.googleapis.com/ajax/libs/jqueryui/1.11.4/themes/smoothness/jquery-ui.min.css?ver=1.11.4" crossorigin="anonymous" integrity="sha256-iWTx/iC9IoKaoSKD5+WVFef8ZYNIgQ4AxVpMbBw2hig=" />



Content loaded via url("...")

data:image/gif;base64,R0lGODlhAQABAIAAAAAAAP///yH5BAEAAAAALAAAAAABAAEAAAIBRAA71
data:image/gif;base64,R0lGODlhKAAoAIABAAAAAP///yH/C05FVFNDQVBFMi4wAwEAAAAh+QQJAQABACwAAAAAKAAoAAACkYwNqXrdC52DS06a7MFZI+4FHBCKoDeWKXqymPqGqxvJrXZbMx7Ttc+w9XgU2FB3lOyQRWET2IFGiU9m1frDVpxZZc6bfHwv4c1YXP6k1Vdy292Fb6UkuvFtXpvWSzA+HycXJHUXiGYIiMg2R6W459gnWGfHNdjIqDWVqemH2ekpObkpOlppWUqZiqr6edqqWQAAIfkECQEAAQAsAAAAACgAKAAAApSMgZnGfaqcg1E2uuzDmmHUBR8Qil95hiPKqWn3aqtLsS18y7G1SzNeowWBENtQd+T1JktP05nzPTdJZlR6vUxNWWjV+vUWhWNkWFwxl9VpZRedYcflIOLafaa28XdsH/ynlcc1uPVDZxQIR0K25+cICCmoqCe5mGhZOfeYSUh5yJcJyrkZWWpaR8doJ2o4NYq62lAAACH5BAkBAAEALAAAAAAoACgAAAKVDI4Yy22ZnINRNqosw0Bv7i1gyHUkFj7oSaWlu3ovC8GxNso5fluz3qLVhBVeT/Lz7ZTHyxL5dDalQWPVOsQWtRnuwXaFTj9jVVh8pma9JjZ4zYSj5ZOyma7uuolffh+IR5aW97cHuBUXKGKXlKjn+DiHWMcYJah4N0lYCMlJOXipGRr5qdgoSTrqWSq6WFl2ypoaUAAAIfkECQEAAQAsAAAAACgAKAAAApaEb6HLgd/iO7FNWtcFWe+ufODGjRfoiJ2akShbueb0wtI50zm02pbvwfWEMWBQ1zKGlLIhskiEPm9R6vRXxV4ZzWT2yHOGpWMyorblKlNp8HmHEb/lCXjcW7bmtXP8Xt229OVWR1fod2eWqNfHuMjXCPkIGNileOiImVmCOEmoSfn3yXlJWmoHGhqp6ilYuWYpmTqKUgAAIfkECQEAAQAsAAAAACgAKAAAApiEH6kb58biQ3FNWtMFWW3eNVcojuFGfqnZqSebuS06w5V80/X02pKe8zFwP6EFWOT1lDFk8rGERh1TTNOocQ61Hm4Xm2VexUHpzjymViHrFbiELsefVrn6XKfnt2Q9G/+Xdie499XHd2g4h7ioOGhXGJboGAnXSBnoBwKYyfioubZJ2Hn0RuRZaflZOil56Zp6iioKSXpUAAAh+QQJAQABACwAAAAAKAAoAAACkoQRqRvnxuI7kU1a1UU5bd5tnSeOZXhmn5lWK3qNTWvRdQxP8qvaC+/yaYQzXO7BMvaUEmJRd3TsiMAgswmNYrSgZdYrTX6tSHGZO73ezuAw2uxuQ+BbeZfMxsexY35+/Qe4J1inV0g4x3WHuMhIl2jXOKT2Q+VU5fgoSUI52VfZyfkJGkha6jmY+aaYdirq+lQAACH5BAkBAAEALAAAAAAoACgAAAKWBIKpYe0L3YNKToqswUlvznigd4wiR4KhZrKt9Upqip61i9E3vMvxRdHlbEFiEXfk9YARYxOZZD6VQ2pUunBmtRXo1Lf8hMVVcNl8JafV38aM2/Fu5V16Bn63r6xt97j09+MXSFi4BniGFae3hzbH9+hYBzkpuUh5aZmHuanZOZgIuvbGiNeomCnaxxap2upaCZsq+1kAACH5BAkBAAEALAAAAAAoACgAAAKXjI8By5zf4kOxTVrXNVlv1X0d8IGZGKLnNpYtm8Lr9cqVeuOSvfOW79D9aDHizNhDJidFZhNydEahOaDH6nomtJjp1tutKoNWkvA6JqfRVLHU/QUfau9l2x7G54d1fl995xcIGAdXqMfBNadoYrhH+Mg2KBlpVpbluCiXmMnZ2Sh4GBqJ+ckIOqqJ6LmKSllZmsoq6wpQAAAh+QQJAQABACwAAAAAKAAoAAAClYx/oLvoxuJDkU1a1YUZbJ59nSd2ZXhWqbRa2/gF8Gu2DY3iqs7yrq+xBYEkYvFSM8aSSObE+ZgRl1BHFZNr7pRCavZ5BW2142hY3AN/zWtsmf12p9XxxFl2lpLn1rseztfXZjdIWIf2s5dItwjYKBgo9yg5pHgzJXTEeGlZuenpyPmpGQoKOWkYmSpaSnqKileI2FAAACH5BAkBAAEALAAAAAAoACgAAAKVjB+gu+jG4kORTVrVhRlsnn2dJ3ZleFaptFrb+CXmO9OozeL5VfP99HvAWhpiUdcwkpBH3825AwYdU8xTqlLGhtCosArKMpvfa1mMRae9VvWZfeB2XfPkeLmm18lUcBj+p5dnN8jXZ3YIGEhYuOUn45aoCDkp16hl5IjYJvjWKcnoGQpqyPlpOhr3aElaqrq56Bq7VAAAOw==1
images/ui-bg_flat_0_aaaaaa_40x100.png2
images/ui-bg_flat_75_ffffff_40x100.png1
images/ui-bg_glass_55_fbf9ee_1x400.png1
images/ui-bg_glass_65_ffffff_1x400.png1
images/ui-bg_glass_75_dadada_1x400.png1
images/ui-bg_glass_75_e6e6e6_1x400.png1
images/ui-bg_glass_95_fef1ec_1x400.png1
images/ui-bg_highlight-soft_75_cccccc_1x100.png1
images/ui-icons_222222_256x240.png2
images/ui-icons_2e83ff_256x240.png1
images/ui-icons_454545_256x240.png2
images/ui-icons_888888_256x240.png1
images/ui-icons_cd0a0a_256x240.png1

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/contact-form-7/includes/css/styles.css?ver=5.1.3
200
text/css

1
ok

No Cache-Control - header
GZip: 651/1685 Bytes




local SRI possible, possible hash-values:

sha256-OtL8sygpXxGZ1ZOtq6kJ8+6nkPaVVUrDwdp6oAn8Dg0=
sha384-DWWCyZvrXhAnC81iVUgJpPe20AtJOqZrM2q30eu48sf1YteUyvVYNF/t8EPpZWLv
sha512-8Mcb8YVE+7B2uMI/wUfYJKL3RVJBooROas8hWpV1nZj3CnMkHUZzSqfAZQDpYmV87aOS59XHM4tcYQ8RDGx+4Q==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/contact-form-7/includes/css/styles.css?ver=5.1.3" crossorigin="anonymous" integrity="sha256-OtL8sygpXxGZ1ZOtq6kJ8+6nkPaVVUrDwdp6oAn8Dg0=" />



Content loaded via url("...")

../../images/ajax-loader.gif1

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/jquery-ui-timepicker-addon.min.css?ver=5.2.4
200
text/css

1
ok

No Cache-Control - header
GZip: 333/648 Bytes




local SRI possible, possible hash-values:

sha256-BX1MIynuR5aqNZHQMzmBu/aORhTWuK9VAAiBjwUv5nk=
sha384-9iIibg7F08Llglja4fCdPdoDJN7w9WM6f4C5eu8cIBZ0d9ezJHw4zUp5GjItlDZ/
sha512-N0otkKJPjawyFU9mE5U+kWxmutA681ia9V3h1hxw8UfVzGKYbKh9DTLLJ5w7yn4JXW7iylO+WMumF3/dxHUdRg==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/jquery-ui-timepicker-addon.min.css?ver=5.2.4" crossorigin="anonymous" integrity="sha256-BX1MIynuR5aqNZHQMzmBu/aORhTWuK9VAAiBjwUv5nk=" />




link
stylesheet
https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/academicons.min.css?ver=20190406
200
text/css

1
ok

No Cache-Control - header
GZip: 1266/6758 Bytes




local SRI possible, possible hash-values:

sha256-lJ0/etdIH9CSZCDjK56BaqEFT2biZcwKeUQSxp2BRc4=
sha384-2zw26kZCAo3OOPxHdSGlYxqFNNyZaNtyfyUHc54acoRrCIDbMVLEDVcCEWVmO4xM
sha512-vDI/OCjYt11qT3Q6c8Dw3ho2Up9bIQ8J0nVBK6D7RLoXxq2KFVYH7sNUkgSx3rAYnV/GthzC3yCdb2zQb3/CRQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/academicons.min.css?ver=20190406" crossorigin="anonymous" integrity="sha256-lJ0/etdIH9CSZCDjK56BaqEFT2biZcwKeUQSxp2BRc4=" />



Content loaded via url("...")

../font/academicons.eot?v=1.8.62
../font/academicons.svg?v=1.8.6#academicons1
../font/academicons.ttf?v=1.8.61
../font/academicons.woff?v=1.8.61

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/font-awesome.min.css?ver=20180625
200
text/css

1
ok

No Cache-Control - header
GZip: 7051/30994 Bytes




local SRI possible, possible hash-values:

sha256-3GjqhYLNCSvoydUEnbNA91PUwU0F5Xm4odWNjDNIeZ8=
sha384-FjIDn4xq3dtDtq/tN4hYAjwxbLyI/ID/RlPmixS6c7XDvdKcntlwUeowdsC2vXaJ
sha512-6vCwRp6xtDdNdHJ4qIrcKsQVdcr0LV9bDuc3x76gV+/Pg/cJYVpDIPCcnR0cJ/1gU5lRG4bHU/hU1DSgvA3MLQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/font-awesome.min.css?ver=20180625" crossorigin="anonymous" integrity="sha256-3GjqhYLNCSvoydUEnbNA91PUwU0F5Xm4odWNjDNIeZ8=" />



Content loaded via url("...")

../font/fontawesome-webfont.eot?#iefix&v=4.7.01
../font/fontawesome-webfont.eot?v=4.7.01
../font/fontawesome-webfont.svg?v=4.7.0#fontawesomeregular1
../font/fontawesome-webfont.ttf?v=4.7.01
../font/fontawesome-webfont.woff?v=4.7.01
../font/fontawesome-webfont.woff2?v=4.7.01

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/genericons.css?ver=20180625
200
text/css

1
ok

No Cache-Control - header
GZip: 16447/28296 Bytes




local SRI possible, possible hash-values:

sha256-0l60NvWEVi98KRxmdy3jC4GdmdvYMZZIeX4/uF4JvtI=
sha384-7I/oTd3JGDqLJGPZLQVOuFhz3+PzoOqqWZmQ+y25gaiUicUazL7k2Mz5I0hjfnTu
sha512-dm8OCvWe3O3gghuspY8EEU28FehK+yfpmNNCRa/Oc0Ii84QTCK/bQPJsMWMTkY4gEFfPcl2jUMJdSeZtUfsIqQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/genericons.css?ver=20180625" crossorigin="anonymous" integrity="sha256-0l60NvWEVi98KRxmdy3jC4GdmdvYMZZIeX4/uF4JvtI=" />



Content loaded via url("...")

../font/Genericons.eot1
../font/Genericons.eot?1
../font/Genericons.svg#Genericons2
../font/Genericons.ttf1
data:application/x-font-woff;charset=utf-8;base64,d09GRgABAAAAADakAA0AAAAAVqwAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABGRlRNAAA2iAAAABoAAAAcdeu6KE9TLzIAAAGgAAAARQAAAGBkLHXFY21hcAAAAogAAACWAAABsqlys6FjdnQgAAADIAAAAAQAAAAEAEQFEWdhc3AAADaAAAAACAAAAAj//wADZ2x5ZgAABFQAAC7AAABIkKrsSc5oZWFkAAABMAAAAC8AAAA2C2BCV2hoZWEAAAFgAAAAHQAAACQQuAgGaG10eAAAAegAAACfAAABOFjwU3Jsb2NhAAADJAAAATAAAAEwy4vdrm1heHAAAAGAAAAAIAAAACAA6QEZbmFtZQAAMxQAAAE5AAACN1KGf59wb3N0AAA0UAAAAjAAAAXo9iKXv3jaY2BkYGAAYqUtWvLx/DZfGbg5GEDgkmLVWhj9/ycDAwcbWJyDgQlEAQABJgkgAHjaY2BkYOBgAIIdHAz/fwLZbAyMDKiAFQBE7gLWAAAAAAEAAACXAOgAEAAAAAAAAgAAAAEAAQAAAEAALgAAAAB42mNgYf/MOIGBlYGB1Zh1JgMDoxyEZr7OkMYkxMDAxMDKzAADjAIMCBCQ5prC0MCg8FWcA8TdwQFVg6REgYERAPvTCMQAAAB42i1PsRXCUAg8SAprl7FN4QZqb2WZGRjAIVLrHj4be4ews7OJHAd54cMBd+Af7JHmt3RPYAOHAYFweFhmYE4jlj+uVb8nshCzd/qVeNUCLysG8lgwrojfSW/pcTK6o7rWX82En6HJwIEv+wbi28IwpndxRu/JaJGStHRDq5EB+OKCNumZLlSVl2TnOFVtl9nR5t7woR0QzVT+D7cKLeIAeNpjYGBgZoBgGQZGBhBYA+QxgvksDBOAtAIQsoDoj5yfOD9JflL7zPGF84vkF80vll88v0R+yfxS9lX8/3+wCoZPDJ8EPil8ZvjC8EXgi8IXgy8OXwK+JHwp+Mrw////x/wsfHx8HHxMvJo8Rjw6PGo8CjxSPCI8fDwc3PVQ2/ECRjYGuDJGJiDBhK4A4pXhDABtHClYAAAARAURAAAALAAsACwALABaAIQAzADyAQABHAFGAZQBzgIIArIDTAOkA+AEEgTCBRYFYgW+BjAGwgbkByQHSAeCB+AI2Ao4CowLGgvQDBwM6g08DX4Nug4kDkYOYg6ADsoO7A8yD4gP8hAwEGYQpBDuEUgRshHUEfYSQBJeEnoSlhLEEtwTIBNYE6oT6hQaFC4UShSQFJ4UtBTyFSAVjBW4FegV+hYUFiwWQBZWFmQWchaIFuYXFhdUF4gXyhgEGCwYThh8GNYZEhlCGVgZZhl8GZIZoBnQGhIaShp8GtIa6Br+GzAbVBt+G8Ib/Bw6HGgciBy8HOwdHh1WHXAdmB3eHvYfIB8uHzofSB9WH6of4CA4IMghACFCIcQh4CIGIjoiSCJ8IpYiyCLmIxAjWiPwJCQkSHja1Xx5YFTVvf/53nUm++zJJJnMkpkJJJkss5GFMIQ9w04IS0BZRSJLMIIo1l4XFETQFkVFBKwVrbuWpRaXPOtalZaCPKu1D2yf28NX21qfQubk9z3nzoSAS//+Mbn3nnvuuWc/n+/n+z3fCxHIaEKEJfJMIhKVhJ4GUtP8jCqRz+ufVuQ/NT8jChgkT4ssWmbRz6gK9DU/Ayw+bPKY/B6TZ7TgpuVwN71Unnnm0dHS24QQRSACUYis8XyzST6xEAch4LF5ZJsnKkc9NsDDj2ETXgUikT4iaClNJEBSGoZIP74qa+l//YRfKB5EAEyj4g/ztWBZbslcIEjucqHATOpjkYBXsYo18DNYeOQI3UMvonuOHIHXj+/YcXyHSs7FLGQp+o7sYA8IFq+BpmqKhtk6SDEZinWVWfMsHlLfIkRCgjdPsLpAtMlRUu8CmzVP8HlDEInJmkC+wcbihT54cN/6cePW79Mv/f1E+MUT2zvCM68cOWt7Rwc2pk8TNQ3IWW0gEbuI3yxI7KW9HdtnjbxyZrhj+xPbWX0EYhjcf9h3Jg9gldjBfhLm1af1ERF7BTAEmoxngQDeU35mB/YPsDiFtU0gxChgX2tn8S6FP3zG38O+zMWEVkU1yaYQRCMxt13WblvTT9bcdgpaTsnahlcqUp9owt0Vr2zYc+oUHwN8S2FjwMYV62PNA5+pPhaFc0EP4JhuPr2la4eQCVCsNRvnLac3A9nRNShIBFZPXpciEmHjareZsEbRWNTEBhVvHDasmyniwP7HJ+4AhlsgbmOP7PUsWVA8DFmHuzoSa3avSXR09XZ0HaZfHa7raOARKjm8kWoLdwfuamwHbcqaNVOo1t54V2D3QtA2nsQL1TYePrwRtMTaWUWYhvI0gGlYz5FeldWtgPiwvfW8bpVgAk/cwxqtR/hwhHxeVq9YWNG6duzo0miCHtBgy55TlN/jbYIHFGwyi6IJ6NVO7RG0c7c7ugBDRITMuMlYqovNAFYeuNg4BWPRSBCDBRhsEaKRQJCl5mOvSfmxpqbY3GQSCmYvXjy7s6bVP2WcjI/P4iEUxG7ddWt0brKrC5/P+Yz2fTans2bNjWMvPTwOi8B2Vhtw5pEr+cpyCWabVVAkVQngpGDFtChYcIsQCIYgT1ADQUUNifmQB7g4HIrN6pIdiponhCAYkoJDMd7ucEkOlxK32q02qxIMlAewtuYWQVwLdsg6+fyNbcufpfRunw+CruicxZMm1JYsV4zGfIuUV9+8OH7VzTdfFV80IpSVVZBvMErLS2rHT140JxrJtYfGjRjrFIyl3liplFNkNDlFY6nTmwuKwx0fu6gZfL67aOrZ5W03Pn/SQNiZfrXlIfr62RfrVXeh9JvpoxY4FUt5/eRFm2bsvTy/YvzFdSDK5jq/F8DrrzMpglAxtSFekt2zZ/rmRZPr/WYl1JmVJxdEq6VcX3GhoGY7zaAUuoZ5pNwhrqF5WabyKXVZhW4l/MJZaHhoC28cdiIDKkJ4nxqIiZQittSTBJlKiL8+LogKUe3+mDleLrvAjLhidsRIPBDMAda9LsERkxwCsETlccHiVXx2S4sUD1SBWyIIewRxjzDgk8iBw54n/0w3db0rjt/1ViE9TY/nNXaeue+KFT+Cxz4uSNCP6Bp5+biD/9dsLw0qj8DEq51nG1+if695Cb68Zevjbs19yW+VvZO2LB9yLT1Er4JdsAEsP/85/ZxupEvw+PznPweLNhWq4MY2evS13r0roL03FCq+m/5W2Jx4iP5u/dsQm1SrddTDuw0Xd7lKw+05HqUYSuGfM+nhE/bxIXBCrGAf3Sc0ultay6/9qXZB5lggL5R1FyAeVyEef0Aa8EZR7Qi4kuRz++3helzyOL0wgJfhOL8YXsXtkgNnaIsQrrc7YvE8UGOqllwpVM/Vnvo9pdvoEdpfVTXzgZ+MuPJ5n99dV/vjhyfPTs6uvwVu+TCrcfGm5OQt4R+tsLY3rFJquycX25Yff/vwfT0jH5QDY+vEbavV3KI3b5QrxfqfXbS445E3s4dUtm1a3Dg8XpRILPfm6vUlKD9UjQQH0MGHKG3xDEcZEXbEAz4UIKUIiyg0zwMI+hHk5dCPKlv3yZOWX/TT2VWUpqrYAxUR4SxB6HwNpN6c5jj8Iyt28drRp2lfqmFHl4xPOLZjufLHWK6b4YPIBAMrI9IiYU+Ugejl5YrSbpiQT1+lvX/+s6N6/EXXtsW7nE51/pKKiNMofU2P9h0SJ0ANCJEFs8bHShVRpB+Z/NVeUTASRJ9M2yyIzB6yhKzi2GA3s0HxeXFFF5hjgDMXFKjHuZsNdgtYYvEWMRphQGBA6AjXOwLlPq+kqPXh+tgIiNkVVVHBIiKOxBz2c3F+HGpVjJmjEbENVsDEL7aN7Nn38idXH6T7v9i27Qv6pzNv0x+PFQO3XC8JX/+j+y/gmypIBXkW1VFoBYdslvMkVZjcCMZV9NN7b6H9R8YXF/lX+Lw2S561qhb8T13bbs23WjdOCVzm82GkrVLwycO/OvSeqmHu+w9e/cnL+3pGbvsCJvLSU3mn6YYlUul9fTUhWREeSo30SHv7dkOOklNXNzZcGJoT9Qp+gzu7JL/Qlt3QAUu6Ox9YJQsilHlFWei7SzDBbFXwuiErE6lWVN68M9XQBT3vH2FzXSC3wj9Rlm4ldWQ4G0W73q8hITOh1ZARh5FBLM5+Me7xh20+my/qi4ajYeE9IZAbGLPkmh3T1723++JF9797+do3WncKVqO9oMjucpWblz66ZMmjS0d2j48VSXS/uE9nVJIWDE/fcc2SMYGLd7+3bu37uy+ePPEeyFVzDdmqURIXP/rbRxeXx8Y0Fb3Nk2M9RZ13Kc8jJzFjXTkjCTJxx4YX4R/FPkZF2FQHFYWyxxz02FoUfCbYhPn0ILQ9KExbumxGvL0KqjrkAnpoWkfluKG52fSQJMGEbJvbUxNuLZ++eVkDEPG/bl40oW1h9aS62kmhszsF8/Ir/WF3cSz1n+L187eaSnzFxZbs+GWPr2ZcKT0/Gct0k+ZBKzC91Bg/saCYDoEPiYTVjhG8moIa9dgLbCrWOs672mbSVyVbeCiGHfSbG0ZPg6mto6ZPGyk1PbSpftowbwH9GgAMhixvg3fMyMwy1ZfkGSIW9X0sbpzS2DxpclPjlL4N8NqTB4sqg4XdHtpz4CAcrrQ5h5Re3E5nY2c+isJhGsqFqazGLkkf9kBQwJURDMQtbALEWKWsrD/ZGsFVEULemYdJkQSpeewvyOeJLNWt++MT2xZEqmdctePgksVPeicUeOffqZb+TMqzb71kxuxAc57j6iVrn1005obXfzT/0ZtXTQjOMKuqaBVUn33munj5xBV3/fIvBhJftGnvgfkbPnxx18rm+Qn6wbAN22MPXy08ZfQsj9x6+LLp4e3/0bD49l9B3cFLn76uLTSt+6a7p965yOYszJmSVWgy+u54rnvS7nu3rp9Vr+N4RvYtzvCJAiFPwGYGY3ELn8/AGiXqjbI77AgbEI8Fgmk0x6nD2CRS7TinOWxuYboywE5yBMiFXCIt5+/YliwZX7J12lW/u31a0+W73u5Zd3T3tVOGdC0zl8iCSZDlvNHjtN41Sx/oGjZ1x0XRdn9Odp1r3KjY3GiBwbjG4pAP0NO7BjMH+hn9iuU/dP1icEaTlx0G8c7Ox+9YnYhfdM3td7bdcmyoIc9iSGRZbaYpVy185uZpzctvm7n96zujndGaXVcObZ01+upk5TSLhfpnLNo8BRyw7sgAQRDIXmGBukDei4srn/PeAuS2BeXpq2yF2V9+SR/+MnVFOiDvZecv03d41eUlUW9Xc4gXbyQR+bkP0TuIkwWpYhx/FrPDjCITQxhlVjaAtSAHlaGfpu5bsco7bZ71qvaN1z0152hdxNo8YdiabkPBpsSYG1VioA/SFB1Oh0AZ3HYtlLWvuKLnboOV/p7+agr9+1NPzbu7FB5nbcjoT/mIDd9af0ZBIag27OnjZ+CanoKsl/J7Ac99nL0SgHeJplTgWvbqWgUqEw47kw9xEwoHnDaMeEZNvihvVFwaBb+gs0wF1c0TN93cM3/+ig0XXzSqNfJqVzIZqjapGm2iH9PIrqoqZ/ls+lHMbi8ra2i8boOwNuVLJObO2cKm52D8cJBqjsEX1J+4lQK7O1aANeKr0c05B9bNHkb2b8J5WQlepRSs9iaojw2GELGMvnSKqVBIzf/XvPk0/ez0ZjP932RUJtFkMqqlT+ejCCWn9Lf6TolkbCMqSKg7NY1JsVekA5l3knxp9QOooPSTbeSnZAe5h9xH7icPkoeZNodNsNUq7M+q1KHOoNQpqpWdFBsDFOxOJR9A8QahtgYCwdpANKB3byAYCfIVGIhiZAS7IFobi8bqIqzPo/VxftV/I6A2DrF6B9Ta62rtYbtj4GdjRy37szqsdXYwyXEjOPyyLQ4mv+qPB1UjBGV/VFVx1Pk/Af+E9BkvqVZThSnVCiLgdBZZrADn/RNgIDGKVuEFTC68AAIM5JHOCDArcH2cujJ19mNwpV59EO6kH34sjPv000+hUpA/ph8KjQ9K/5AlWi2oAkjsHVaowIpM54D5A63OzoFjLPt0TUX+HC+AL+GLEhyTZAFkEPCWHew1ngE7H8vOptXpFop6jqwMlgzfgCn07Rd3wmz68M4X9/5pVeoFiLx47+Rdu3ZhaPbOF+//06rz56oF5dwL5GM2V5GJFaCO5uaqVQsSYVTXBJQPDrsUV9I8AjEVgXUEMEzFFKiHWTgDUxiRRmStjdQhVQuUsyj+aoyBcAgUPUI4B8whIRjggocnY1Qcc2MP2T0TSiIqi0GO1w6XiLfsjfStAPXlOINQiAVZlojhEpYZDJjjMYyPK5KCcG+2SxI5yJgfI2T0Dkb8OAc8tpueWLlyidW075r14N4wIbn6rTtmlSdC2KNGEUb+/OVlD4Brodt/KX3/dnHo0I4tV6xrn7vgyWuT2V3tl9AvV14xvCXLsHPlqv9qanEkQxs3RTsstnBBVbS0am4gEDEYzEUFlfXFzki1udghK5VlFTWh8bmohxlt9jGBwFirTTYbi70V9spOj9cvCh0bW8Mza3Js5qmXrBtWPjJsKjaaHRsebp91+0y64TRsuqRp1o43eibdsNAZG9/TTQ899BD9dFxb7qzZUP2MyXwv/fSNdde9DyGdd+rNZLQzzUDvMqxdfRn945139E8Yn9dgm739re6xm9bWY1uzBEiuaLp1Q7j62jtTWaNuGtYz1FfiTV775ALhshdbJlmbWpZfds3637g80+d3fpgMV1uDwxcsnFlcWaZm5zkc44YMbfc4PBZByHGai9v8/haTXYFhlQKUTSh1eQSo9Pnag1aP0yIZi8rcc2pHXhYy5Yy5aHU00l5tsOfVDC+Pb2ieclU0P2flA303f/3WTTeuPXrvZVb3yq3T7qJPrN/QXer8rz27YOU99/7BJQk5t7xL/7x7H/3D+9f//8R1mT73Y3W4ej25BG9cuAjy5BAqSKY8A858HnIJsTiKJ5eI+ngspPiC3kAeJgOXWAZqSMLF0iK6RIe8Wy2aMGb26CZnXlnlitVXdl86K2E2I+waTFa3P1IaWdU+xmzxjB41rACGKdbEiNmTpo+oyxLKW6Z3zpsx0mKRCsKR5NgZ48aXFBeJJmeR0XhKdTQOKc0eP2rMww899bO7N8xzqkPEnKH1M+ffsO3QojmbZ8Qtcm6uqtD/EVS7w+3yuUqzzUKRKycXCr2VeeXV4jOpjwQ5W5It1aMuGzPx+s62Km++ASFJyS+sCCerqxdMm9hYlZP9htG9fNWD9786b/LlTW4hr6QoKz2GiEFXIAYNIddh79hVbgwNMqiRUCwy5iaivseUAtlmBWapCgz+YRqmD9rTgn3gORITJpusg2SINS3zB57bMnQgpo4Mw6QbDiy5auWUiZe//yukq6ZRdZ3r75y69cq2sYteeHB7z4wqekmT1ze8qX368g6Xu9xtKYjEOxdVDvWUOIpqIj5vkXPYsBkzu7ctXzGsIR7tnL1xXsswr6el9dLJ1aFCp8NWUlYV8/pikVlXHrxnVbfYuuzyJQdumNSYN3zFrmff62mfefnGqXeu76xL5lTN6Nn+4AuL5tPftl86e3hzRbDY6bAYjeZ8zCPkLXe7W0I2e3l5dai+FqmIMzhkQtuCS0a3BgMlVrPJ46ofMbTKbvN4orWFRagDJSdNrBkRCnH+jKyIKMzuGGESHXFX1wbwrFQiS+EcJSRUgomjOO94Zp1Gwe6ptyuaPVhkZ0cymmCsgSZGXjFu7lCtt27VwgSoiACeOWMLDAbYG01KpLiu3OAJ6mdM3ZWsqK0QtIvu/3qzbKr2lLTvnD5zrz+Q1Cn927BVDas93KIVJLVkBBmPesxmrGUMq6UPWwSJAY4VYC3TWqK9nKkzCrvzxzidV+0oE1iQWwesdgmsjhgzlyjEqzCzbsRi1e0/gBKO866MXoTpLCimHHILYgXrCtQSgn7R7mD3LpBezx/qyu949nBHvmto/rDbfkL/1hoKjRwZCrXC6HmtrfNaBU9lw5DqshmpLY+C75FH6AePPkY/eOQR8KU+rKiZWVo1pFGuxoEYUb1vWCjvilfoF/QE/eKVtQWllUXrZtTNKDn03/Nks9kGDYXT69qWL2+rmVIn0jOT/vxkycz62LyYaMh3VeZ3dORXuvKHgRJqxeJbW/VzKDS8rHZIQ3B4alnXgctWHOzqOnjiYJdwb03JxOHlDUJ7qCVUnUg9Fe8srq9b+uzGKVM2/mop6n/hkb4Z66oDC43whj07Rx4/pG75HcurJ4Wa6bU5CypCsXlsfSK/Znq6RnwkjuPBjDBM7RX5loUwHDw23VzOu81hU2VPRscKRh1x/aE0ze63e2sA5t03f4w2LwZqzega+bUtW16X7kMaoc7bPX/+7nmw/D6Mlo7Os/ttIS8tm3vPnGjnj0YfPeKpqfHAx5uef3HTZdU/Ptq5a+6cnZ1/qA0dZ/FEryPbP8B5nU/KM3ybb+Lo+jrbxkF+yPZyHBB3IamOOxRkxpn9GyTW7wWSXX76Hn3P35UMwHLZ1DC6wSSr3Kx+VN/iOcrs6Kl9LAF9H/z8hR1Sqc9XKhHdrvUCcqnWgT0WByFG0WTMiduMEHUIt8Ga1Od0O6wULBTDggVWpv4u5NPtqc9hDb0dLt+d+iL1xW61lb5FD0F56lnw0V/RtyAC4+kH9CFxL/0TTIDI2W/o28t66EvQ0rOMt10ghCpzsO0uMoa3XRUFNU9iKoQKeaBrOEwcMr6F65vtb8TNyLCYcqGzMKaZcMuiBxVo+dXZjdbIHFlWrEU1rjMGWaVX5g11Z1vL8suaK4RTXtlpSa2ylcr/dFpLyz6wFouCS5RcFvr3Yp+vGEZk2wtUsmgRpbTFarVV2MyCgTYU5IqyWlkh2xxVVSV09S/tZW5zn0GRcZ4U5jnzDLtyrT5vcbDYk2PhOMX2R9h+0GDtb9BmCPnezY/0bgfHOgFnLd9TYnsdqPw5PDaPGBZ6xd5+wjRETJ7i8jylIRPW+klmLmHJCmPHOdwqZYTMRqCESyFFKBHf7GKApmAwRdg+U5Ldk8weC5+HZcSftmtm2DQza+q7f4hNeCdZTKhsmcQ6cIH8XHf3c/Qs/ZCefX716ufhjrXv3NvZee87a3fRr3buhKw/wdBO+rRKVj+vJ2LJkefji8+fXd2588RnJ3Z27qRf0dcxuUToXPqfnTAV3tPnB9aJ8L1IE957GY7arSLrVQ/rTKmL72ZqTGs+tUfS+B4m/ezUnn7siD2nCBncrmxSTKp0W53JEw3b8LAw45c+rbj+mh4vNlQ+VlhYRqFzBg9NwM5ORvu4xiniOdXrRKYcSODZqWhn2RLStLOYjCVIsbNwIOCkhD2HXkx5fl1cZChpxLrUoqasioxHxS16iZ4mqK0PowJRAnU/VFUJy1JC4RJ1xRO8DMK0KYebmya/s8bSb0AwqFij4pxQETyNVRLcDtTnDn9X5QnJGajr4H3rYpwblaQJZdwohqdhm5g+MmFPOowc1Wb6oZ7OvHtuO5vVmF+/pwGU6GnYM37Q9DVzFsh3NQWi+qY5Xx8zYaZ6tXo1tseNCAcOQB2tRYA4qAFvPt+jUyFurx+BsAt/Fsrmpk6VNzUGvTnWYcLX+4WyA/6uwIFCs7lwf+rkgQCG/cIwnspfU5pnDIWnS88dSJ3c7/cfKGptLTwglGHwoL9rYG1ynC8gJdh3KqCUZjv15W7JjOyOIM9HBEMJhdhHNGq6+9n0+oFhkLVzdd/q9Ue+PLKenQAb/LfVmSe4dHY9eze8mX64fv2AfTpdFm/pBcWRdFGoXtgtUY9NNsHfvlVmauxAngZBE1dT07fKpd+cq5VhsG2cr7cSUsFtVza2FeOJMjj6gXqIOIw4UGzpCv+mOkomIb6S+jf14vKNQKWBKO+QXKxTKaJbNdv/Z9AWNEIMqyIagXe8EZi2FUNVI8aNjgLnXYifMpyl8hL6JfKeL5dSBc4shRwYCjl+WEu3Tnrl3Zcn0lvh8kmvrFjxypQUYWauU/SlhRxbZXyTypf09CyDM3BmWU9PXyVcAT2TZ0yfTG+lW/EKL+3RXzglRDk6n1dn5ofh46uOgDcIjDWyuiOtjDNLeByCFgcE46whqEtk8N7PmSM2KK7zTYkUeWC/ckoAWMBbcucvdm2/qH3FK0lY+8fQdWfJdRpt5M268//eSG3h1YC3u257eAVvWsuaEaf2rEDIgf2eoj2nhJN0L2vTlO3e6ZPhinfhQ54DvMoauDf1Fm/4V13LeRNfWrNgJQdjEBho6b4S2P/M7IX1MwIKo15IaLSX9mqQ4CdIyBfcayxNen+R29HPz8NA+nrFhNbX29eriQl+EhPqBfcaS8PmqJaWKxbEsyjzcLFVGqJ+ziLsKutBhlWIVHJ4wPgZPveTiQ44mo49ySgg0DCB4OxPA76mg4+eQuGJEYoOIOjiX2+KqyACXjMH5w1QirxhBzGy9WrBP5CLQSW0/BD1U/8hWi5M3L9f+jE9mPoUJtL9ggPaQHCkPmXYovMFDbs2i692BN4gMxqj1Ne0PqKJuGAUBpiUGahTvdBLE+f4MeMLRu6TZAT8M3kYi0jhT8TfGQxzF5pedmJVJRLvv16lF98zkDzGdIwCW90OHIoaQfXjfMQ+6u3TaELUUo8vEGak9moLEgs0mIThBQqW3qdBL7acPetbwJ/lskdp/oS5syE2Ztx8VOQ5jPYgDCVS/E1WFegdjDc5uLY5g+a+Gp6IUO4z1aMYcwLeZEGgCnxmphyhmAWi7zm09ZMjdPfvj8I2mAYlr67qJ/Me/Jx+TA880b23G//kjLvE72HREZGsepX+lT5JLz/6BCSh6PMH5/VpPB2X7f3fADEo6ovYG07uo+JCecJ1UlyiLcgsBpZmMXgs6luVeZErZnxzunVZs8PhE76u7L68u5L+H193f4zQj8LC3LHa/LgvMbNrmPTO2AkTxp45ylcVRNmeAQ5MZp/BhtgQ1nkNQwXUXeJc3+RIhqCG6Oth0GB3sMYH1ZAgcBqleJnHFv1tkv7mpVkPbm0E1AoC0S2TmIMOHqi+JmH4S9d/MofFg2/G4i95YyWcSo8dD7U3AWoT/tjwU0IZ28h47PiSOSwCyutLaS3vPd3fivsxVWa8mPLAyzg9Liu7m7sz+bwDTkt8rXGazJ2XOIJrLLRmytRuXDcauzLXpZR2NcP2qxk2MD8lQZuypntqmmy9TJvZnUA2snUBP1HY3Mgjhbp/HIKnyrA+GjGjClHAii+wi+VccsyZSpfT5VPn7IR9Nz733I2Ys0qYNFl7DB/AXVOPrd0FWSnnc2B4jjlTMTxbwPBMPsmWEJIJH8QdMucl9KR2Uj65IEVgr9aLY4Vz1EAGuBQpwsFi48WuBvI10Q82k3GZ4pHionAQZ7CQIZhHEFd1HrMLO0w4iKwJzALi8JjKcIJxDwMTTn34y18E7ZOa0f4/PnTz6UcXrZc3DVs69i8pzfLO+KlLnljF4pRSvP8k1L1xzNP0b1X0jH3zqyDeugvsdPKlrz48Dt+3vDP215euPbKtFBR8SFNMJxGxrZLGW8OWpcb87tL1ZPjDOoG1j89EfzrFWVRP+vC9PsKd3RjSzBASBtZnKtczy9gq5/wgfQGHlN7vM6fXizCM/gu2a9QCa6UH04HuvlE4Mdgw/H33mjW718j30zLEJyLsSZ3Sry0L2VOcPvTwGpbkPG6icj7L8IW7kg1emTL3HUNVCa+QPLceEYnTsSJ3IBu8GAnLisuUdN4ZphzXmTJJ4475gqs/7f2pM2Vd/Mhc8Hi4EEK1Ecmzz8TSCPu48Bj8B2nnRuZHmRFDNKGrA/ycwMqx5zgI/A3QX6T6ZZ9OjCVOm5lE0nM9yzVK5oTKCB0j4kRlumgJ12d1cRiJNUHajsVtTNw+OWizT1UPb2xdVxV67vI9pwolwvWyHWWejYfD1Us3nNrT0srXpqaCKqf9Ye1Wxr+DbGEEA5ERbCdNRFquHEwmP207mqQN9CS8Bm1tnyaPt83e20/2yruSx/ARjKcN4GaPjuNdW2rHXiAMkIHJLpnRKPVc/4t6RWS9Qtym+Af5f+UnuKwRsPCoByQCn1PLLJjFXFTpL+THqYVaOmCWBrO4HRIX2B8UTX8H1zySWyS1EplFf8G8UGHWLGqRH++gv8B3O+BzrssnFFYPxuiYgASEiFRvCllNr8xksYDUJsHTMSxJsHRYFyMm41YCIYE/jQlsDKZ6B3wJRKwe88bEGSxyd9o+Pg8BVyhWTX+Gc5st0syzNE+QNe6STIwiq7zGSBmbAWeJoDsecx5fwG5kTfm2/ucjQZzZNShz4lwTJBl9jx3xsM03+D48SB/8vnthgEylMqE+7cLAgAN0xgP6e0K8awRuB+G2DFbnb+1iZ5CF4ZisG2T4WbeNMEMJs5718TiJObNo6dUu4qM0jvD8GX4FLsg/zASuzRcdVI4YZYownCtKYxlpmQI5K2NWwEyZqOExxfhcwQeYituv2xAydnCGM8U6FjN5Lqev4LEKCiOAIRBEfIc3iF/6cJBv+vQn/eQnn96kcODglnD9mnrzbvqvX5bSf0Ju6S8hm9FEoq97Ja3FMXxOAwBDq8Eg4IIBFJCwesz1FnDe8NZi43SHX0U5vLGqfVypDgoCVk3HLmBmGyZH8OJ2bzzsqHSlMeIc9pQPYI9ej+8rPe1JSDJ10If1/JI5HOnQ+R1lCtxfn/EqI7fgmdjWlkfl8hqBGDECFy3zLmf6JzNHpN6bKwToXIGNEMV1xy1yKMD38Qfn2bDymZgo5c4cePJFue86MKjFNP2MZbNhuUpNsdXI8gaUm/q6TY+5iY84kxBNyGrTs5nVLRCJc41F4apFIjN1+4hYX1/fd4TZo9hU0vT5fBZLi/80zjRNAdFyj7pAXUCq+M6K6ldUixpkRDFoCQTlINMf48G4HIuLcQeictwh2h1+h2rHseaT216vLmikv6tptm95Y4Sz5Y0ttqZa+rvGTwyGTxqhrrbJtuWNkdaRb9xqb6qFOhZNN3H4FU7fam+uOZdSzyA3O4E5NNfoST/RM771dcy4jGM3ucDGYEV9/rwvH4Ab+VWI+fnOaRyUC7+BkOo3n96yaYNweHwf4aHUmPHf+iAidWTL6c3jU2M2bGJX4fCGb/GH4nNypTyjVyCgstXPlrusc4eUfmEsCGGYsEkj4ezRY/XF/SaTwWx1n5srOo8y6SyRxWZEvUx0qGbceoBz8ZTsyxH965GBbxIyOK+7D4n48AwrnmTwftD+QyYtkiELm576dyB6iSkuIAa+nyCDvp/A0tLfT4jAHbwN34u5ZBDm6kbwNNalQRc7x4AAeEZfsXj+OgO6vKoixyOWv4LaFcNcjqnG84rxpH+DihPS4CoMFAm82rj0M0XzL1Gw/0UtUzy+hO1mrR+oxoXzznLhvJMym3TI1zy2MDK3C+edsExH+720V9v7rQlXz4vpSzJooWk5dl55ju/+wodx1m995ZMazFsvKOjskfP0yPPKCH93GfrONa4qB9+uZkDLfqUQjnIPqO8pH170t7ffsf/n825aUlHkLCyKjC52vmUyj5n+fXUSGhqndSdGXrR/XEFBia+k2Du0umpkg7fUaquOpH3hdZ1Xn9Xsp+K8YYYKjrknqRuHzQ0nL0jLEhpZ2hSOvESYwZ6lZcyHupk9I2MHYUzHTOz4RhgVg7AFj6DPb0HNLlzMggqjGimWeQe00/85UamlPuvgtkitYwTeybwu3I7JE6bDvO7/xPrkKtvYTgbTQFsEexnEW8CF0horv35CU/DGZ1+YcP/9E1741caK5gk4ZZeO+c1r97YMHXP33WOGttz7+ktj2Jwgl8BJdafixhWsfw3F7F8iqBbRwQzaQeGyE/Qo1Jw4Kh09cfToCag52/U1kK/lhm3IoRu2QQO8to2+Rl/bBq/RshaJtDCdjOunaTtQEdv9MQpRFLSoxX3LgTjKtTREubBJNxIpiCqsnX0oqges7lEm33UTrcxhhFnz8IRU9lwKbtMfMPp+ux6lP1wP2w+Xn/p3JWvkO8os+4EyLSj+g+oPldoHL8+lOw50/lDJOH1e7mSJGIqm56iMcgzLNRkF5rRgCqIIY/Y0k8CtngyARYJyaEfbc0v6OR7LCWYdpb18CrMPyujxHW0Tqabfp/0ldFzP4z7Vg3OVL8iLfMf752wPIuuTjCzycgdl0Weq5w4WHD0kPsnHrk4mV48dt6Il3ODzNYRbVozjMcB7SsaVxzRSdogDoUEYx/lRNrPSQBrEeYnMv9kT5Fv1wC0jDLgljS2shmHdKdLtDxcxNS/FxaPE51EfSW6Nr1lTPvfiem0wd+K2hguHlDkEurFzZE+Uf1qncEW4j583nwb76c1slxR5h3TeGGq6J6rG6SbTNwQiz8I2FBAn99f1cJRUVBt3QfF5mCmOQWglFOlBH8qkZV+uXr1w6sqFf/0NnQbk+iVz6uouXbt96YK3FG3smHuW3ZinFt20+r6nhV8NH9daWkpb6PFJU28jaTs6kTP7wz4xrHriYYsv7pFna19oFTRRwS6oXnKFikvOtM1b49wim2EQ6+eMYwmYgswRk7MLOJCWxzhxe/s5Vko6Xel7U0j0phaAm00QI/ezZv3KeIOR5HB/ZxuOIMp+i8ljYR8asNk2BEC3DKt+I6BKr+nKDWjf8DHTzS2gm5i1bzROhPFeThNjiqVnDC9shEHjLErjagYztmnny0kz+Y/zZZgjqKgjuLtlMF4j5EONMEJ1jIAyCNRAvhQcAY54cIQQCKoO/MsXWSK8RVkXR3jmCeP5QhnGYaAM8iGuloEazzcEK/HGEccMJYdaIyvMXdNRI48QkDiPEPBtScWkIuboyMdZd6GIzBPFLNnkEsjLkGhT8n1FhcMiFUEAWXbkWnL9geJRzsJch5xX6nCGC8XcGkOhrSJ/Yo9k9Ug2Q/OkZqUgJ2R3j3FdtuidJwO1bl+NSynJrk2Wx3ODxV6Lx2MszbYmY0PlvOxQgbMsz+fMcjsNhaFgnVLamD8kWIUKowEMcpYMTtc1726SsrJHubPUPIMh35rbHBTyLaPrvEaDx1BTWyY4Suoryk2CRxr6LcH9L0mxIMPum/zHp7LCRQaLTSyNueOq2ZdndfogS/VnNcdkVbD7so0VTtHuNNqz1ycFk5wlGLN8pc0em9VkMIH/ZsgxGBTVLDrkItvQfHOJN+AwmbPiVos9x1SgWixyvsliLXQ2O2srKt2uSqfRPKW2oNWUZcpxlIcWz/gJ7X+mPOeWEa3DSgqiLXK2Uc01Fxepdq9FrjMWZEuWxpGjyzplh8mpcBm6V3SrC6SMDfJbPH6Az/t+fcMNv75BFAdfpJM38Ougv7SfJLO79DJUxzlvIF9rYq84YK/BGwNbKyRqArEXUb8vwd6REnwvC+ORa/BYA+lLcDtOIr3PJXD+wqL1PAfbACpILRmmf6+sey4hJ/Po3y2nv5YxIWOLDYd0VHl6wUtpYodI08i/Ru4njWOZLtwYuPqmrh083KfvRQrJtMPI2LXeB5jc6NIkn3fdGIZ8oY5WB7WP29H1gHftWIyw87QHMoRZGdAtzv/2PS1LMps7me+4gejSpI8wBV5EAU55jMhAgmlOeFCSCQHnYXqY41ucY4BGcvX9EKOIOjEEWyS+Y+rzBiEaDCj5oDBfLodubiyDcyYaAp9igf/0+8EP3MtP/G0M2xGjBxPOTv9Ef5c/X9Dy/RjKdya0p6KBQNSvatSBtDPX3xWAclG2jZu+8QyNTkx2xaBNSzjzMbH+VheGOp2J1L/wJX+UkMHfEo4mE0k7mUeW8D2jtE9gC8SZU6DHNBDDfGzZ8A6KiHLlf2C0mdUHrxlQH/D8ueCqDgx1Mpoe9rGN/Sjx0kG2m5MOMiealD4N+tJq2vmX+fq484nwAJKqD9L3Y9Z5wZeMPpCeJ3j7wJ5TkJk2OJPoB6f2pMXKmeQgZTiZmTsC9skpNaH08v00ou/Lh42CiGzXwbZHM2tWfsS3plXMFmh3v84k6fH/Hsc9A/Cnb0TJPdEWoe+kwGcPqoOzerYxkxi7F36W3sETYBWuqZ/imvLwvRYH9w6Iu8BhYh7XgzrZFrb5TC2Q6WaZ3rGMPkCX0AeW3TH2lR5NS/edpvW8Qn+kd9OROY/+9s1H5rRdYoF/aQ+c64UHNJptWSqm0o0W0nOCkMk4H3SLVyX75tdcCqytwyESZFt85UFlIMIcDwR9ujUsEg+YeC3xoUtwtwjML47dFah2m98bCOreoI48QeWbBG/neucuCkQC18+lX+28h/5rzg14s3iOJ+9t9rS39D68XfrY5yB9/thSDO4qSWk7U8Pn/mNT5+M/aarY8mu+qTCybRnt38rzS5x49MpbNl/52HH9bivAsgmtmGTqgiMg6HHXY1aY5fX6He0/0tmh/WLzwpXhzsTcWyZnbF3aoL1swZNGC1nTTXps3TOeInHGwMaQMgSAAQ7AuI09bPJWAclCLcHqUO3EIb9+371H6eX0SfrXV1cJpOv5S6D+sBgOU7LqVSiBabDt6Ocnnn+a/m06r8OrOBca+f8FUcr9zjhX5CTaGg8rAjOvBoRg2AXumDR1z5o1UyJzws/2Wr98up88/aW11/EOFB8XtTVTBDJlTXhOhJKpBYfoF0PoF1AwBAoObT50KO3TLGJLB++pySS9p3buO2pHxoLDDZ+mwWE13SeDzpxAZc6MOn1XPKTfy+gJvL+zM9+Z6T/mLsDwltnSGbHWQ6y/+TduhNfNyHbRQPTIoh//PCIKMe654JHIOroVqtahHh25Eqro1nXHhMdT77yTOpE68U7qHeFx+WN6zx/onvffh4V/EFENodekboRb6DrhGrgx8917poyMP4SnGFCFH5TJsWOo7g96Mb0ZN7h++YPfFnklL8zjWKaK386MVrD6wbK07x7X1ezI8CuZ/cmIs4vtZnOc9nBvczbv1EAQYZk9hfq43cFs1gof036udnWxweCBueOHzLphj77r20f0O8q4MQcyLpaBpP/TkKZrF3Xq8ZSH4cLv9arJBLLoO7029Z3hgId9i8x2j+3hWJhv3NnjulJSnv5M2Wp31PNHkqPebhl4xp+EM0/s4njohol/27r1b3Q/vZ3uZyGxy+LKN+bn/Z3+NXb1xNEmk6nI6cz95SU//uKiXK2kPLiJPvPIuFunjA6HyhSn0vPLn0OgK8epuWrCd9Dr3+l7JBEO5Lvlx359GGZfXaRqg7OGiby4s8vykRcX5qlbTWaTIbvYbHPlOpsacj6qcTVYJ8/GEk3NJZGs3GDbqFxwRvxh57xZYduYQDg3MCWZc15fidybtIjNdh//TwL4ZrzoyzARWxxn7y6hZFffxcpwWk3v/+yvlChLzpyFiz+Fx+THaDUcYwccP/s8HcUIiPR6apQ45+yOY8c4DqVtSen95cHaJhPPusJznmcmV3XYyuQx/Pz/AAfdhq542o2QsWrDMBCGfyVOSjOUDn4AdSlJiY1sMCTZ0hQHQqcM6RyMahsSKVj2EChd+wgd+wZ9s7xDz4pKl0IrkO7T3a+73wZwhU8wnNcNHhwzDPDiuIMLvDvu4hYnxx4G7M5xD9fsyXGf8q+kZN4l3e7tq5YZfDw77tDcN8ddPOLDsQef+Y574Cxx3Kd8gQU0DjiiQokcBWpwDJFhRDGGQIQEY+IV6SQU0RwGezR0GpvBQh+OVZkXNR9mIx6LKBnzlZaKz82+MUaSZGmV0k7JqJOit1hKJasy04p4TcWcmu6wJRHWMm92W4LUimsbK1JIayskYxwz2r81PlciTBBgSvv7M5BqVae6yiWPQ8Fn/McAXaJJMA1a8/9wu7FFQ2Vtf4mwE0IbW2fYyMqUWnEholAIwf/u+QXtVlqxAAAAeNpt0meTFVUUheH7DhkJEgQJgpIFhdvn7NM9gxKGCZKzKGZyUHJGySAgSq7i5wrFfYdPdFXX+tRP9V61Wl2tt8//rdbh1vueV29eWl2tYXQxjOGMYCSjGM0YxvIB4xjPBCbyIZOYzBSm8hHTmM7HzGAms5jNJ8xhLp/yGfOYzwIWsojFLOFzlrKML/iS5aygTUUiExRqGrrpYSVf8TWrWM0a1tLLOvroZ4BBvmE9G9jIJjazha1sYzs72MkudvMte/iO79nLD/zIT/zML/zKb+xjPwc4yCEOc4SjHOM4v/MHJzjJKU5zhrOc4zwXuMglLnOFq/zJX1zjOje4yS1uc4e73ONv7vOAh/zDI/7lPx7zhKc84zkveDnqwsljg1W7bVZmMrMZZjFrszG7zZ63mfSSXtJLekkv6SW9pJf00pBX6VV6lV6lV+lVepVepVfpVXpJL+klvaSX9JJe6njZu7J3Ze/K3pW9K3tXbg9915id/wid0Amd0Amd0Amd0Il3TueesJ+wn7CfsJ+wn7CfsJ+wn7CfsJ+wn7CfsJ+wn7CfsJ+wn0h6SS/pZb2sl/WyXtbLelkv62W9rBd6oRd6oRd6oRd6oRd6oVf0il7RK3pFr+gVvaJX9IperVfr1Xq1Xq1X69V6tV6tV+s1eo1eo9foNXqNXtPxijsr7qy4s+LOijsr7qy0h75rzG6zx+w115l9Zr85YA520l0Wd1ncZXGXxV0Wd1ncZama1x+EcTsAAAAB//8AAnjaY2BgYGQAgosrjpwF0ZcUq9bCaABTzgdAAAA=1

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/socicon.css?ver=20181009
200
text/css

1
ok

No Cache-Control - header
GZip: 3523/19394 Bytes




local SRI possible, possible hash-values:

sha256-e/rv9LETTG4AcU2zzLeX3+kwQS+Nk0gesLK6yqGrFmM=
sha384-aMgsSFYRkMHHlODRZpRjtNNlTtHs8bxbqfgPX12dWVmWZAOGbx2pA14GbnGhvD7v
sha512-7GEoVPpCBDIe/ih84uANs+rvFSfEM78/8iIDw6/q2q69L/m/uGIQR+FqPHkLxOO/yhllkxtDaxdAqupWKaRd6A==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/socicon.css?ver=20181009" crossorigin="anonymous" integrity="sha256-e/rv9LETTG4AcU2zzLeX3+kwQS+Nk0gesLK6yqGrFmM=" />



Content loaded via url("...")

../font/socicon.eot2
../font/socicon.svg1
../font/socicon.ttf1
../font/socicon.woff1

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/trx_addons/css/font-icons/css/trx_addons_icons-embedded.css
200
text/css

1
ok

No Cache-Control - header
GZip: 133901/217709 Bytes




local SRI possible, possible hash-values:

sha256-Hlzz8MXbxjv8jMFJvdnuNrVEaQ7ugJ0j3MDAJya0mr0=
sha384-PTvPP+1RLWgpRN3vXKG4G3Mx5f8JRcHloKh3iEmX3upem1klDjtmcaP+p9k57QfV
sha512-hZVJbiWcLYnH55m4ywLeAPBGQr08cxXyIWGI9AAstjlJo8tmaGleILaxEZC9ShjAO3FtQiUxopJ5FSoBNjJkWA==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/trx_addons/css/font-icons/css/trx_addons_icons-embedded.css" crossorigin="anonymous" integrity="sha256-Hlzz8MXbxjv8jMFJvdnuNrVEaQ7ugJ0j3MDAJya0mr0=" />



Content loaded via url("...")

../font/trx_addons_icons.eot?59224671
../font/trx_addons_icons.eot?5922467#iefix1
../font/trx_addons_icons.svg?5922467#trx_addons_icons1
data:application/octet-stream;base64,AAEAAAAPAIAAAwBwR1NVQiCLJXoAAAD8AAAAVE9TLzI+aVPdAAABUAAAAFZjbWFw7z8EyAAAAagAABDWY3Z0IAdn/nIAAVfoAAAAIGZwZ22KkZBZAAFYCAAAC3BnYXNwAAAAEAABV+AAAAAIZ2x5Zm4CUu8AABKAAAEwImhlYWQQbFwAAAFCpAAAADZoaGVhCDwFbQABQtwAAAAkaG10eKCb/ssAAUMAAAAEPGxvY2Hq6zphAAFHPAAAAiBtYXhwBF4ONAABSVwAAAAgbmFtZbCvFuMAAUl8AAADLXBvc3QFxGuMAAFMrAAACzRwcmVw5UErvAABY3gAAACGAAEAAAAKADAAPgACREZMVAAObGF0bgAaAAQAAAAAAAAAAQAAAAQAAAAAAAAAAQAAAAFsaWdhAAgAAAABAAAAAQAEAAQAAAABAAgAAQAGAAAAAQAAAAEDbQGQAAUAAAJ6ArwAAACMAnoCvAAAAeAAMQECAAACAAUDAAAAAAAAAAAAAAAAAAAAAAAAAAAAAFBmRWQAQOgA8pgDUv9qAFoDmwDfAAAAAQAAAAAAAAAAAAUAAAADAAAALAAAAAQAAAQeAAEAAAAAAxgAAwABAAAALAADAAoAAAQeAAQC7AAAADAAIAAEABDo6+kS6RjwR/Cw8LLwy/De8OTw6PD18PfxMfE08V7xY/G58fDx9PI28k7yUPKY//8AAOgA6Q/pGPBH8LDwsvDK8Nzw5PDo8PXw9/Ew8TPxXfFg8bnx8PH08jbyTvJQ8pj//wAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQAwAgYCDAIMAgwCDAIMAg4CEgISAhICEgISAhQCFgIYAh4CHgIeAh4CHgIeAh4AAAABAAIAAwAEAAUABgAHAAgACQAKAAsADAANAA4ADwAQABEAEgATABQAFQAWABcAGAAZABoAGwAcAB0AHgAfACAAIQAiACMAJAAlACYAJwAoACkAKgArACwALQAuAC8AMAAxADIAMwA0ADUANgA3ADgAOQA6ADsAPAA9AD4APwBAAEEAQgBDAEQARQBGAEcASABJAEoASwBMAE0ATgBPAFAAUQBSAFMAVABVAFYAVwBYAFkAWgBbAFwAXQBeAF8AYABhAGIAYwBkAGUAZgBnAGgAaQBqAGsAbABtAG4AbwBwAHEAcgBzAHQAdQB2AHcAeAB5AHoAewB8AH0AfgB/AIAAgQCCAIMAhACFAIYAhwCIAIkAigCLAIwAjQCOAI8AkACRAJIAkwCUAJUAlgCXAJgAmQCaAJsAnACdAJ4AnwCgAKEAogCjAKQApQCmAKcAqACpAKoAqwCsAK0ArgCvALAAsQCyALMAtAC1ALYAtwC4ALkAugC7ALwAvQC+AL8AwADBAMIAwwDEAMUAxgDHAMgAyQDKAMsAzADNAM4AzwDQANEA0gDTANQA1QDWANcA2ADZANoA2wDcAN0A3gDfAOAA4QDiAOMA5ADlAOYA5wDoAOkA6gDrAOwA7QDuAO8A8ADxAPIA8wD0APUA9gD3APgA+QD6APsA/AD9AP4A/wEAAQEBAgEDAQQBBQEGAQcBCAEJAQoBCwEMAQ0BDgAAAQYAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAADAAAAAAMuAAAAAAAAAEOAADoAAAA6AAAAAABAADoAQAA6AEAAAACAADoAgAA6AIAAAADAADoAwAA6AMAAAAEAADoBAAA6AQAAAAFAADoBQAA6AUAAAAGAADoBgAA6AYAAAAHAADoBwAA6AcAAAAIAADoCAAA6AgAAAAJAADoCQAA6AkAAAAKAADoCgAA6AoAAAALAADoCwAA6AsAAAAMAADoDAAA6AwAAAANAADoDQAA6A0AAAAOAADoDgAA6A4AAAAPAADoDwAA6A8AAAAQAADoEAAA6BAAAAARAADoEQAA6BEAAAASAADoEgAA6BIAAAATAADoEwAA6BMAAAAUAADoFAAA6BQAAAAVAADoFQAA6BUAAAAWAADoFgAA6BYAAAAXAADoFwAA6BcAAAAYAADoGAAA6BgAAAAZAADoGQAA6BkAAAAaAADoGgAA6BoAAAAbAADoGwAA6BsAAAAcAADoHAAA6BwAAAAdAADoHQAA6B0AAAAeAADoHgAA6B4AAAAfAADoHwAA6B8AAAAgAADoIAAA6CAAAAAhAADoIQAA6CEAAAAiAADoIgAA6CIAAAAjAADoIwAA6CMAAAAkAADoJAAA6CQAAAAlAADoJQAA6CUAAAAmAADoJgAA6CYAAAAnAADoJwAA6CcAAAAoAADoKAAA6CgAAAApAADoKQAA6CkAAAAqAADoKgAA6CoAAAArAADoKwAA6CsAAAAsAADoLAAA6CwAAAAtAADoLQAA6C0AAAAuAADoLgAA6C4AAAAvAADoLwAA6C8AAAAwAADoMAAA6DAAAAAxAADoMQAA6DEAAAAyAADoMgAA6DIAAAAzAADoMwAA6DMAAAA0AADoNAAA6DQAAAA1AADoNQAA6DUAAAA2AADoNgAA6DYAAAA3AADoNwAA6DcAAAA4AADoOAAA6DgAAAA5AADoOQAA6DkAAAA6AADoOgAA6DoAAAA7AADoOwAA6DsAAAA8AADoPAAA6DwAAAA9AADoPQAA6D0AAAA+AADoPgAA6D4AAAA/AADoPwAA6D8AAABAAADoQAAA6EAAAABBAADoQQAA6EEAAABCAADoQgAA6EIAAABDAADoQwAA6EMAAABEAADoRAAA6EQAAABFAADoRQAA6EUAAABGAADoRgAA6EYAAABHAADoRwAA6EcAAABIAADoSAAA6EgAAABJAADoSQAA6EkAAABKAADoSgAA6EoAAABLAADoSwAA6EsAAABMAADoTAAA6EwAAABNAADoTQAA6E0AAABOAADoTgAA6E4AAABPAADoTwAA6E8AAABQAADoUAAA6FAAAABRAADoUQAA6FEAAABSAADoUgAA6FIAAABTAADoUwAA6FMAAABUAADoVAAA6FQAAABVAADoVQAA6FUAAABWAADoVgAA6FYAAABXAADoVwAA6FcAAABYAADoWAAA6FgAAABZAADoWQAA6FkAAABaAADoWgAA6FoAAABbAADoWwAA6FsAAABcAADoXAAA6FwAAABdAADoXQAA6F0AAABeAADoXgAA6F4AAABfAADoXwAA6F8AAABgAADoYAAA6GAAAABhAADoYQAA6GEAAABiAADoYgAA6GIAAABjAADoYwAA6GMAAABkAADoZAAA6GQAAABlAADoZQAA6GUAAABmAADoZgAA6GYAAABnAADoZwAA6GcAAABoAADoaAAA6GgAAABpAADoaQAA6GkAAABqAADoagAA6GoAAABrAADoawAA6GsAAABsAADobAAA6GwAAABtAADobQAA6G0AAABuAADobgAA6G4AAABvAADobwAA6G8AAABwAADocAAA6HAAAABxAADocQAA6HEAAAByAADocgAA6HIAAABzAADocwAA6HMAAAB0AADodAAA6HQAAAB1AADodQAA6HUAAAB2AADodgAA6HYAAAB3AADodwAA6HcAAAB4AADoeAAA6HgAAAB5AADoeQAA6HkAAAB6AADoegAA6HoAAAB7AADoewAA6HsAAAB8AADofAAA6HwAAAB9AADofQAA6H0AAAB+AADofgAA6H4AAAB/AADofwAA6H8AAACAAADogAAA6IAAAACBAADogQAA6IEAAACCAADoggAA6IIAAACDAADogwAA6IMAAACEAADohAAA6IQAAACFAADohQAA6IUAAACGAADohgAA6IYAAACHAADohwAA6IcAAACIAADoiAAA6IgAAACJAADoiQAA6IkAAACKAADoigAA6IoAAACLAADoiwAA6IsAAACMAADojAAA6IwAAACNAADojQAA6I0AAACOAADojgAA6I4AAACPAADojwAA6I8AAACQAADokAAA6JAAAACRAADokQAA6JEAAACSAADokgAA6JIAAACTAADokwAA6JMAAACUAADolAAA6JQAAACVAADolQAA6JUAAACWAADolgAA6JYAAACXAADolwAA6JcAAACYAADomAAA6JgAAACZAADomQAA6JkAAACaAADomgAA6JoAAACbAADomwAA6JsAAACcAADonAAA6JwAAACdAADonQAA6J0AAACeAADongAA6J4AAACfAADonwAA6J8AAACgAADooAAA6KAAAAChAADooQAA6KEAAACiAADoogAA6KIAAACjAADoowAA6KMAAACkAADopAAA6KQAAAClAADopQAA6KUAAACmAADopgAA6KYAAACnAADopwAA6KcAAACoAADoqAAA6KgAAACpAADoqQAA6KkAAACqAADoqgAA6KoAAACrAADoqwAA6KsAAACsAADorAAA6KwAAACtAADorQAA6K0AAACuAADorgAA6K4AAACvAADorwAA6K8AAACwAADosAAA6LAAAACxAADosQAA6LEAAACyAADosgAA6LIAAACzAADoswAA6LMAAAC0AADotAAA6LQAAAC1AADotQAA6LUAAAC2AADotgAA6LYAAAC3AADotwAA6LcAAAC4AADouAAA6LgAAAC5AADouQAA6LkAAAC6AADougAA6LoAAAC7AADouwAA6LsAAAC8AADovAAA6LwAAAC9AADovQAA6L0AAAC+AADovgAA6L4AAAC/AADovwAA6L8AAADAAADowAAA6MAAAADBAADowQAA6MEAAADCAADowgAA6MIAAADDAADowwAA6MMAAADEAADoxAAA6MQAAADFAADoxQAA6MUAAADGAADoxgAA6MYAAADHAADoxwAA6McAAADIAADoyAAA6MgAAADJAADoyQAA6MkAAADKAADoygAA6MoAAADLAADoywAA6MsAAADMAADozAAA6MwAAADNAADozQAA6M0AAADOAADozgAA6M4AAADPAADozwAA6M8AAADQAADo0AAA6NAAAADRAADo0QAA6NEAAADSAADo0gAA6NIAAADTAADo0wAA6NMAAADUAADo1AAA6NQAAADVAADo1QAA6NUAAADWAADo1gAA6NYAAADXAADo1wAA6NcAAADYAADo2AAA6NgAAADZAADo2QAA6NkAAADaAADo2gAA6NoAAADbAADo2wAA6NsAAADcAADo3AAA6NwAAADdAADo3QAA6N0AAADeAADo3gAA6N4AAADfAADo3wAA6N8AAADgAADo4AAA6OAAAADhAADo4QAA6OEAAADiAADo4gAA6OIAAADjAADo4wAA6OMAAADkAADo5AAA6OQAAADlAADo5QAA6OUAAADmAADo5gAA6OYAAADnAADo5wAA6OcAAADoAADo6AAA6OgAAADpAADo6QAA6OkAAADqAADo6gAA6OoAAADrAADo6wAA6OsAAADsAADpDwAA6Q8AAADtAADpEAAA6RAAAADuAADpEQAA6REAAADvAADpEgAA6RIAAADwAADpGAAA6RgAAADxAADwRwAA8EcAAADyAADwsAAA8LAAAADzAADwsgAA8LIAAAD0AADwygAA8MoAAAD1AADwywAA8MsAAAD2AADw3AAA8NwAAAD3AADw3QAA8N0AAAD4AADw3gAA8N4AAAD5AADw5AAA8OQAAAD6AADw6AAA8OgAAAD7AADw9QAA8PUAAAD8AADw9wAA8PcAAAD9AADxMAAA8TAAAAD+AADxMQAA8TEAAAD/AADxMwAA8TMAAAEAAADxNAAA8TQAAAEBAADxXQAA8V0AAAECAADxXgAA8V4AAAEDAADxYAAA8WAAAAEEAADxYQAA8WEAAAEFAADxYgAA8WIAAAEGAADxYwAA8WMAAAEHAADxuQAA8bkAAAEIAADx8AAA8fAAAAEJAADx9AAA8fQAAAEKAADyNgAA8jYAAAELAADyTgAA8k4AAAEMAADyUAAA8lAAAAENAADymAAA8pgAAAEOAAAAAv/9/2oD6wNSACcAUABRQE4kFgYDAQJMQjQDBAMCRwABAgMCAQNtBwEDBAIDBGsGAQAAAgEAAmAABAUFBFQABAQFWAAFBAVMKSgBAEdFMS8oUClQFBIMCgAnAScIBRQrASIHBgcGBxQWHwEzMjU2NzY3NjMyFhcHBhYfARY+AS8BLgEPASYnJgEiFQYHBgcGIyInJic3NiYvASYOAR8BHgE/ARYXFjMyNzY3Njc0Ji8BAe6DcW1DRQUFBARUEwU1M1NXY0+ONDoJAgz3CxQKBDoCEglBRFpcATMTBTUzU1ZjUEhFNTsIAgv4CxQKBDoCEgpARFpdZoJxbkJFBQUEBANSQD5rboEICQIBEmJTUS8xPjg5CRMDMgMJFhDjCAsGPEYmKP4EEmJTUS8xIB44OQkTAzIDCRYQ4wgLBjxGJihAPmtugggIAgEAAAAMAAD/agPoA1IADwAhADUASQBcAG0AfgCQAKQAuADKANoAq0CoDAECARwEAgACVU0CBAB7c2piBAMGiwEIBcQBCwfXvAIJC88BCgkIRw0BAgEAAQIAbRABCAUHBQgHbQAHCwUHC2sACQsKCwkKbQwBAQAABAEAYA4BBAADBQQDYA8BBgAFCAYFYBEBCwkKC1QRAQsLClgACgsKTMvLpqVubl1dIyIAAMvay9nT0cLApbimuImHbn5ufXd1XW1dbGZkIjUjNQAPAA4mEgUVKwEiBh0BFBY7ATI2PQE0JiMXJg8BBhYfARUWNj8BNiYvASYFIg8BDgEfATAxHgE/AT4BLwE1JgUiDwEwMQ4BHwEeAT8BMz4BLwEmBSIPAQYWHwEWNj8BMDE2Ji8BJgUxIgYdARQWOwEyNj0BNCYjBTEiBh0BFBY7ATI2PQE0JiMFIg8BIwYWHwEWNj8BNiYvASYFIg8BIw4BHwEeAT8BMDE+AS8BJgUiDwEOAR8BFR4BPwE+AS8BMDEmBSIPAQYWHwEWNj8BNiYvATAxFyIGHQEUFjsBMjY9ATQmIwHOBAcHBEYFBwcFtAYEWwMCBTwECgJbAgIEPQH+UAIEPQQCAlsCCQU9BAICWwMCZQQCnQQDAiMDCQSdAQQCAiMD/M8IAyMCAgSeBAoCIwICBJ4EAscEBwYFtwUGBgX8LwUHBwW2BQYGBQJOBwMiAQICBJ4ECgIjAgIEngL9xgMCnQEEAgIjAgoEnQQDAiMGAc8EAj0EAgJbAgoEPQQCAlsD/ooHA1sCAgQ9BAkCXAIDBDyPBQcHBUYFBgYFA1IGBbcEBwYFtwUGLwEGngQKAiIBAgIEngUJAiMBAgIjAgoEnQQDAiMDCQSdAQajAVsCCQU9BAICWwIKBD0HBgY9BAkCWwMCBTwECgJbAusGBUYFBwcFRgUGBQcFRgUGBwRGBQeZBjwECgJbAgIEPQQJAlwBBQFbAgoEPQQCAlsCCQU9BnoBIwMJBJ0BBAICIwIKBJ0GAgaeBAoCIwICBJ4FCQIjOAYFtwUGBwS3BQYAAAABAAD/nAMgAyAAJwBEQEEhAQUEFAsCAgMmBwIBAANHAAQFBG8ABQMFbwADAgNvAAIAAm8GAQABAG8AAQFmAQAgHhsaExEODAUEACcBJwcFFCslMhYUBiImNTQ2NSUGIyImNDYzMhclNCY1NDYyFhQGIyInBRYUBwU2Aoo+WFh8WAL+/CoyPlhYPjYmAQQCWHxYWD40Jv76AgIBBiTIVn5YWD4GEAScIFh8WB6cBBAEPlhWflggnAgiCJweAAP//f+xA18DCwACAAkAFgArQCgFAQAFAUcABQAFbwAAAwBvAAMBA28CAQEEAW8ABARmFRQREhERBgUaKwEXIwUzCQEzNyElFA4BIi4CPgEyHgEBrXDhATw1/wD+/zU6ASMBG3LG6MhuBnq89Lp+AferfQGC/n5ZNnXEdHTE6sR0dMQAAAYAAP9pAxIDDQAIABEAHgA4AE0AWQC7t0lGQAMACwFHS7AJUFhAQAALAAALYw0OAgIKCQoCCW0PAQkDCgkDawwBAwQKAwRrCAYCBAUKBAVrBwEFBW4BAQAKCgBUAQEAAApXAAoACksbQD8ACwALbw0OAgIKCQoCCW0PAQkDCgkDawwBAwQKAwRrCAYCBAUKBAVrBwEFBW4BAQAKCgBUAQEAAApXAAoACktZQCUfHxMSWFdSUUhHPTwfOB84NTMwLywrKCckIhkYEh4THhgQEAUWKwEyNi4BDgIWFzI2NCYOAR4BBTIWBxUUBiImPQE0NgURFAYrARUUDgEmJzUjFRQOASYvASMiJicRJR4BFSE0NjcnJjc2HwE2Mhc3NhYHExUUBiImPQE0PgEWARMJDgIKFggEEPMJDAwSDgIK/kYXIgEgMCIiAmckGSogMiABTSAxIAEBKRoiAQF/O0j9/EY9JwQGCAQoNXY1KAQOBOMiLyIiLyICRQwSDgIKFggCDBIOAgoWCGkiF/AYIiIY8BciC/6NGiR/GCACJBZ/fxggASIXfyQaAXPiHm5CQm4eSQgEAwdKGBhKBwcI/qfwGCIiGPAYIAEiAAYAAP9qAsQDUgAHAA0AGQAqAG4AmgCmQKOBDgIBABQCAQMOAYx5AgYOckgLAw0HYwkCAw1bAQwKUgEJCwdHAAEADgABDm0ABg4EDgYEbQgBBwQNBAcNbQANAwQNA2sACQsFCwkFbQAPAAIADwJgABAAAAEQAGAADgAEBw4EYAADAAoMAwpeAAwACwkMC2AABRERBVQABQURWAARBRFMl5WIh399eHZta2ZlX11ZV1ZUIhYoJhoVIyolEgUdKwEHFzY1NCMiAxc2NycmAxQXNjMyFycmIyIGAxQeATcyNjc0Jy4DByIGBxQXHgE3MjY9ATQmJy4BJyIHBhQeAjIWNzMyFhcGBwYHDgEHFBYVBwYVJicGIxYVFAYHIiY1NDcXFjMyNjU0JiMiBgc0NjcmNTQ2MzIXAjU0NjMyExc3PgMXMhYVFAceAxcUDgIHIicuAQIUQEJcFh/QEhUTKBafWQkSCSFEKRsLCi06SBQIDAESBxYeKA4MHFgOIYpYf6sOCh+uQBQHBxgmMDIuEA0NEQMQJiISJDABFAEDTAUFEgEsHy5eEiIrHwcQYhAYHkAwNBBEIxAXWy4rSWwFKAsmIi4TKC5ZIiwWBgE0YIpXPj5TegJ/twz8JSD+AzEXDgcEAfU37AYDxHoS/kwUXFABEAcNLBEuNCgDHsYXI1FcAb2QJQ0sCRwcAQYDJBwQDAQCFRQQDwwNGkwmEkARBgcBBXMBBAceKAFYLRMSKjoICBN8Mh85RA8qECNECAEBOy04/rwNbh9SNiwCOCg89wgiNjIlU5JqPAEXIJYAAAACAAD/sQMJA1IAIAAwAHNACigBBAMaAQEEAkdLsApQWEAZAAUDBW8AAwQDbwAEAQRvAAEAAW8CAQAAZhtLsAtQWEAVBQEDBANvAAQBBG8AAQABbwIBAABmG0AZAAUDBW8AAwQDbwAEAQRvAAEAAW8CAQAAZllZQAkhISQhEiMGBRorJQYHBiMiJyYiBiMiAjU0NjMyFjMyNjMyFxYXBgcGFRQWAxQGBwYHBgc+ATceAR0BFAMJFS9ISBszMEZaHVWlfmAodBMZcChCNR0dLBQkTJ8hJB4eFCYCU2IBAqxGRW4SEiYBI4d/oiImJBQkJR00P0VwAoEiVCMeCgcDU3gXAggCBgQAAAAGAAD/+AR4AsQAAwAJAB8AJgAuAEEBOLU3AQoCAUdLsBNQWEBQAAANAQ0AAW0AAQwHAWMABQgJBAVlAA0ADAcNDGAABw8BAgoHAmEACwAKAwsKYAADAAgFAwheEAEEDgYEVAAJAA4GCQ5gEAEEBAZZAAYEBk0bS7AUUFhAUQAADQENAAFtAAEMBwFjAAUICQgFCW0ADQAMBw0MYAAHDwECCgcCYQALAAoDCwpgAAMACAUDCF4QAQQOBgRUAAkADgYJDmAQAQQEBlkABgQGTRtAUgAADQENAAFtAAEMDQEMawAFCAkIBQltAA0ADAcNDGAABw8BAgoHAmEACwAKAwsKYAADAAgFAwheEAEEDgYEVAAJAA4GCQ5gEAEEBAZZAAYEBk1ZWUAnCwoFBEE/MS8uLCknJiQiIB0cFxURDw4NCh8LHwgHBAkFCREQEQUWKwEhFSEHIgYHMyYDMjY3MwYjIiY3NDYzMh4BBxQHIRQWJTMyNTQrATUzMjY3NCsBJyEyHgIVFAceARcUDgMnIQQH/uMBHYwzPgPjClwjQgl7N7d3jgGQdE1yOgEB/pFA/VSlcm+onCwyAWqRmwFMMExCImBAQAEcLkBGKP6rApVFqTozbf66JB6rknl0mkx8TQkRPkQdXWRqKipQeBAkSDJlLhFeQylGLiAQAQAABQAA/5YDEgMzAAoAFQApAEIAZAAiQB9WPzwgAAUBRQABAAABVAABAQBYAAABAEw+PTIxAgUUKwEWBicuATY3Nh4BFy4BBw4BFx4BPgETLgEvASYHDgIHHgEfARY/AT4BEw4DBw4BJicuAycmJz8BFiA3HgEGEwYDDgIHBicmJy4CLwIuASc+Az8BNjc2FxYXFhQBxwRAHxUQDhYUKh4+CG43IyoBA1JmRH8LKAwoopoYGiILEDQPMX97Mg8yMQQKBBwTMHRsOxkoLiQLDhEDCnwBPnwMAghlDy8DGBgTjMiLUQgMCAEGHwYOBQIQEiIIG0Zp06ZWIgkBcyMsEwkuLgkLCCAKPEAZD0QmM0gJVgFhDxQCBxobBAYSDxAUAgYQDwcCFP3ODjgmKAwbGgIJBQoUHhM2bQkFU1MDFB4CE17+8BEcEghGFQ8/BhAYByqtImInDhoQEgMKGgoVMRkrCyIAAAAD////sQNaAwsAAgAJABkAOEA1AgEAAgkBAQACRwAAAgECAAFtAAUAAgAFAl4DAQEEBAFSAwEBAQRYAAQBBEw1NREREhAGBRorJSMbATMDIwMzNwERFAYHISImNxE0NjchMhYB/6RSgq219bWu1QFZXkP96UJgAV5DAhdCYPQBNP4YAjz9xLABev3oQl4BYEECGEJeAWAAAAQAAP+xBHcDCwAZADUAVwBbAOxLsBBQWEA8CQEDBAAEA2UGAQAFBQBjEAEPAAwCDwxgCAECCgEEAwIEYAsBBQcBAQ0FAWEADQ4ODVQADQ0OVgAODQ5KG0uwEVBYQD0JAQMEAAQDZQYBAAUEAAVrEAEPAAwCDwxgCAECCgEEAwIEYAsBBQcBAQ0FAWEADQ4ODVQADQ0OVgAODQ5KG0A+CQEDBAAEAwBtBgEABQQABWsQAQ8ADAIPDGAIAQIKAQQDAgRgCwEFBwEBDQUBYQANDg4NVAANDQ5WAA4NDkpZWUAeWFhYW1hbWllRTz89NDIsKignJCIRJiISIyIQEQUdKwEzDgEHIiY0NjcyFhcjLgEHIgYHFB4CMzIlMw4BByImNzQ2NzIWFyMuAQciBhcUHgIzMjY3NCYnJi8BJiEgDwEOAQcOAhYXHgIXHgEzID8BNjc+ARMRIREBtnQIXklaaGhOU14HcQMiHSAiAQYOHhY1AZVzB15JWmgBaE5SXgdyAiIcICQBBBAcFxsgyxIZAwQVMP6r/qMvCgcKAxkQARIYBAoMBBjamgFUMRUGARoQbPuJASBZZAGC3IIBYlkkKAFEQRooJhROWWQBgm9tggFiWSQoAURBGigmFCpmc3AiBQMOJCQGBAgEIXDocCEFCAYEEhIkDgQFIXACHfymA1oACAAA/2oD6ANSAAMABgAKAA4AEgAVABkALQAtQCoZGBcVFBIREA4NDAoJCAcGBQQDAgEVAAEBRwABAAFvAAAAZiopIB8CBRQrNwU1Jwc3JwElJwcnNycHJzc1DQEXNQc3JRUFERQHAQYiJwEmNRE0NwE2MhcBFnkBULq5bGwByQFRl7ormJiYTbr+sAKtbLmX/q8ByRP+NwwYDP43ExMByQwYDAHJE8bhyXwUSEj+P+FkfEpmZmY0fMnhmEiQFGThyRj+0BcN/s8HBwExDRcBMBcNATEHB/7PDQAAABcAAP9qBHcDUgBGAE4AWQBgAGUAagBvAHYAewCAAIgAjQCSAJYAmgCdAKAApQCtALAAswC2AL8A30DcOy4CDwarAREPr66VkZCPjYmIXAoKEb28u7CtrKijop2cmpmYloyLioeBfnt6eWloZ2RXVlVUT0EoIxIKHwYCDBK1s3QDDgwZDAIBCwdHAAoREhEKEm0IAQYYEAIPEQYPXgkHAgUAEQoFEWAZFxYdExwGEh4bGhUUBQwOEgxeAA4LAA5UDQELAwEBAAsBXgAODgBYBAICAA4ATLS0ZmZhYbS2tLaysaCflJN9fHh3c3JubWZqZmphZWFlYF9eXVtaTk1MS0pJSEc/Pjk4NzY1NDMyMTARERERHh8FGSsBFAYPARYVFAYPARYVFA4BJyMGIicjBiImJzQ3Jy4BNTQ3Jy4BNDY/ATU0PwEmNTQ2MhczNjIXMzYyFhcUBxcyFhUUBxceAQEzJyMHMzYyARwBBx8BNzUnBgclIxclIwYiATQ3JwcjNycHHwE/ASMXBTM3IxUXFiczNycPATM1BxYRMB0BFAcXNTcVFzcvAQcVNyclIwUXFQcXNyUnFQUHMzcXEycjJyY9AS8BAxcBNQcTIxclBz8CJjU3JwMXNgR3DgxyAg4MawESGwngCR4J3gobEgECawwOAnMLDhAKbxN0AhQaC9wJHgnfChsSAQJzDRIEaAsO/drZv0+/yQoW/fkBdAhpaAcJAXvYagE1nAkaAYECIwoRDY2lI9EJJe+6/ggCv9ACCArgJKxYbFtdAgRfEVWmfH0CcmoB7An+pXemrqX+mEwBDxcvpIVJAQEMBXgH9K3+L1tbW1sCXhtJFnMBAl9IKwIBXwwSAsYFBQwQA7wFBA0SAQoLCwsSDgQHuwISCwUFxgMSFhICwAMUCcoGBA4SDAwMDBIOAwfIEg0HCLUCEv44xcUJAbwCCwPJA2/CbAUB+m9vCf1lAwMmLDuUqyTND62/BsW7AwPSJbNde2liBQHKAQEJB2OWBq1YsIN8BJQqcAV9fRiwsqsJTp57GduMAVwDDAcJAdID/v63ARh9nv4Rnp5+fifKBQMJpf6qLgIAAAEAAP+OA+EDCwAPAC9ALAgHBAMEAUQAAQIBcAAAAAQDAAReAAMCAgNSAAMDAlYAAgMCShERFBQQBQUZKxMhAwUlNzMHFyU3ITchNyGaA0eU/j/+eyemEOsBECb9XSECohb9XgML/RiVlcZSWVm+pWsAAAAAAgAA/2oDEgNSAA0AGwAzQDAPAQMCAUcFAQBFAAAAAgMAAmAEAQMBAQNUBAEDAwFYAAEDAUwODg4bDho3NCIFBRcrETQ2MyE3ERQGIyEiJjUlJzU0JgchIgYVERQWF2ZJAZ7FZkn+TElmArBjJBn+8hokJhgB10lqyPzMSmpqShRk7RomASQb/u4aJAEAAAAAAgAA/7EDWQMLAA0AHQAzQDAAAAECAQACbQACAwECA2sABQABAAUBYAADBAQDVAADAwRYAAQDBEw1NSETIREGBRorJREhESEiBhcRIREhMjYTERQGByEiJjURNDY3ITIWAzX+eP70NEoBAYkBCzRKI15D/elDXl5DAhdDXlIBDAGJSjP+9P53SgJL/ehCXgFgQQIYQl4BYAABAAD/sQI7A1IAEwA4QDUAAQQFCgECAQJHAAUEBW8AAgECcAAEAAMABANeAAABAQBSAAAAAVYAAQABShMRExMREgYFGisBAxczFSEPAiM1EycjNSE/AjMCO6kOm/7mGU8RqKkNnAEbGU8RpwKp/rsR6BCZEaoBRRHnEZgRAAAAAAgAAAAABHcCtQAFAAkADQARABkAHQAlACkAikCHFwEIAAhvAAAHAG8ABQELAQULbQAHFgEGAgcGXg8JAgITDQIDBAIDXhkUGA4VBQQSDAIBBQQBXhEBCwoKC1IRAQsLClYQAQoLCkomJhoaDg4KCgYGJikmKSgnJSQjIiEgHx4aHRodHBsZGBcWFRQTEg4RDhEQDwoNCg0MCwYJBgkSEREQGgUYKxMzESERMxE1IxUTETMRJxUzNRchESE1MzUjNzUjFRMhESE1MzUjNzUjFbdy/te3ReVycnIuASn+17e3t0XlASn+17e3t0UCtf3bAYX+187OASn+ewGFoHJyoP3yWy5czs4BKf3yWy5czs4ACP/9/7EDXwMLAA4AHwAmAC0AMAA8AFQAYQEnS7AJUFhAF0c/NzUiBQIDEQEEAj0rKRcLAgYABwNHG0uwClBYQBdHPzc1IgUCAxEBBQI9KykXCwIGAAcDRxtAF0c/NzUiBQIDEQEEAj0rKRcLAgYABwNHWVlLsAlQWEAyBgUCBAIBAgQBbQAHAQABBwBtAAkAAwIJA2AAAgABBwIBYAAACAgAVAAAAAhYAAgACEwbS7AKUFhAPgAFAgQCBQRtAAQGAgQGawAGAQIGAWsABwEAAQcAbQAJAAMCCQNgAAIAAQcCAWAAAAgIAFQAAAAIWAAIAAhMG0AyBgUCBAIBAgQBbQAHAQABBwBtAAkAAwIJA2AAAgABBwIBYAAACAgAVAAAAAhYAAgACExZWUAVX15ZWFNSUVBPTUxKNDImJRQsCgUWKyUmJyMHDgQHJxYzMgMmJwYjFRQWFz4DPwE+AScmJw4BBzIFJgcWFz4BASIwBSYjIgcWFz4DNxMmJwcGDwEOAgcfARYXNzYWMh4CMh8BFA4BIi4CPgEyHgECOxc3AQEJHlJIShQJZ4NJIgsSrsowLRxSTkQVFQIKOUNGTWoTqQIndW8xFj5U/koBAUpniissSUAnRCggBYQCUQEFBhgSLEIpGQMCAykVKCYgIBYSBURyxujIbgZ6vPS6fg2GkAEDDCoyTisGVAFwGyM0DEV+MTFYMigHBwECeHdcJIhUhSERhYEqgAHqUVsKX3cPJh4iBv77gWQBBwYZEx4qDzUKBwIEAgIEAgYDBXXEdHTE6sR0dMQAAAAABQAA/7EDxAMQAAMAEwAXABsAHwAPQAweHBoYFhQPBwIABS0rEwUHJQUVBRU1BzUlNRc3NRc1FRcBFwUnBRcFJxMFByXgARS//u8C4/7uAf7vUr8BwP6Av/7svALkvP7vv78BEbz+7AHIq5+ynjykAQEBAaQ8Np8BAQEBnwK0n6mWlpiynwHzspapAAAEAAD/cgNZA0gAFgA1AFsAgACrQA5WAQcDNAEABwJHdAEGRUuwC1BYQDwABgQGbwAEBQRvAAUIBW8AAwIHAgMHbQAHAAEHYwAAAQIAAWsACAACAwgCYAABCQkBVAABAQlZAAkBCU0bQD0ABgQGbwAEBQRvAAUIBW8AAwIHAgMHbQAHAAIHAGsAAAECAAFrAAgAAgMIAmAAAQkJAVQAAQEJWQAJAQlNWUAUYWBSUU1LRUM/PTs6Li0qGSQKBRcrBSYHDgEHIicmIgcGFBceATI3PgI3NicmJyYjIgcGBwYXFjY3PgEyNjI2FjYXMh4BFx4BNzY3NC4CIg4BJwYuAwciBgcGFx4BNzI+AhceAzcWNjc+ATcUDgIuAyc0PgU/AT4BNz4BNxYXHgEXHgYCiwMKEUApSCMDCwgEBBM8NhwXMBgEBxgLCw0eGg0QHA4HBggOAggEBggGCggIDxIIBAUEBQ3BBgwaI0hIFA8qKjQ6IUBcAQEqECYnIFJEQhMPKiYmDBQaEg8SHER2mKyceEYBFiAwJjIWDTsLIBEUGgNIIBlgGAwULigsIBQjCwgNEgEcAgcDDAUSDgICFAwGBkoaCAkGBxgOCwQECwEICAYCBgMICAgKAgEHqQwaGBAuMAEBGB4iFgFYNz8dCwoBJComAgEiKCQBAhIaF0RyW55oQAQ8dJpbMlxIPCwiEgUeBhYODzItVhYQLA4IDCgoQkZgAAAAAAEAAP+xAhcDUgAUADNAMAABAAYBRwADAgNwAAYAAAEGAGAFAQECAgFSBQEBAQJWBAECAQJKIxERERETIQcFGysBFSMiBh0BMwcjESMRIzUzNTQ2MzICF1cwIqQWjquOjnRhUgNLkygoaqX+WAGopXpocgAAAwAA/7EDWQMLAA8AGAAhACxAKQYBAAIAbwQBAgMCbwUBAwEDbwABAWYBACAfHBsXFhMSCQYADwEOBwUUKwEyFhURFAYHISImNRE0NjcTNCYOAh4BNiU0Jg4BFB4BNgK4Q15eQ/3pQ15eQ+VGYkQCSF5KAThEZEREZEQDC2BB/ehCXgFgQQIYQl4B/lMxRgJCZkICRjExRgJCZkICRgAAAAQAAP+zA1kDCgAKABQAHgApABdAFCgmIyEYEhANAwkARAAAAGYoAQUVKwEGAAcmNTQ+ARcyFxYXBgAHJic2AAM2ADcWFw4BByYFJicGBz4BNwYHFgIJsf72QwtyxnMuxjQo2f7APTQiPgE8w0EBJscWCKP6QjoCIGxhS1Y8uHILLSQC/kP+8rIyMHXEdAFNJDM//sDaKTLXAT79V8cBKkEzOkP6pQgLHCQvDHK4PlVJYgAAAAMAAP+wArkDUwAjAD4AQwA6QDcIAQMAQAEEAQJHCQEERAAFAAADBQBgAAMAAgEDAmAAAQQEAVQAAQEEWAAEAQRMOys1JzgkBgUaKwE3NiYnISIGFxEUPwE+ATsBMjY3Njc2JgcjIiYnNTQ2FzMyNjcOAgcOBCsBIgYDDgEnJjURNDYXITIWBwM3PgECLhUDEAz+cw0SAQOiDRIRhgwQAw0HAhANpBAUARYPwQoUgAkqJAEEAg4OHBOXBwrpDCoGHiouAe81JAxYExEsAmBsDRIBFAr9mQQExA8IEAlIIgwWARYQFxAWAQ6GKdiuCgwMGA4KC/7yDgQFDCoDEx82ATw6/kdhWNYAAAYAAP9qA8IDUgAGAA8AOwBHAGsAdAEAQBhZUhMRBAMKSDECDwNJLAIHDwNHEAEFAUZLsA5QWEBaAAwREAgMZQAGCAIIBgJtAAMKDwoDD20ABw8JDwcJbQAACQEJAAFtABEAEAUREGAABQACCgUCYA0LAggOAQoDCAphAA8ACQAPCWAAAQQEAVQAAQEEWAAEAQRMG0BbAAwREBEMEG0ABggCCAYCbQADCg8KAw9tAAcPCQ8HCW0AAAkBCQABbQARABAFERBgAAUAAgoFAmANCwIIDgEKAwgKYQAPAAkADwlgAAEEBAFUAAEBBFgABAEETFlAI3Nyb25raWdjYmFfXltaWFdMSkNCPTw7Ojk3JiQiIyEhEgUYKyU0IyIUMzIDNCYnIhUUMzITFQYHFhUUBgcOARUUHgUXFCMiLgI1NDc1JjU0NzUuASc0NhcyFzITIzY1ETQnMwYVERQlFQYjIi4DPQEzNSMiJyIHNTM1NCczBhUzFSImKwEVFDMyARQGLgI+ARYBTFxYYFQhIiBFRUKWFBgJUkUWFhomMi4qFgLLJkQ+JGYmIyg0AWpONi429XwCAnwDAVIoOSMyHBAEAQsHAwwVNgR/A18IIAgvMCL+2ixALAEsQioFOHMB4SIsAVFLAQFwBwYYF0ZkDQUUFxEWDgoUFjAfqg4gPClcIQMWMD0PAw1eLk1oARr+LxkxAVQ1ExMy/qkxY24WGB46LCTEAgEDaioeFBdFagLMSQIjIDIBMEIwATIAAAAABAAA/7EDoQLDAAwAGQAzAFoAS0BIWVJORwQCCA0AAgADAkcJAQcIB28ACAIIbwQBAgMCbwADAANvAQEABQBvAAUGBgVUAAUFBlgABgUGTFVUIx1LNyISKxwTCgUdKyUUDgEuAz4CHgEFFA4BLgM+Ah4BFzQmIyIHBiInJiMiBgcUHgM3MzI+AzcUBw4EByIuBCcmNTQ3JjU0NzIWFzYzMhc+ATcWFRQHFgFlDiIuJAwCECAyHhIBYw4iLiQMAhAgMh4SWE5BF1YoYCdVGEJMASQ2UkouXi5KUjgifiIWSlRqVjIrSFxOTDoTI0wPHD1aPVJaU0o6XDsdD0yrFi4oAiQyKDQiBCosGBYuKAIkMig0IgQqLBhDXgwGBgxeQzFILBYMAggaKEySdEUrPiIUBAEEChgiOCRFdIRZLTJAOSwvFBIuKgE5QDEtWQAB////sQNIAwsAIwA2QDMSAQMCEwEAAwJHAAIAAwACA2AAAAAFBAAFXgAEAQEEVAAEBAFYAAEEAUwVJSMnJRAGBRorASEWFRQOASMiLgM+AjMyFwcmIyIOARQeATMyPgM3IwGtAZQHZrx5WJ50QgJGcKJWp3h1RGZIekhIekgwUjQoEAXzAZslInm+bERyoK6gckRxcENKepZ6ShwmNiwVAAAAAAIAAP/EBQYC9wAjAC8AXUBaDwECARABCgICRwAKAgUCCgVtAAcEAwQHA20AAQACCgECYAgBBgQFBlIMCwkDBQAEBwUEXgADAAADVAADAwBYAAADAEwkJCQvJC8uLSwrERETERUlIycjDQUdKwEUDgEnIi4CND4CMzIXByYjIg4BFB4BMzI+AzcjNSEWJRUjFSM1IzUzNTMVAyJisnVTmG5AQG6YU6Byb0FiRXRERHRFLk4yJhAE6AGCBwHkdXV1dXUBVXW0aAFAbpimmG5Aa2s/RHiMeEQaJjAuEo0kJHZ0dHZ0dAAAAAAEAAD/agPoA1IACgASABkAKABBQD4RAQADDw0CAQAcAQIBA0cABAMEbwYBAwADbwUBAAEAbwABAgFvAAICZhMTAQAlIhMZExkXFgUEAAoBCgcFFCsTMhcWFyMmJyY2NwUGByYnNjcWNxYSFyMCCQEUBwIDJicmNjsBMhYXFvYTCpU1+UeGBgoLAggbKyxjFwJ2fYOoE/wX/uMCdTgmow4tAgoKyAwSBEAB2w7M5PasCRIBx29srZ57gL7etP5e3wFzAcL+v+3YATgBJKieCQ4ODOQAAAIAAP+xA1kDCwALABsALEApCQUAAwIAAUcABAEBAAIEAF4AAgMDAlIAAgIDWAADAgNMNTQSFREFBRkrARMjBwYHLwEjExUzAREUBgchIiY1ETQ2NyEyFgHElD9XDgsXV0OTOQGVXkP96UNeXkMCF0NeASIBFq4bGDOu/u21Afr96EJeAWBBAhhCXgFgAAAAAAIAAP+OAxIDCwAQABUAOUA2FAsGAwJEAAUAAAQFAF4GAQQAAwEEA14AAQICAVIAAQECVgACAQJKAAASEQAQABAVFBERBwUYKwE3IRMhDwEvASMfATM3EyEnAyEDBSUCdwn+EhoBVgxubgdhDMoCyBz+mQj/AxJI/r7+vwIFYv7WgB0dTps3NwEwZQEG/N1aWgAAAAAFAAD/sQNZAwsACAARABoAVABtAGNAYBIBAwUBRwAKAgcHCmUADQsOAgYFDQZgAAUABAAFBGAAAwAAAQMAYAABAAIKAQJgCQgCBwwMB1QJCAIHBwxZAAwHDE0gG2plXllSUT08Ojk4NzY1G1QgUxMUExQTEg8FGisBNCYiDgEWMjY3FAYuAT4CFjcUBiIuATYyFiUiKwEiDgEHDgEHDgIWBhYGFhQfAR4BFx4BMhY2FjYWPgE3PgE3PgImNiY2JjQvAS4BJy4BIiYGARQHDgEHBiInLgEnJhA3PgE3NiAXHgEXFgI7UnhSAlZ0VkuAtoICfrp8Px4sHAIgKCL+5gQnOxRELhEcKgwGCAQCAgICAgYKDCocEDBCKkwKSixANA0cLAoGCAQCAgICAgYKCyodEC5GJlABqgMFgHMy/jJ0gAUDAwWAdDEBADF0fgYDAV47VFR2VFQ7W4ICfrp+AoKKFR4eKh4eZgQGCAsqHBAwRCZQBlAmRBgoHCoLBgoEBAQEBAgCCgsqHBAwRCZQBlAmRBgoHCoLBgoEBP6igDF0gAUDAwZ+dTEBADF0gAUDAwZ+dTEAAwAA/7MEdwNOAAwALABPAE1ASgAMAAQDDARgDQEDCAECAQMCYAABAAAFAQBgCwEFCgEGBwUGYAAHCQkHVAAHBwlYAAkHCUxOTEpIQkA9Ozk3JiIjJRIjJDMyDgUdKwEUBiMhIiY0NjMhMhYXNCchIiY0NjMhLgEiDgEXFBchMhYOASMhHgEzMj4CNxQGKwEWFRQOAiciJicjIiY0NjsBJjU0PgI3MhYXMzIWAzAaFv55FBwcFAGHFRx3Df3cFBwcFAH7MaTEqGIBDAIkFRwBGhb+BjGkYUqGYjrPHBRJCUh8ql2J4jdqFBwcFEoKSnqqXoniN2kUHAGCFBwcKBwcFDAvHCccUF5iqGIwLxwoHE9eOmCI2BMcMC9drHhOA5R5HCgcLzBdqnxIAZZ4HAAAAAQAAP+wA1kDCwAbADYAUgBuAElARmk0HQMCA2NiW1pWUEtKQismJR4bExIOEQECQT0FAwABA0cHAQMCA28GAQIBAm8FAQEAAW8EAQAAZm1rYF8ZJy8YHicIBRorJQ8BDgEnDgEnIiYnNDY3JjY/ARcHBhQWMj8CAxcHJyYiDgEfAQcvAS4BNy4BNTQ2MzIWFzYWARQGIyImJwYmLwE3FxYyNjQvAjcfAR4BBx4BAxQGBxYGDwEnNzY0JiIPASc/Aj4BFz4BNzIWAlVZZSRiLglAKC9CATImDBokB1QGFSk6FWVaagdVBxU6KAIWvlRaZSYYDicyRC8qQAcvXgHnQjApQAgwaCYGVAcUOioVEa5VrhAkGgwrOAE4Kw4aJQZVBxUqOhS/VVpVECVoLwZALC9E+1lmIxoMJzQBRC8pPgkwYiMHVQYVOikUZlkBKAdVBxUqOhW+VVlmJWgwCEAoL0Q4KAsa/YgvRDYnEBgmB1UHFCg8FBCuVa4RI2IuBkICSitCBTBmJQdVBxQ6KhW/VVlVESUaDyo4AUQAAAACAAD/+QR4AwcAGwBPAFNAUBQAAgcBOwEFBzwkAgQFIQEDBARHAAIBAm8AAQcBbwoBBwUHbwgBBQkBBAMFBGAGAQMAAANUBgEDAwBYAAADAExOTEVDIyQmIyUmIyk1CwUdKwEeAQcUBiMhLgE1NDY3JjU0NjcyFz4BFzIeAQcFFBYzMjcnJicGIyIuATYzMh4FFzI2JzQmJyIHFzYzMhYHFAYjIiYvAi4CByIGA+09TgGEXf1NX4Q+MwdcQTUrKqRkXZxcAf0YXkVNORoRCCUrHyoBLB0YLiQkKC5AI0ReAV5EUDc0JSodLgEqHxgsEiUnFC4+I0ReAaMZcERbggaAXT1oHhYYQFoBIVZqAVqaW6hEUDgfFAgkJjsmGCQwLCgUAlBCRE4BNjwjJB0gJhYUKi4YIhwCTgABAAD/+QPoAmYAYAA0QDFZJiUABAIBAUcGAQQHAQECBAFgBQECAAACVAUBAgIAWAMBAAIATCwvKScoJSwrCAUcKwEUFx4DFxYVFAYjIi4FLwEuAyMiDgEVFBYzMjc2NxcGBzEGIyIuASc0PgIzMh4GFxYzMjY1NC4GJyY1NDYXHgEXMR4CFwcmJzEmIyIGAtEGBRIaGBO1dlMhOiwqHCAQDhQSIjBELTViOHZYYy0fDy8IEEmPUopKATBSbjsxUDowICIWIg41TS1AFiIuMDIoIgQCYj4rMBoGDg4ESA8PDSobJgHJAxQQFhAGBzKHUWwUIDIwRC4lNS06MhY+ZDVZhjUkHVUTFFVYkFE7cFQ0FiI2OkhCUB9wNi0YIBQQDhgiOCkJCT5aAQIMGAYQGAM3GwwMJAAAAAADAAD/sQR3Ar4AFgArADsAcEBtEwEHBC8fAgwKOTQqJBoFAQYDRwcBAEQLAQoHDAcKZQ8NAgwGBgxjAwEAAQBwBQEECAEHCgQHYAkOAgYBAQZUCQ4CBgYBWQIBAQYBTSwsGBcsOyw6ODYyMC4tKSciIB4cFysYKyIjEiIiERAFGisBEyInJiMiByYjIgcGKwETNjMyFzYzMgMyFhcDJiMiByYjIgcDPgI3Mhc2NwMGByYjIgcDPgEzMhc2FwQgV0lHb2x+U1J+bHBHRQNXfZCCVVaCkJdIdFdFYG59VFN9bmBFO0RgNHBgYIgfdlNUfGJaP0V0QnRcYHECd/06IDNTUzMgAsZHOzv9kyAlAjosT08s/cYYGhIBPT0SAfsDVFcl/fMcHDk8AwAAAAADAAD/zANZAv8AAwAOACoASkBHIgEFAQFHBwkCAQgFCAEFbQYEAgAFAHAAAwACCAMCYAAIAQUIVAAICAVYAAUIBUwAACknISAcGxYUERANDAkGAAMAAxEKBRUrExEjETcUBisBIiY0NjIWAREjETQmIyIGBwYVESM2PQEnMxUjPgM3MhbDuMQ6LgEuODpcOAKLty4wIy4NBrgBAbgBCxgmPCJfdAH1/dcCKaspNjZSNjb+QP7DASg7QiYdERz+y9+KpRtQEhogEAF+AAAJAAD/aANWA1MABwAOACEBAAENARwBKQE9AeEDLEuwClBYQSsBHQEKAHUAawBgAFkADQALAAcACQAGAAMBGgCcAAIABQAEAMAAMQAkAAMAAAAFACIAAQAIAAAB2wFwAAIAEAAIAPcA2wACAAcADgDfAAEACwAHAAcARxtLsAtQWEErAR0BCgB1AGsAYABZAA0ACwAHAAkABAADARoAnAACAAUABADAADEAJAADAAAABQAiAAEACAAAAdsBcAACABAACAD3ANsAAgAHAA4A3wABAAsABwAHAEcbQSsBHQEKAHUAawBgAFkADQALAAcACQAGAAMBGgCcAAIABQAEAMAAMQAkAAMAAAAFACIAAQAIAAAB2wFwAAIAEAAIAPcA2wACAAcADgDfAAEACwAHAAcAR1lZS7AJUFhAagAJDwEPCQFtAAMBBgEDBm0ABgQBBgRrAAQFAQQFawAFAAEFAGsAAAgBAAhrAAgQAQgQawAQDgEQDmsADgcBDgdrAAcLAQcLawwBCxEBCxFrAA8CAQEDDwFgABEKChFUABERClgNAQoRCkwbS7AKUFhAcAAJDwEPCQFtAAIBAwECA20AAwYBAwZrAAYEAQYEawAEBQEEBWsABQABBQBrAAAIAQAIawAIEAEIEGsAEA4BEA5rAA4HAQ4HawAHCwEHC2sMAQsRAQsRawAPAAECDwFgABEKChFUABERClgNAQoRCkwbS7ALUFhAZAAJDwEPCQFtAAMBBAEDBG0GAQQFAQQFawAFAAEFAGsAAAgBAAhrAAgQAQgQawAQDgEQDmsADgcBDgdrAAcLAQcLawwBCxEBCxFrAA8CAQEDDwFgABEKChFUABERClgNAQoRCkwbQGoACQ8BDwkBbQADAQYBAwZtAAYEAQYEawAEBQEEBWsABQABBQBrAAAIAQAIawAIEAEIEGsAEA4BEA5rAA4HAQ4HawAHCwEHC2sMAQsRAQsRawAPAgEBAw8BYAARCgoRVAAREQpYDQEKEQpMWVlZQScBzgHNAb4BvQGpAacBdQF0AVsBWgFXAVYBVQFSAU0BTAEwAS8A/QD8APQA8wCnAKUAoQCgAIkAiAB5AHgAaQBoAF8AXgA3ADYAEgAFABQrAQ4BIwY1NDcXBiYHNhcWByIOAgcGFzI2NzQ2NDInNScmBTQnNz4CJjYmNCYnLgEnFhcWBwYHBi4BJy4BLwEuAScuBDYmJy4DNjc2FgcGFjc2PQEuAi8BBhcUIy4BBjU0JiIGBxQeATc+AQciJic0NhcyHgEHDgIVDgEXHgMXFjc+AT8BNjc2Fx4BBgcGDwEOAScmFBcWMz4BPwE2FhUUDwEGDwEOAQ8BDgImJyYHBhUUDgIXDgEHBhQHBicmJyY3NiMHBhcWHwEWHwEeAQYHHgIXNicuAS8BPgEXFjc2NzYWBxQHBhYzPgE1Ni4BNzYzNDYWATYmIyYVFjMyBwYzMhcuBgYjBhYXMjYnNC4BDgEfARYXFDc2NzQuAScmIgYWDgEUFj8BNjc0MjYBHgEGFA4CIgYnDgEHDgEnLgMnIyIHIg4CLgEvAS4CJyY2NzYuATY3PgE3PgE3FgcGJyYHBh8BHgEUFgYWFxYfAR4CNz4CJi8BJicmBwYnJjU+Aj8BNj8BNjc2NyYnJjY3NjM2FhceAQcGFxYXHgEXFg4BBw4DIy4CLwEmNyYOARcWBwYWNjc+ATc+AS4BJy4BNjceBQFyBgYBAwo3AwgGDgQCxwMCAgQEBQUCCgICAgEBAQHdHwQCAgICAgYEAgUqEw0TMBIGFhEIAgUFDAUJBAYBCBIQCgYMCBQJIAgEDA4VEAYGCgwHAwoMBw88CgEFFhASHxACBAwCBgUGBAgCCg4KCgICDAoWBwQGCAwGEAsbHgEYBxEKAgUGAgIECAsUGRkdHgUKDhcKFAoxBQoBAgECBQMEAwYPLCAXFwwCARAQCAoNLAQBAwQMEgIBAwIDAhQaAwsNCy80CQISEAQYBgEaFgIIAQECCgYaQ0oZDQwBDQUEDAEOAQgCDgkUJir+rgIGAwUBAQYCAQYB6gEEDAUEBAICAgcWCwUGZAYGBQQCAwgCBQEeAggCCAoEBAMGBAIGBAUKBgE9Cw4CEggaCBwBFTYPCToVCgwGFBBoFQsZKBQcIFwjOQoYDAQFEgEBBgYCBQcwChEMAQweEhwTBQcKBAMEARICEwwjOA04JA0YGAIKBgtDGyYZBgMBAQoQBQ4KBxEKCz4IBwIBHC0WJB46FSAmAgMTEzgeMggFBAoGBRAOIBIKDgwBBwYBDBYICAsLBR40FSEiKR4aBhYRExICBwEICA4KDgJtAQoBAwcCCAEKAwYHA/AECgYEBgEIBgIEBAICAQHICg4PBxAIEAYSBhYDGz4LCyRaQRYBAhhGGRUiCA4GBAIjLhAWFyQSBQIQAhwcAQIkDwoKBQISFREWDAIEBEYJBQICBB8mIBEIGBIBAgsBEAsMEgEYFAIJDgwBCBACBAwKBAIBCQEGAwcEBggDAgYIAQMJCwsFBAEECA0BBgUaAwQEAQEDAgECAQQBAggiDg0jEQUCBA4iHCYQA14gCjgFDgwRJA8QCgMkOAcJCw0mKgkaFgIIIB4YDSYFCAMDAwYFHQkJKBUIGg0mDRAKQhEMOjIOChUSBgHECRABBQMJC2wEBAIEBgIGAgkeAwp9BgoEAQIBAgIPAgMBgwEEAgMICAYHBgQFAgUDAgEC/RYGDg4KEAQSEgILKBAJBAoFEA4IAQIQEg4BIgcKAggIBwwyBQkcEhgDBgQEChQSKRILAwEHCBgKBwYMDyYRBQQHCwMSCAIDGB4kCxRqHSoTBQ0JDBAaGgsoHA8jFApPHT9uM0QYDAEQEBdYJzVCPzshdDAcKBQDARIWEAEEDAIMCgEUCC4fJ0YkKAITHBIPChQUDAcGKiYIEhwSDAoEAAAAAAEAAP/5A9oCwwAVAClAJg4BAQFGBAICAAEAcAAFAQEFVAAFBQFYAwEBBQFMIhERESMRBgUaKwEDIxM2JisBAyMTIwMjEychMhYXHgEDzly6YwgfH19yunKgcrpyVQLIOGIiIRgBo/5WAdAfJf3sAhT97AIUtiwqKGwAAAAEAAD/sQNZAwsADwA+AFMAYwBYQFUXAQECAAEAAU4BBAADRwANAg1vCQMCAgECbwsIBgMEAAoABAptBwUCAQAABAEAYAAKDAwKVAAKCgxYAAwKDExiX1pXUk9MSUVCNCU0JTQyNSYkDgUdKwEVFAYnIyImPQE0NjczMhYFNTQmKwEiByYrASIGHQEUOwEyPQE0NjczMhYdARQ7ATI9ATQ2NzMyFh0BFDsBMiU1NCYrASIGFxUUOwEyPQEWOwEyNhMRFAYjISImNRE0NjMhMhYC3BANcQ0QEA1xDg7+7yQeSiYPECZJHSQLHwwQDTUNEAsfDBANNg0QDB4MAUkmHZMdJgEMHwsSI2oeJEdMNf2qNkxMNgJWNUwBfD8OEAEODz8ODgEQjYseJB0dJB6LDAyADg4BEA2ADAyADg4BEA2ADEFWHiQkHuQMDGQXJAF1/ao2TEw2AlY2TEwAAAACAAD/sQPoA1IAEgAbAAi1GRQCAAItKwERBy4CJzQ+ATcVDgEVFBYXEQUXJTcmJzUWFwJemH/QdgFwxHh5nKyDAg0V/ttSQlqacgNS/KdIDFqQUE6KXA5gFX5PVYARAvf72T8vJxBgE0UAAAAB////agMOA1IAbQBUQFFYUE88OjAlBwMEZSMVCgQABgJHHQEGAUZEAQRFAAQDBG8AAwUDbwAFBgVvAAYAAAIGAGAAAgEBAlQAAgIBWAABAgFMbGthYFdWKCcjJxQHBRcrJQ4DIi4CLwEOAQciJj4BMzI2Nw4CLgMnPgEeAhc2NyIOAS8BLgQnPgEeBR8BNjUnLgQ2Nx4EBg8BBg8BFTc+BBYXDgMPAQYmBi8BBgc2PwE+Ah4BAw4RMjQ6ODQsIggKP8R1ChACDAxhpjkUKDQyNjAuE0BwSkIgEB0PBAwoEy4bLDIiGgMnRjgwIhwSDgICBgwIJiAcChgbKTwiFAICBgsFBAQFAxweMDZIJgEWIiwXMBkmJgcJDRwDBxwVLEJCTustQCQQCg4QBQaAkgEOFg54aAgKBAYaKEgtGwoSLCoZSVkCAgIFAxQcLD4oEAgIGh4mIB4HCUQpCAUoKEA+UCUOKC4wNCwUIw8ICUQKBiQeIBICDStILCQHDgcEAgMCUkwEBhcRGBgCGAACAAD/agNaA1IAJgBEACxAKQAFAwVvAAMCA28AAgACbwAABABvAAQBBG8AAQFmQD04NjEsODYzBgUXKwEWBwYhIyIGDwIOASsBIiY/AT4CNzY7ARY3Njc2NzY3NjI2FxYnFAcGBwYHFCMnIgcGAxQrASImNxM+ATchMhYXHgEDUAoNMP71GA4WAgMfAxYOjAwMAQ4JDBIGAxVJSzliPjkeDQYBAgICLFUaLXtATTIzNwoCLgekDBIDggIaEAFNE0gaPD4B6i9D+BIPC8kPEhAMXj5AeiEVAg0WOzVUJyMEAgMhZDxIgi4WAQEBNgT+3QYSDQM1EBQBDgsXXAAKAAD/bwRaA1IAggC8AMoAzgDbAOIA5gDoAOwA7gEhQDy4owIKC5R9fHJubQYGCd7cAgcG3YJXAwAHzAEBAF9BFwMFAc7NIyAECAXXAQwO5uUOCgQNDAlHsJwCC0VLsChQWEBYAAsKC28ACgkKbwAJBglvDwEGBwZvAAcAB28ABQEIAQUIbQACBAMEAgNtAAMOBAMOaxABDgwMDmMAAAABBQABYAAIAAQCCARgAAwNDQxUAAwMDVkADQwNTRtAWQALCgtvAAoJCm8ACQYJbw8BBgcGbwAHAAdvAAUBCAEFCG0AAgQDBAIDbQADDgQDDmsQAQ4MBA4MawAAAAEFAAFgAAgABAIIBGAADA0NDFQADAwNWQANDA1NWUAk5OPi4NvZycfAv6Cfk5B2c2RiWlhVU0RCPDotKyopFRQQEQUVKwE2HgMXHgIXDgIHLgUjDwEWFx4EHwEWFB8BFA4CByYGIyInJjU0Nz4CJyYHDgEnIi4BJyYnBCMiLgE2NyUmNDY/ATYyNzI2MzIWFzYzMhYUBg8BFQYWMzI2NTQuAjc0Nyc2NTQnNjMyHgUXNw4DBzcuAy8CJgYnLgEGJyMiBz4CPwE+ATceAjsBFRc2PwE+Bz8BBgcOAQ8BBgceARUUAz4BMzIeAxcGIyInAzcXBxcWFA4DByc+AT8BAwcnNzYzMhMzFwcBNR0BBzU/AQKqKkw4OCYXEzIiJhpEVhUZIBISHjIsBQMCBQMYBg4GBAYCAgEEBAoBFEgTFhIBAQEiHgENCxRUIg44QA4EC/7zEgkMAQoHAQ8EBgYLBRACAwwECA4EWwUKDgoIZgFcDRpQGh4cAQYmGAMuIhkeGAwKCAoJGwEWGhIBIgIKBAgBBQQEAgQECA4FKEYzCRYoEBoKJAYHEhIMBg2KRRwNFBIODgwOEAkEAhYtjGUzDAoCGIoWaB0FEA4QCgNDRSIjkxs8KOgCFB4gGgUEDCwSIvg1BBMNBgp2EQYXAfABAQEBTAEaJkQ0Kh88HCQRHiQIFFhgaFQ2AQIDBQMUBBIECg8FGAsSDyIYKgkBDAYJESkNByAiCwEOHjQBRlYKAw4+DBEOATsIDAgCBAIDCBIKFQwSDAIWCQ9mWhsUEgQIDwkKCxgpDhIJAgYKEhIkDw4XFgIECngDCggEBAQEBAIEAQQCARgREhAMFAguBQUaDioBNTUWChYMGgoeDCoJBR4wXG4ZCQIGCiACB/30DhgQIBgiARkGAcEHYxuqCAQKBAYCAhgBCAECAV8LCQQD/pkuBwN0AQECAQECAQAAAAEAAP+xAsoDUwBKAEVAQiMBBQITAQEDAkccAQFEAAIEBQQCBW0ABQMEBQNrAAAABAIABGAAAwEBA1QAAwMBWAABAwFMRUQ7OTEvKScoJQYFFisRND4DFzIeARUUDgMnIiYnBw4FDwEnJjU0Nj8BJjU0NjcyFhUUDgEWMzI+BDc0JiMiBhUUHgIVFAYjJy4DKkpgbjpYmF4UMEBgOiZKEQ8KCA4QEiISBwUJGBkdEjotIiYwATIkHzQkGhAGAXpjb5YOEA4QDQkdLBgMAgU8alA6HgFKjlk2ZmBGLgIkHz8pGDgWMCgcAwZYETOAYXEkOi9QAS4iJYpHLhwwOkA8GmBskG8ZLhoaBA8yAQksPjoAAQAA/2oD3wNSAGYANkAzX1kaCAQBAFM2MgMDAQJHAAABAG8AAQMBbwADAgNvAAIEAm8ABARmSEVCQTw6JyYsBQUVKxMmNTQ2NyY2NzQ2NzYzMhceBh8BFhUUBh0BFDIHHgEHFAYjIi4FIwcGBx4CFw4BBwYjIi4BLwEuAQcOASMiLgM3NDY3PgE/ATY1Jy4BLwEiBw4BByMiJicmNTSXBQwIAQoIZkdNZ0tKGy4iGhYODgUBHwoEASsyARYUBQwIDgQKAQEDISkMLh4FAQIDJIUdQC4jDQgkBBdgLhQmQi4mAQwRBiAMCAEBG0IIAwIFCigXAQICAg0BkAsSCyIIDCIHTqYiJR8LHiIqKDYuIAIvJQgeBgICAkBwPBhACAwQDhACAlYnCxQaGAIOAzYKDAsEAgIBGRYCCA4gExcUEgEMAQEBAQIGaCQCDBckAwQBHxmaAAUAAP9oA+gDVAAPABgAIQBLAFwAa0BoMyopAwgJOSYCAwZJQAICAwNHAA4JDm8ACQgJbwoBBwgGCAcGbQAICwEGAwgGYAUBAwQBAgEDAmAAAQAADAEAYAAMDQ0MVAAMDA1YAA0MDUxZWFFQRUQ7Ojg3MjAUEhQTFBMWFxMPBR0rJRYHBiInJjc2MhcWMjc2MicUDgEmNDYeARcUDgEmNDYeATc0JgYHJic3FxQWPgEuASciBycmDwEGByYiBhcUFhcGFRQeATY1NCc+ATcUDgMuAjQ+Ah4DAmMJCSKaIgkJAwoEG4YbBAqoHigeHige3B4oHh4oHowmOhNIZSNwHCoeAhoXHg58CgQmZUgTOSgBFBIEntucBBEUyFCEvMi8hFBQhLzIvIRQxwkIIyMICQMDHBwDYhUcAiAoHgIcFRUcAiAmIAIaLBsoAhMyBJ4aFB4CHCocARwcAwyuBDIUJhwUIAgQEE9wAXJOEg4IIANmuIhMBFSAwMTAgFQETIi4AAMAAP+xA1kDAwAIABIAHAAUQBEZFQ0JBgMGAEUAAABmEQEFFSsFBiInPgE3HgEDERQGByY1ND4BARQHLgEnER4CAnhf22BNbhITbsiOcWVeogJZZXKMAWSkXBo1NTCMT1CKAuz+8YzoN3icaLZ2/myceDfojAEPEXi0AAAFAAD/xgR3AvcADwAfAC8APwBcAF1AWlEBAAkIAQIAGAEEAjAgEAAEAQYERwACAAQAAgRtAAQGAAQGawAKAAACCgBgAAkABgEJBmAHBQMDAQgIAVQHBQMDAQEIWAAIAQhMVVNQTjQmJiY1JiYmMwsFHSslETQmKwEiBgcRFBY3MzI2JxE0JgcjIgYHERQWNzMyNic1NCYrASIGHQEUFjczMjYnNTQmByMiBh0BFBY3MzI2JRQGIyEiJjU0NjcmNTQ2MzIXPgEXMh4BFRQHHgEDRRAMNAsQARIKNAsSnxIKOQsQARIKOQsQohIKOQsQEAs5CxCiEgo5CxAQCzkLEAMXhFz9SVyERjsGWj85LBmmalOMUgdLYFUBmQwQEAz+ZwsSARAMASgLEgEQDP7YCxIBEAzvDBAQDO8LEgEQDMoLEgEQDMoLEgEQXVyEhFxBbhwTFj9aJmaEAVKMVCUfEnoAJwAA/40DWQNSAAQACQANABEAFQAZAB0AIQAlACkALQAxADUAOQA9AEEARQBJAE0AUQBVAFkAXQBhAGcAawBvAHMAdwB7AH8AhQCJAI0AkQCVAJkAowDQA3ZAN8YBQAfEAQkGr6sCCwixAT49PyMCDDoFR0FAPTw7OTg3NTQzMTAvLSwrKSgnJSQJCAUEAwIcDERLsAxQWEC7Vi8CHiAFIB5lADsFBEA7ZQAAAAIPAAJeTh1NG0wZSxdKFUkTSBFHDw8cGhgWFBIQBw4DDw5eQQEDAAEfAwFeLlUsVCpTKFImUSRQIg0fLSspJyUjIU8IIB4fIF4wQgIFVzECBAcFBF4yQwIHWDMCBgkHBl4AQAA/PEA/YTREAglZNQIICwkIXgA8AD0+PD1gNkUCC1o3AgoNCwpeOEYCDToMDVIAPlwBOgw+OmA4RgINDQxWWzkCDA0MShtLsB1QWEC8Vi8CHiAFIB5lADsFBAU7BG0AAAACDwACXk4dTRtMGUsXShVJE0gRRw8PHBoYFhQSEAcOAw8OXkEBAwABHwMBXi5VLFQqUyhSJlEkUCINHy0rKSclIyFPCCAeHyBeMEICBVcxAgQHBQReMkMCB1gzAgYJBwZeAEAAPzxAP2E0RAIJWTUCCAsJCF4APAA9Pjw9YDZFAgtaNwIKDQsKXjhGAg06DA1SAD5cAToMPjpgOEYCDQ0MVls5AgwNDEobQL1WLwIeIAUgHgVtADsFBAU7BG0AAAACDwACXk4dTRtMGUsXShVJE0gRRw8PHBoYFhQSEAcOAw8OXkEBAwABHwMBXi5VLFQqUyhSJlEkUCINHy0rKSclIyFPCCAeHyBeMEICBVcxAgQHBQReMkMCB1gzAgYJBwZeAEAAPzxAP2E0RAIJWTUCCAsJCF4APAA9Pjw9YDZFAgtaNwIKDQsKXjhGAg06DA1SAD5cAToMPjpgOEYCDQ0MVls5AgwNDEpZWUDym5qWlpKSjo6KioaGgIB8fHh4dHRwcGxsaGhiYl5eWlpWVlJSTk5KSkZGQkIeHhoaFhYSEg4OCgrCwby7tLKurKmnoJ6ao5ujlpmWmZiXkpWSlZSTjpGOkZCPio2KjYyLhomGiYiHgIWAhYSDgoF8f3x/fn14e3h7enl0d3R3dnVwc3BzcnFsb2xvbm1oa2hramliZ2JnZmVkY15hXmFgX1pdWl1cW1ZZVllYV1JVUlVUU05RTlFQT0pNSk1MS0ZJRklIR0JFQkVEQx4hHiEgHxodGh0cGxYZFhkYFxIVEhUUEw4RDhEQDwoNCg0UFRBdBRcrESERBS0BESERBQE1IRUXFSM1FxUjNRcVIzUXFSM1FxUjNRc3FwcXNxcHFzcXBxc3Fwc/ARcHPwEXBz8BFwc/ARcHARUjNTMVIzUzFSM1MxUjNTMVIzUzFSM1MxUjNTMVIzUFFSM1MxU3FSM1MxUjNTMVIzUzFSM1MxUjNTMVIzUXNSM1MxUHNTMVBzUzFQc1MxUHNTMVBzUzFSUiLgE2FzIWFAYnFB4CMhYXFCMiJyMHFjMyPgInNC4BIiY0Nj8BMhYXMzcnJi8BJgciDgIDWf5P/lgDIf0XAXEBeP0XLRUVFRUVFRUVFSQIOwkRCToIEQg7CRIIOggsOgk7QzsIOkM7CDtDOwg6/elAmkCaQJo/mkCaQJpAmj/9nBVBWkCaQJo/mkCaQJpAhitAFRUVFRUVFRUVFf6fSGYBaEdJZmalFiIkJBQBPzYPARImNRAeIBQBHi4qIBgKFxMqBwIRIwcGGAgFECAcFANS/Pe8vCUCBP38pQLhcHCmQEBTQEBSQUFTQEBTQEBPExsSCBMaEwcTGhMHEhoTExoSGzUaExo0GhMaNBsTGgKwFBQUFBQUFBQUFBQUFBQUFL4sQBQUFBQUFBQUFBQUFBQUQCwUQFJAQFNAQFNBQVJAQFNAQBRmkGgBZpFm1BQWBgIKDBscIxgGDBoQGhoEBBgOAQIMDSAOAwEFAgIGDBoAAAAAAwAA/6oEdwMSAAgAEQArAC9ALAcBBQYFbwAGAgEAAQYAYAMBAQQEAVQDAQEBBFgABAEETDMTNTUTFBMSCAUcKwE0JiIGFB4BNiU0JiIGFB4BNhMRFAYHISImJxE0NjczMhYdASE1NDY3MzIWAeJafFhYfFoB4Vh8Wlp8WLQkGPwBGSIBJBjxGCQBpSQY8RkiARI/WFh+VgRePD5YWH1YAlwCAP0QGSIBJBgC8BkiASQYWloZIgEkAAIAAAAABHcCrQAAAFgAX0BcV0ACBwABRwAIBwYHCAZtAAoACQUKCWAABQACAAUCYAsBAAAHCAAHYAAGAwEGVAADAQEDVAADAwFYBAEBAwFMAgFTUUdFPj07OTUzLSsmJRgWEhAIBgFYAlgMBRQrARcyFhcUBgciLgcjIgYXFBYzMjY/AT4BFzIWFRQHDgEiLgEnNDY3Mh4FNzI2NTQmIyIGJyImJzQ2NTQmIyIOAgciJjQ3PgEzMhYVFAc2Ax6RU3QBelgvVkRAOjo+RlAxVm4BdFk4eDALCRAECAwiOJSSfkoBnnNDdlpOTkZiLzlKSDUQOgkMEAEKeFkgPCIcBQgMDiFiNWqOAiACDXJuUld0ASAyREhMQjQeZlVYaCoiCggMAQwHDh0yPEJ2S3OWATBOXGBMMgFEOTVIFgEQDAosC1h0FBoSAQoUDyYojGoUEAgAAAACAAD/sQNZAwsAPQBdAGZAY1MBAgkMAQEATAEEAVwBAwRDAQcFBUcACAkIbwAAAgECAAFtAAEEAgEEawAEAwIEA2sAAwUCAwVrAAYHBnAACQACAAkCYAAFBwcFVAAFBQdYAAcFB0xWVCoiJiQkLyUlLQoFHSsBNC4DLwEuAyc0MzIWHwEeATMyNjU0LgEHIg4CBxQeAh8BFhcWFAYnIi4DIyIGFRQWFzI+AhcUBiMiJwYjIi4CJzQ3JjU0NjMyFzYzMh4CBxQHFgKPFiAyKhxTCBYMBgFQGCYLFQoaDhogQF42Jkg+JAEULCwkUTMMEi4jHSweFCAOHByIXilKQCLMflhJOisoUJJqPAEJLX5YSTorKU+Saj4BCCwBARwuHhgOBhQCCAoOCSsMChMJDiQZHzAcARIiPikiNCAWBxQMCAssHgESGhgSIhg0SAEUKEBPWX4tCT5qkFEpKzpIWX4tCT5qkFEpKzoAAAAAAgAA/7EDoQNSAFIAVgBUQFFWVU9FOzowBwAFUCYCBABUJRsREAYGAQQDRwAGBQZvBwEFAAVvCAEABABvAAQBBG8DAQECAW8AAgJmAQBJR0JANzUqKB8dGBYNCwBSAVIJBRQrATIWFxQPARcWFRQGIyImLwEHFxYVFAYjIiYvAQcGIyImNTQ2PwEnBwYjIiY1NDY/AScmNTQ2MzIWHwE3JyY1NDYzMhYfATc2MzIWFRQGDwEXNzYFNycHA1AiLgE0YB8EMCAaLAcfrR8ELiIbKggfVRELIi4gGFc7Vw4NIS4eGVgeBC4iGiwHHq0eBC4iGiwIHVsLDSEwIhhYO1sN/lKtO60BoS4hNhMhXQwOITAeGVw7Ww4NITAeGlseBSwjGioJHa8eBS4hGiwHHlgODSEwIBhZO1kNDSEwHhlaHwMsIRkoCR6xIASSOrA8AAAABAAA/18D5gNTAAkAEwA3AGEAQ0BAXlUdFAQAAQFHTURDOi0FBUQHBgIFAAVwAAgABAEIBGADAQEAAAFUAwEBAQBYAgEAAQBMW1gROhk1FBQUEgkFHCsBFA4BJic0NjIWBRQOASYnNDYyFhcRNCYHISIGBxEWHwEeAjYWNhUyFxYXFhc2HwEWNjI+AzcGBxYHBgcGJyY3LwEHFgcGJyYnJjcmJyY2FxYfARE0NhchMhYHETc2FgHnRmRGAUhiSAEXRmRGAUhjRn4kLP2ULyABGBotEzQcMg4yJg8DAg8TBD5GExYmHigiKm5EjC88JEI6KzACARoBAjAsOkIkOi6MRA4YFQMEBjQmAr0lNgEMFRgBtS5CAkYsL0JCLy5CAUQtL0JCkwF0MCoBJjP+iA0JEAcGBgIECAMPBAEODzMCAwEECgQSDBBTOZ9lPxMSGhxAtga8QBwaEhQ/ZZ45UxUeEAEDBAGDKDoBOCn+fQgPHAAGAAD/agNTA1IABwALAA8AEwAXABsAdUATCwEEAQFHFxYVExIRDw4NCQoBRUuwDlBYQCIDAQEEAW8ABAUEbwYBBQAABWMAAAICAFIAAAACVwACAAJLG0AhAwEBBAFvAAQFBG8GAQUABW8AAAICAFIAAAACVwACAAJLWUAPGBgYGxgbGhkREREQBwUYKwUhESMRIREjJTcFBwE3BQcBNwEHAwEHCQE1IRUCz/2QWQMjWv3zEgG1Ev6EJgGUJf7bOQFXOXkBCkf+9f63Ab89AQz+mwFlGVdcVwEsUr1RAYNF/uFEAfH+mjUBZf0BWVkAAAAEAAD/sQPpAwsACAAcACUAPABcQFk4AQABMgEFADMBBggxFw4DAwIERwABBAAEAQBtAAAFBAAFawAJAAQBCQRgAAUABgIFBmAACAACAwgCYAADBwcDVAADAwdYAAcDB0w7OjYjFBMULCQTEgoFHSsBFAYiJj4BHgEBNCYjIgcXHgEOAScuASceATMyNgE0JiIGFBY+ATcUBiMHDgEjIiYvATUXNjMyFzc+ATIWA3NQcFIESnhI/lZSOQ8POiskI1QrDC4LEkIoOlAB0GSNZGSNZFSUavQGbkhEaA6A2Sw1BwyfAZTSlgINOFBQcFIESv4mOlIEFxFUViQSBBIFIihQAdlGZGSNZAFiSGqUskhkVkAz8FgbAeNolJYAAAIAAP/FBC8C+AAcAC0AREBBHBsAAwIAJyYlAwMCAkcFAQIAAwACA20ABAAAAgQAYAADBwEDVAAHAQEHVAAHBwFYBgEBBwFMGBMVFRMTFRMIBRwrATU0Jg4BFREUBiImPQEzFRQWPgE1ETQ2HgEXFQcXMxUUBiImPQEXNxUUFj4BNwJRIi4ijMeMtyIuIo7DjAFt3reMxoxJbSAyHgEBxUIXIgIeGf6qYoqMY5WSGCICHhoBWl+IAYhgTCBalWOMimOWIiCXFyICHhkAAAIAAP9qAqsDUgAeAEoAOUA2BQEAAgFHAAEDAXAABgAFAgYFYAACAAAEAgBgAAQDAwRUAAQEA1gAAwQDTEhGFyclHigiBwUaKwEUBgciJwYHBhMWBgcjIiYnJj4DNzY3JjU0NjIWFxQOASciJy4BPgEXFjMyPgIuAw4DBxQXFg4BJicmNTQ+AjcyHgEB1kAsIR0iHooZARALAwsQAgcKGCQoFiInCD5aPtZYllgkJQwMBRQMHCA2ZEYsAihKYHBgSigBHQUGFhYGJDRWekFYllgCEy0+ARQmLM/+8A0SAQ4MRohqZkgiMioTGCxAQDJYllgBCAMUFwwBCCxGZGxkRiwCKEpgOEA6CxYMCAtEUEJ4WDIBVpgAAAADAAD/sQNaAwsADwAfAC8AQUA+IAEABRkRAQMDAAkBAQMoAQQBBEcAAwABAAMBbQAFAgEAAwUAYAABBAQBVAABAQRYAAQBBEw1NhcmJiMGBRorJRE0JiMhIgYVERQWMyEyNiURNCYjISIGFREUFhchMjYTERQGIyEiJicRNDYzITIWAYkKCP70CAoKCAEMCAoBdwoI/vQICgoIAQwIClkUEPzvDxQBFg4DEQ8WZAI7CAoKCP3FCAoK3gFlCAoKCP6bBwoBDAGz/O4OFhYOAxIOFhYAAAEAAP+wAjsDUgAiADRAMQ0BAQMBAQAFAkcAAgMCbwADBAEBBQMBXgAFAAAFVAAFBQBYAAAFAEwlEREpFiMGBRorJRcOASMGLgMnESM1PgQ3PgE7ARUzFSMRFB4CFzYCDywMYjI6YjwuEAFeKEAmGgwCAQQCiLq6BhQkGyxshBMkASAyREIhATB4DjIyQC4aAwTtjP7fERwgDgEBAAQAAP+xA7ADUgADAAcADwAZAGlAZhgBAQQRCQIFAA4BBwUDRwAIBwhwDgEKAAQBCgReDAMLAwECAQAFAQBeDQYCBQcHBVINBgIFBQdWCQEHBQdKEBAICAQEAAAQGRAZFxYVFBMSCA8IDw0MCwoEBwQHBgUAAwADEQ8FFSsBFSM1IRUjNRM3ESERMxU3AREHIwcjNSMRNwH0UQEvUVGN/Wa2eQG88rZ5ed49AmDy8vLy/liNAbz9t3l5Apr9y/J6egKGoQABAAD/9wOIAsMALwBNQEouLCogAgUFBhkBBAUWEgIDBAsBAQIERwAGBQZvAAUEBW8ABAMEbwADAgNvAAIBAm8AAQAAAVQAAQEAWAAAAQBMJBYWIxEiKAcFGysBBgcVFA4DJyInFjMyNy4BJxYzMjcuAT0BFhcuATQ3HgEXJjU0NjcyFzY3Bgc2A4glNSpWeKhhl30TGH5iO1wSEw8YGD9SJiwlLBlEwHAFakpPNT02FTs0Am42JxdJkIZkQAJRAk0BRjYDBg1iQgIVAhlOYCpTZAUVFEtoATkMIEAkBgAAAAEAAP+lA0MDUwA1AEdARCkBAwQAAQUDGQECAAUDRxcBAEQAAQIEAgEEbQADBAUEAwVtAAIABAMCBGAABQAABVQABQUAWAAABQBMJCclHB4SBgUaKwEVBiMOAgcGJy4GJzMeAxc2Ny4BNTQ2HgEVFA8BBiIuASc2NTQmJyIGFRQWMzIDQzg2JHBcGS0uDyQ8NkI0Mg6eDjJCRiteQk9adMdqIAsHJCQgDBEgHB4kdlojAYVvDUyWWg8ZGwkeQFB8lMx0esqYbjZehSikaGuKAXZrWUYCAQYWEjotMDIBODJoeAAAAAH////3BDsCXQCGADJAL3RWAgMCJQEAAwJHAAQCBG8FAQIDAm8AAwADbwEBAABmg4FjYU5NPz0sKhYUBgUUKwEWBwYPAQ4BHgIXFhUWHwEeAQ4BIwcGJi8BLgMHIg4DFRQGDwEGByMGLgIvAS4EJyY0PwE2MzceAR8BFhceAR8BHgMyPwE+AT8BNicuAS8BJicmNzY3NhcWFx4CFBYGHQEHBh8BHgEfARY+Ajc2Nz4BPwI2Fzc2FhcELg1hDRcfCRACDhYVAk8cBAIEBhYWjg4kCwsRLCAkDgEGDgoIBAICChRAKFJCMBAOBRQ8Ok4iBAICCReZBwwDAwkECx4ICRAeGBYQBwMCCgIFAwMBCAMEDiEICwgNHWguHQwOCgQEAQEBAgEKCAkFFBYkFCEbAgYDBQgIA6AWHAMCMCSAEh4oDB4SFBwQAQFJMgcEFhAOAwIKCAYMMCYcBgQMFCYZCA4DAwsBAxgiKAwOBRhMXoxSCQwDAwsBAQQDAgYMHDoRECIwHBADAwIUEC4eJxckCAYTBQIMCgcOAQEGAwoQFB4gGC4XEQoWDBQEAgEOGDQiOkMGCAIDAgICAQMIBgAAAAAGAAD/jQR3AzAACAAUAB0AKQBGAFgAaEBlJA8CAwI9MgIJA0xKPAMLCQNHSwELRAAKAApvBAEAAQBvBQEBCAFvAAgMCG8HAQMCCQIDCW0ACQsCCQtrAAsLbgAMAgIMVAAMDAJYBgECDAJMVlRPTURCNTMjFSQTFCQkExINBR0rATQmIg4BFjI2ATQmByIGBxQWFzI2AzQmIgYUFjI2ATQmByIGBxQWFzI2JyYjIg4BFxQXBiMiJi8BLgEjBzcmNTQ+ARcyHgEBFAYHFycGIyIuATQ+ATcyHgEBRBwvJAEmLhwBnhwWEBgBGg8WHIMcLyQkLxwBYh4VDxgBGg4WHJMSFl6eXAENFBIPGhIZBy4FjSiibLxtYq52AVxMQh9vVCZenlxcnl5anmACURccHiscGv79DxoBGg4QGAEYASwXHB4rHBr+/Q8aARoOEBgBGO4DVpRWLCkCAgMEAQpGeXKgXp5cAUiE/ndBdjFlPBROiJ6KTAFOigAAAwAA/64DWgMOACoAPQBRAGBAXToBAANLPDsDBABJAQcEA0dKAQdEAgEBBQMFAQNtAAMABQMAawAABAUABGsJAQYABQEGBWAIAQQHBwRUCAEEBAdYAAcEB0w/PiwrSEY+UT9RNDMrPSw9HyIaKAoFGCsBMhYXFhUUDgEjIicuAScmNzU2NzYzMhYzMhYXHgEVFAYHFBcWFxYXFjI2AzI+AjQuAg4DBxQXBzcWEzIeAg4DJyInBzcmNTQ+AgImB14DARI+GiBKN1AqKQECJw4PBAwFCwgEBRwmAQMTJh81Bw4sa0eCXjg4XoKOgGA2AUMsh1hoVpxwRAJAdJhYbF/pTDxCcpoBMzIFAgYSLh4jGVI+PDAFMiYMAgYNC0wDDCoFAwUpIx4bBDb+2ThchIyEXDoCNmCASHFcgis6AwNEbqCmoGxIAjVL4mN2Vpp0PgAAB//+/8YD8QL8AAkAEwAdACsATwBkAHkAGUAWQgEAAQFHAAEAAW8AAABmRUQyMQIFFCslNi4BBgcGHgE2NzYuAQYHBhcWNhcOAS4BPgEXHgE3LgIHDgEXHgI3PgE3FA4DLgM3NDY3PgEXFgcGHgE/ATYyFgcOAR4BFx4CAx4BBw4BJy4BNzYmBwYmJyY2NzYWNx4BBw4BLgE3Ni4CBwYuATY3NhYBeQsKJywLDQomLkAFBg4SAwkRCBBlGX56LDR0Oz42lAVYklB8pAgFWo5SfaKlKFJqkpyYdEwCTkdewigkGQIEBgULTngyGQEECgQHIDQkKBcOCgUYDQwOBQswJA0YAgMQDCJCfDEcFgUcHg4EEBRGYDAQGggSEESIhhMmERAREyYUElUHEAUGBxIIAgY1OTQmaGg0EBBkITVSKAgNhFI1UigIDYRPJk5MNigGIEhgP0CSR15KKCRRCAYCAQMhRUAHCAYEAQogPAE6G0QgDAwDBRgNIzYIAxAMDhYDBxRBNo4/DxAMGhAuZE0eCwMSHhwCDyoABAAA/2oDoQMLAAMABwALAA8AMUAuDwwHBAQBRQoJAgEEAEQDAQEAAW8FAgQDAABmCAgAAA4NCAsICwYFAAMAAwYFFCsBESURAREhEQERJREBESERAX3+gwF9/oMDof4FAfv+BQEh/pQ1ATcBnv6RATv+lv5JRgFxAer+RQF1AAAG//7/agPqA1IABQA9AEUATwBgAHEAZ0BkNAEAA0tFQSEgHw8OAwIKBAACRwADAgACAwBtAAQABwAEB20JAQUACAIFCGAAAgEBAAQCAGAKAQcGBgdUCgEHBwZYAAYHBkxiYVFQamlhcWJxWVhQYFFgREIyMC4sKSUXEwsFFCsTNDcTLgElFA8BDgIPAQM3PgEmIwcmJyIOARQWMx8BCwE3PgEmIwcjIic+ATMyFhcjIgYHFB8BHgIfARYFExQXBiMiJwEWFRQGBxM2NTQBMh4DDgIiLgI+AxMyPgI0LgIiDgIUHgJHJc1thgLQAgUDCAoFK5sxCwgMCXMqRwYKAgoGLENenDELCAwJcw0JBTq+blKWOgYfKAEBAgEIAgYXI/7lhQJGSD47AfE1dGKEIf6EZriITARUgMDEwIBUBEyIuGZhsIBMTICwwrCATEyAsAFeW1T9zzXQkwsLGxASMAiPAc0EAhIQBgEFBgwICgS3/ucB0AQCEhAGAVloOjcsHwcHDAUQBgomPHX+lwQDGBICaWFtdcQ6AXtePBcBO1CEvMi8hFBQhLzIvIRQ/C9MgLDCsIBMTICwwrCATAAC//7/sQMVA0wAEwAkACVAIh8XCQMAAQFHAAMBA28AAQABbwAAAgBvAAICZjQ4OTMEBRgrAQYHBisBIiY/ATIvASY3NjsBMhclFgcBExYGKwEiJwMBNjsBMgFNBYoPFYYMCgWNAQFaBwcFDIYWDwIdBgb+2bwGCwyGFw69ASgOFocMAd4K9RkSC/oBnAwICRrHCQz99/6oCxIZAVwCDRkABQAA/2UDLQNZABUAKAA8AEoAYQAoQCVhAQABAUdIAQFFCgEARAABAAABVAABAQBYAAABAEwjIhwaAgUUKyUVFAcGBwYmJyYnNDc+ATcyNz4BHgEnBg8BBiMmJyYnJj4BMzIfAR4BBQ4BBwYnJi8BJjY3NhcyHwEWFxYBFgYnAyY3PgEXFh8BFgUWBwYHBgc1BiYnJjcyPwE2NzYXHgEXAa8DBxUfjhMIAgIDIFUBIQgcGw5TARxDmQoTCwYDBQoYEwhpbw0OAcwEXhwVDwdfGwcCChMbAUKHFgQQ/oUDQSDSBQ8XuiAXBQwLAXQBEAivJg0NGAkREQEpVA4FDxUbUgVyR6MHEgQGNhYJCwcIBihlJwsGCxaAHwgWMQETDhwqZiQrLQUYtR54CggLBpsrCxwMGAoWLAcFDAFLORUyAU0UDxg0CQUUqqBwFgsGKgkEAQMKDRoXOXITAgsKDHwgAAsAAP9qA0oDUgAJAA8AFwAqADsAVwBfAHgAhACUAKYCzUAkpaGEfnsFFhWYARsWMQEBCQYBAgFWPjwgHAUGABI2KgIHAAZHS7AJUFhAcRwBGh4abx8BGxYdFhsdbQYBBAUJBQQJbRMNCwMJAQUJYw8IAgcADAwHZSQjIQMeABUWHhVgIgEWIAEdGRYdYAAZDgEFBBkFXgMBAQACEgECXgASEQoCAAcSAGAUEAIMABcYDBdhFBACDAwYWQAYDBhNG0uwClBYQH0cARoeGm8kIwIhHhUeIRVtHwEbFh0WGx1tBgEEBQ0FBA1tEwENCQUNYwsBCQEFCWMPCAIHAAwMB2UAHgAVFh4VYCIBFiABHRkWHWAAGQ4BBQQZBV4DAQEAAhIBAl4AEhEKAgAHEgBgFBACDAAXGAwXYRQQAgwMGFkAGAwYTRtLsAtQWEBnHAEaHhpvBgEEBQkFBAltEw0LAwkBBQljJCMhAx4AFRYeFWAiARYgHx0DGxkWG2AAGQ4BBQQZBV4DAQEAAhIBAl4AEhEKAgAHEgBgFBAPDAgFBwAXGAcXYBQQDwwIBQcHGFgAGAcYTBtLsA5QWEBxHAEaHhpvHwEbFh0WGx1tBgEEBQkFBAltEw0LAwkBBQljDwgCBwAMDAdlJCMhAx4AFRYeFWAiARYgAR0ZFh1gABkOAQUEGQVeAwEBAAISAQJeABIRCgIABxIAYBQQAgwAFxgMF2EUEAIMDBhZABgMGE0bQHIcARoeGm8fARsWHRYbHW0GAQQFCQUECW0TDQsDCQEFCQFrDwgCBwAMDAdlJCMhAx4AFRYeFWAiARYgAR0ZFh1gABkOAQUEGQVeAwEBAAISAQJeABIRCgIABxIAYBQQAgwAFxgMF2EUEAIMDBhZABgMGE1ZWVlZQEaVlZWmlaakoqCfm5mXlpKRiomDgn18enlzcmdmZWRfXltaU1JLSkZFQ0E5NzU0MzIwLykoJCMfHRsaERERERESEiMiJQUdKyUVFCMiJzU2MzIXFSM1NDIlMzUjFTMROwIRIxUGIyInJj0BIxUUFxYyPwE1NCcmIgc1IxEzNRYzMjc2NzUjFAcGIyI9ATM1NCcmIgcGHQEUFxYyNzY3NgE1NCIdARQyARQHDgEHBiAnLgEnJhA3PgE3NiAXHgEXFgEzBxUjNSYnJiczHwEVFAcGIicmPQE0NzYyFxY3ESM1BiMiJyY9ATMVFjMyNzUCHhYNDAwNFr0zMv3lPK47N6EyMhEPCgEBMgUHNB7wBQo6GDIyGRseCgW8MwEEEhpkDxZLFg8QFk4UCgIB/q0wMAGRDggyIGb+YmcgMgcPDwcyIGcBnmYhMgcO/dM5QzgIGhUQPCf1EBVLFg8PFksVELszHhwZCAQzAgoPEZx2JQyoDCYZGSZUNDT+wgEU0xcLAhLL2hwNFSI1bikOHx55/o4bHx8PLwcdBRQmMTksFRwcFSxgLBUdHg8PBQIZdScndSf+hINAIS4CDAwDLCI+AQhAIS4DCwsELCI+AkPfl5cqTTkvkydhLhQdHRUtYS0VHBwVLv7pHyMVDR3c4QwY1QAAAAEAAP+xAxwDUgAhACVAIhIFAAMAAQFHGgkCAUUEAQIARAIBAQABbwAAAGYcJxIDBRcrARMmIgcTLgInFjMyNxYfARYXNz4BPwEWMjcHBg8BBgcGAd8IIy8kCBeOZDMgHBklIyhdNRg9KDQgPB49ICESCh8VB1EBPP51BwcBiyf8pk0ICD5CmlgnY0FSOWoICDEbETYlCooAAf/9/7EDXwMLAAwAEUAOAAEAAW8AAABmFRMCBRYrARQOASIuAj4BMh4BA1lyxujIbgZ6vPS6fgFedcR0dMTqxHR0xAACAAD/sANZAwsALgBhAFlAVlkJAgQBAUcACQACAAkCYAALAAABCwBgAAoAAQQKAWAAAwUGA1QABQcGBVQABAAHBgQHYAAFBQZYCAEGBQZMVFNRT05MPDs5NzY0KignJiQjIRIrDAUXKwE0Ji8BLgE0PwE0JyMiDwEiJgciBg8BBgcOAgcUFhUUBhQWMjYXMhYzMjc+AjcUDgEHBiMiJiciBiciJjU0NjU0JjU0PgI3Njc2MzIWNzI2FzIWFRQGFRQWHwEWFx4BAxEIBgkDBAIDBQgKFiEigCIYOhIyTCU1SBoBDgwOGTYOIH4fZTpIdkRHTo5WRXEffiANNg4pOAwOFCpGMCxWbEQigCEKLAotKgYCAQQDAgkKAYUZTBAZCBgcGiUVCgIDHAEMBxMeHCmChEkWWhYNMhYSDgESFRl4mk1ctoogGRABEgE+KQ4wDRdaFz14cmYkISIsHAEGATgvDTINBw4CCwkCF1gABgAAAAAD6AI6AAsAFQAfACkANABGAFtAWC8BAgY0LSopJCMgHxoWFRALBQIPAQACRwAIBghvAAYCBm8EAQIJAm8AAAkBCQABbQAJAAEJVAAJCQFYCgcFAwQBCQFMNjVCQD07NUY2RSQUFBQUHhgLBRsrNxQjIi8BNzYzMhUfARQiNSc3NDIVHwEUIjUnNzQyFR8BFCI1Jzc0MhUfARQiLwETNjMyFRMXIjURNDc2MzIWFzYzMhYUBiMiCgYEDg4EBgoQVhgMDBgOWBwKChwMWiAICCAKXCICBgYEDhIIQA4MJDBYgggYGjRMTDSyBARGSAQESGwICGymCAimagoIbN4KCt5qCgpq4AoK4GgMDGgBAA4O/wB0DgGMCgQOdFQKSmZKAAYAAP+SA5gDKgARABsAIQAtADYAPwBtQGoiHxcUBAIDAUcABw4BCAQHCGAKAQAABAkABGAACQ0BBgUJBmAABQwBAwIFA2ALAQIBAQJUCwECAgFYAAECAUw4Ny8uHBwTEgEAPDs3Pzg/MzIuNi82LCspJxwhHCESGxMbCggAEQERDwUUKwEyFhUUBgcOASMiJjU0Njc+AQMyNy4BJwYVFBYTHgEXLgEXPgE1NCYjIgYHHgEBIiY0NjIWFAYnIgYUFjI2NCYCLJjUwIwinF5+smxWDNBudjholhZkdlgQbEoCdNxYcpZoWo4QfK7+Cio+PlY8PCwYICAwIiIDKtSWjtIKVm60fGCaIozA/M5kFpZoOHZUdgGUTGoQUHTEEoxcapR0WAKuARI8Vjw8VjygIi4iIi4iAAAAAAQAAP9qAuQDUgAYACIAKgAzACdAJDEqKRsaExIREA0MCwBFMwkIBwYFAEQBAQAAZgAAABgAGAIFFCslFgcOAS8BBycTBi8BExcWFxMXBxceAQcGAycHFAcXFj4BJgUWPgEmLwEHExY+ASYvAQ8BAiIwNCqSTkBsOM5EQni6ekIazjpsQEwsKjA8QHwCPjRgOBr+FjRgOBoyQIDcNGA4HDI+BHzwWlpGJCwkuCABZgomRgFERig8AWYiuiQslkRYASom2AIEJB4aYGLAHhpgZBwm3v7OHhpgYh4kBNgAAAAABAAAAAADhAKKAAYADAATABkAPUA6BggCAAcBAQIAAV4EAQIDAwJSBAECAgNYCQUCAwIDTA0NAQAZGBcVDRMNEg8ODAoJCAUEAAYBBgoFFCsBMhYdASE1ATUhFSEiITUhFRQGIwE0MyEVIQNSFB7+DP5wASz+/CgBkAH0HBb8rigBBP7UAooeFMj6/drI+vrIFhwCJjL6AAADAAD/nAMAAyAAPgBNAFMAXEBZUgEHBhABAgELAQMCA0cABgcGbwAHCgdvAAoFCm8ABQgFbwAICQhvAAkECW8ABAEEbwABAAIDAQJgAAMAAANSAAMDAFgAAAMATFFPSkkWJSU1LRMiJSYLBR0rARQeAQ4CIyInJjc+ATMXBwYjIgcGFzc2Jy4BLwEmJy4CIgYjIiYnLgE0FzMyNScmNTQzMhceAR8CMh4BAzYuASIOARcWPgEyHwEWARQrATcGAu4KCAocSjaaKBoIAkYiIgQMGhQEBCxWJgoCIBIxHxAcJBIEDBgsvhQiODp0TgEBKFoeEhYCBMoKHjBgBhAqOCIIBAgOJhoRHAv+IhyQsAQCfASKlsCWZhoUbigmAkYCGiYEBASEEBQDCAUECCgidB4UIuZGBEg0KBRSDggkEA4MBiD+uAY0NC4uBgYCCAYKBAE4FqyKAAAAAAEAAP+xA+gDDAAcACFAHhEBAAEBRwIBAQABbwMBAABmAQAXFQ0LABwBHAQFFCsFIicBJy4DNTQ2NzIeAhc+AxcyFhQHAQYB9A4L/qQPCioiGo59Ikg+LhMULEBGI32OgP6lCk8KAVAPCjY2UCV7igEYKiIVFCQoGgGM9YD+sQoAAgAA/7ED6AMMABwAOQA1QDIyAQEAGgEDAQJHAAEAAwABA20AAwNuBQEEAAAEVAUBBAQAWAIBAAQATCgqHxUVFQYFGisBNC4DDgMHBiInLgMOBAcUFwkBNjcUBwEGIicBJy4DNTQ2NzIeAhc+AxcyFgOhGCY2MjxAPCQQCiIKDig4RDg2MioUAmkBRAFEaUeA/qUKHgr+pA8KKiIajn0iSD4uExQsQEYjfY4CBS5EKhgMBBgwIBINDQ8mKh4CBh4kSitdaf7IAThpXXuA/rEKCgFQDwo2NlAle4oBGCoiFRQkKBoBjAAAAAMAAAAAA+gCdgAUAB0ALABDQEAiAQQFAUcGAQAAAwUAA2AABQAEAgUEYAcBAgEBAlQHAQICAVgAAQIBTBYVAQAqKCUkGhkVHRYdCwoAFAEUCAUUKwEyHgMUDgMiLgM0PgMTMjY0JiIGFBY3Fj4BFxQGIiY0NjMyDgEB9FyqcFYoKFZwqriqcFYoKFZwqlxcgoK4goJcCDoqBEJcQEAuDggQAnYySlA+HDxSSjIySlI8HD5QSjL+En6yfn6yftYIDAoOLD4+Wj4uMAAAAAIAAP9qA+gCwwAXAD0APkA7NAgCAQAmCwIDAgJHAAMCA3AABAUBAAEEAGAAAQICAVQAAQECWAACAQJMAQA7OiQiHRsSEAAXARcGBRQrASIOAQcUFh8BBwYHNj8BFxYzMj4CLgEBFA4BIyInBgcGByMiJic1JjYmPwE2PwE+Aj8BLgEnND4BIB4BAfRyxnQBUEkwDw0aVUUYICYicsZ0AnjCAYCG5ognKm6TGyQDCA4CAgQCAwwEDRQHFBAHD1hkAYbmARDmhgJ8ToRMPnIpHDUzLiQ8FQMFToSYhE7+4mGkYARhJggEDAkBAggEAw8FDhYIHBwTKjKSVGGkYGCkAAAB//MAAANvAlQADQAGswgDAS0rEwkBNhcWBwEGJwEmNzY/AXIBdBYaGhr+dBYa/nQaGhgCOv6cAWQaGhYa/ngWFgGIGhYYAAAB//T/ogHeAxwADQAGswkDAS0rBRYHBicBJjcBNhcWBwEBxBoaGhb+eBgYAYgWGhoa/poUGhYaGgGKGBoBihoaFhr+jAAAAAAB//P/ogHdAxwADQAGswsFAS0rFwkBJjc2FwEWBwEGJyYNAWb+mhoaGhYBiBgY/ngWGhoUAXIBdBoWGhr+dhoY/nYaGhYAAAAB//QAAANsAlQADAAGswcDAS0rJQkBBiY3ATYXARYHBgMk/oz+jhowGAGMGhYBjBgYGoIBZv6aFi4aAYYaGv56GhgWAAIAAP/YAwwC8AALABkAF0AUBAEARRkVDQcEAEQAAABmEhEBBRQrAR4BHQEHAQc3ATc2ATcmJy4BIycPARYXFhcCziAe/P7e7jIBIvw2/loYAjIWLgwOFhIcEhgMAqggQBAQ/P7gNPABIPwM/TgYLDIWGgIYUBASGBgAAAADAAD/zgPoAu4ACAAdADIAYkBfAAUGAAYFAG0AAAMGAANrAAEICggBCm0ACgsICgtrAAQABgUEBmAAAwACBwMCYAwBBwAIAQcIXgALCQkLVAALCwlYAAkLCUwfHi8tKyolIyEgHjIfMiIVIhEjExINBRsrATQ2MhYUBiImJwYrATUzPgEzMhcWFAcGIicmIyIGBTMVIw4BIyInJjQ3NjIXFjMyNjc2AVRehF5ehF5yDjSgdijShKR4EBASMhJOeGSYAlCgdijQhqR2EhIQMhJSdGSYFgwBXkRcXIZeXn48eHycdBIyEhAQUnyceHycdhIyEBISUn5ePAAAAAAE//r/mgPzAxoAKwA3AFYAXgAdQBpZWEA/BABEAgEBAAFvAAAAZh0cGxoREAMFFCsTDgEUIwcGBwYvASY3PgE3NjI+ATcyPgE3NjcyFzIHBgcGFxYXFg8BBicuARcBFg8BBicBJj8BNiUWBwYnJg8BJzc+ASY3Njc2FgcGBwYWFxY3PgE3NhYBNxcHBi8BJpsIBgIRDwQQDEYLDQIgBAYqHggGAg4mFoY0ehoMFHggUCwiBAgKTA4EKjr4AZoSFDAWEP5iCAhIDAIyECAyaDgsUkREGA4CBgyADAwEDCIOBCY6JgYoAgQS/Kj+TPYUEi4WAfoIHBYPDQQOEkwMDAIYBAYcMAYOHhBaBgIINBg4Oi4CCAZGCAQwGDL+JBYQKg4SAdgIDD4IwGg+WBoMLE5ORhg6SBY4OAYSBgxECjIcKD4MOgQKAv1E+FbyFBAuEgADAAD/nAOEAyAACAARACoAP0A8HQEEAUYACAYEBggEbQAHAAYIBwZeAAQABQAEBWACAQABAQBUAgEAAAFYAwEBAAFMEjITMiQTFBMSCQUdKzM0NjIWFAYiJiU0NjIWFAYiJgEGFjMhFRQjISI9AQMjNTQ7ATIdASERFAeWPFI6OlI8AfQ8Ujo6Ujz+viQEKgIyFP1yFGxiFJwUAsASKDw8Ujo6Kig8PFI6OgEWChpMFBRMAfRQFBRW/u4WBAAAAAABAAD/sQPoAy4AKwApQCYmAQQDAUcAAwQDbwAEAQRvAAECAW8AAgACbwAAAGYjFxM9FwUFGSslFAcOAgcGIiY1NDY3NjU0LgUrARUUBiInASY0NwE2MhYHFTMgFxYD6EcBCgQFBxEKAgEDFCI4PlZWN30UIAn+4wsLAR0LHBgCfQGOWh7hXZ8EEhAECgwIBRQDJh84WkAwHhIGjw4WCwEeCh4KAR4KFA+P4UsAAgAA/7ED6AM1ABQAOgArQCgmAAIAAyEBAQACRxABA0UAAwADbwIBAAEAbwABAWY4NywqHRwkBAUVKyUVFAcGIyInASY0NwE2Fh0BBwYUFwUUDgIPAQYjIicmNzYnLgEnFRQHBiMiJwEmNDcBNhcWHQEWFxYBZRYHBw8K/uMLCwEdESzdCwsDYBIaHAgLBQsDAg4BGFMkdlsVCAYPCv7iCwsBHhAXFeZpXvYnFwoDCwEeCh4KAR4RExcn3gscC/MgVEZGEBYKAQQP31woLAeMFwoDCwEeCh4KAR4RCQoXkw9sYAAAAQAA/7ED6AMvACwAHUAaAAMBA28AAQABbwAAAgBvAAICZiodMxQEBRgrARQHAQYiJj0BIyIOBRUUFxQWBxQGIicuAicmNTQ3NiEzNTQ2FhcBFgPoC/7jCxwWfTdWVj44IhQDBAEKEQYECAYDRx5aAY59FhwLAR0LAe0PCv7iCxYOjwYSHjBAWjgfJgQSBggMCgUOFAOfXW9L4Y8OFgIJ/uILAAAFAAD/bwPeA00AFQAZABwAKgAuAE1ASi4tAgECLBgCBQEeGhkXBAUDBQNHAAIBAm8AAQAFAwEFXgADAAQGAwRgBwEGAAAGUgcBBgYAWAAABgBMHR0dKh0qFSUXEiU3CAUaKwEWFA8BERQGByEiJicRNDYXITc2MhcJAScBBx8BBREHDgEHIzU0Nj8BIREBNycHA8YYGLkeFv1cFh4BIBUB1LkYPhj+iwFHcP64FQRYARWnFFYlnxYUpf7IAsBDckMCnxdAF7n+KxUeASAUAqUVIAG5GBj9hAFIcP65LFYEzQE4oBQaAZ8pUhSn/cICTkNyQwAAAgAA/yEDdQObABQARQBDQEAzLCghBAIFPDUfGAQBAj8VDQYEAAEDRyoBBUUABQIFbwMBAgECbwQBAQABbwAAAA0ASUNCOjgxLyUjHBoZBgUVKwEWEhUUAgcVFAYiJjc1JgI1NBI/ARM+ATcHBiMiJj8BJicHBiMiJj8BJicGBxcWBgciLwEGBxcWBiMiLwEeARcRND4BFhcBxbz02qwgKCIBrNr2vAk0fZ4DowgLEBANxAsicQgLEBANe2GjpGB6DRAQCwdyIgvEDRAQCwejBJx9ICoeAQOaI/7av7T+5C5AFR4eFUAuARy0vwEmIwH8ZivWhaQIHg7ETUFyCCILe4giIoh7DCABCHJBTcQOHgikhtQsAmAWHgIiFAADAAD/uQQWAroAFAAkADkAHkAbLhECAAEBRwMBAQABbwIBAABmNTQoJxcSBAUWKyUHBiInASY0NwE2Mh8BFhQPARcWFAEDDgEvAS4BNxM+AR8BHgEJAQYiLwEmND8BJyY0PwE2MhcBFhQBWBwFDgb+/AYGAQQFEAQcBgbb2wYBRNACDgYiCAYB0QIMByMHCAFs/vwGDgYcBQXb2wUFHAYOBgEEBUUcBQUBBQUOBgEEBgYcBRAE3NsGDgJO/S8HCAMJAwwIAtAIBgEKAg7+j/77BQUcBg4G29wFDgYcBgb+/AUQAAABAAD/tAMQAwgANgA9QDoAAgUGBQIGbQAGBAUGBGsAAQADBwEDYAAHAAUCBwVgAAQAAARUAAQEAFgAAAQATCYXJiUTFRUiCAUcKyUUBiMiJwEmND4BFwEWFAYiJwEmIgYWFwEWMzI2NzQnASYjIgYUHwEWFAYiLwEmNTQ2MzIXARYDEFpASzj+Tj98sEABUgUiEAX+rSx0UgEqAbEjLiQuASP+uw4TEBYO5QYkDgblI0AtMSMBRDhNQVg3AbJAsHoBP/6uBRAiBQFTK1R1K/5PJDAjLiMBRA4WIg/kBhAiBeUiMS5AI/67NgAAAAIAAP/5AoMDCwAHAB8AKkAnBQMCAAECAQACbQACAm4ABAEBBFQABAQBWAABBAFMIxMlNhMQBgUaKxMhNTQmDgEXBREUBgchIiYnETQ2FzM1NDYyFgcVMzIWswEdVHZUAQHQIBb96RceASAWEZTMlgISFx4BpWw7VAJQPaH+vhYeASAVAUIWIAFsZpSUZmweAAEAAP/5A6EDDAAlADBALQQBAgEAAQIAbQAAAwEAA2sAAwNuAAUBAQVUAAUFAVgAAQUBTBMlNSMVJAYFGisBFRQGByMiJj0BNCYOAQcVMzIWFxEUBgchIiYnETQ2FyE1ND4BFgOhFg4kDhZSeFIBNRceASAW/ekXHgEgFgF3ktCQAhGPDxQBFg6PO1QCUD1sHhf+vhYeASAVAUIWIAFsZ5IClgAAAgAA/2oCgwMLAAsALgA8QDkHAQIBAAFHAAMCA3AABwgGAgABBwBgCQUCAQICAVQJBQIBAQJYBAECAQJMLSwTMxEUIjMVFRMKBR0rATU0JiIGHQEUFjI2BRQGJyMDDgEHIyInAyMiJic0NjMRIi4BNjchMhYUBicRMhYBDAoQCgoQCgF3Fg7vHQEKBgEPAivhDxQBWDcdKgIuGwFlHSoqHTdYAXD6CAoKCPoICgq9DhYB/vIHCAEPAQ8UD0VuAR4qOioBLDgsAf7ibgAAAgAA//kDkgLFABAAMQAuQCsuJiUYFQ8ODQgBAwwBAAECRwQBAwEDbwABAAFvAgEAAGYqKCMiIREUBQUXKwERFAYHIzUjFSMiJicRCQEWNwcGByMiJwkBBiYvASY2NwE2Mh8BNTQ2OwEyFh0BFxYUAxIWDtaP1g8UAQFBAUEBfCIFBwIHBf5+/n4HDQUjBAIFAZESMBOICghrCAp6BgEo/vUPFAHW1hYOAQ8BCP74ASQpBQEDAUL+vgQCBSkGDgUBTg8PcWwICgoI42YEEAAAAAMAAP+6A5gDSQAcADsAXACmQBo6AQkFV0cCAAQTCwIBBwNHVisCCUYGAgcCRkuwClBYQDYABQMJBAVlAAEHAgABZQAIAAMFCANgAAkAAAcJAGAABAAHAQQHYQACBgYCVAACAgZYAAYCBkwbQDgABQMJAwUJbQABBwIHAQJtAAgAAwUIA2AACQAABwkAYAAEAAcBBAdhAAIGBgJUAAICBlgABgIGTFlADllYFxccKBcYGhgUCgUdKyU0LwEmIgcXHgEfARQGByIuAS8BBhQfARYyPwE2ATQvASYiDwEGFB8BFjI3Jy4CNTQ2FzIWHwEWHwE2ARQPAQYiLwEmNDcnBiIvASY0PwE2Mh8BFhQHFzYyHwEWAy0QdBAuEBYDDAECIBYIDg4EFhMQcw8tEFIQ/ncPcxAsEFIQEHQPLhEXAwoEHhcJDgcLBAgKEgH0MFIuhy5zLjExMIcvdC8vUi+GL3MuMTEwhy90L6sXD3QQEhYDEAYPFx4BBAoEFhEuD3QPD1EQAZ8WEHMQD1IPLBB0DxEXAw4OCRYgAQQFCAMJCxH+jkIvUS8wcy+HMDExL3Qvhi5SLi90LogwMTEvdC8AAAAIAAD/sQOhA1IACwAXACQAPQBVAGIAbgB6AJJAj2oBDwlkAQwISTkCBQouAQEEEwwCBwMSDQIGAAZHAA8JCAkPCG0ADgwLDA4LbQABBAMEAQNtAAAHBgcABm0ACQAIDAkIYAANAAwODQxgAAsACgULCmAABQAEAQUEYAADBwIDVAAHAAYCBwZgAAMDAlgAAgMCTHh3cnFtbGdmYF9aWFJRHxcXJCQVFhUSEAUdKzcHBiImND8BNjIWFBcVFAYiJic1NDYyFicUBisBIiY0NjsBMhYFFA8BBiIvASYnNxcWMj8BNjQvATcWHwEWAQcnJiIPAQYUHwEHJi8BJjQ/ATYyHwEWBRQGKwEiJjQ2NzMyFgEVFAYiJj0BNDYyFhcHBiImND8BNjIWFPWPBg4LBo4GDgtZChAIAQoODH4KCLIICgoIsggKAsIwUi6HLroMDIaYDy4PUhAQmQoUC7wv/qeFmBAsEFIQEJkKFAy7Ly9SL4YvugwBbQoIswgKCgizCAr+0AoQCgoQCuOPBg4KBY8FDguNjwULDgaOBQoOHbMICgoIswgKCnUICgoQCgpQQi9RLzC7DBMKmQ8PURAsD5qFCwy8MAFSCpkQD1IPLBCZhgwMuzCFLlIuL7sMQggKChAIAQoBKLIICgoIsggKClyPBQsOBo8FCw4AAAAAAgAA/2oDkANSAAYACgAzQDAGAQQAAUcAAQABbwIBAAQAbwUBBAMDBFIFAQQEA1YAAwQDSgcHBwoHChMRERAGBRgrASMRIREjAQUVITUDkOz+oOwBnP5kAzgB8QFh/p/+ZHV2dgAAAAAD////sQPoAsMAGQA5AEkAQEA9GxIBAwMCEwACAQACRwADAgACAwBtAAABAgABawAFAAIDBQJeAAEEBAFUAAEBBFgABAEETDU9LRkqKQYFGislEQYHBgcOAicjIi4BJyYnJicRFBY3ITI2EzUvASYGJyEiBgcUFxYXHgQ3MzI+Azc2Nz4BNxEUBgchIiY3ETQ2MyEyFgOhEhWVWRwkPBsCGj4iHViWFRIMBgM2BwoBAgMDBAb8ygcKAVNrdAQgEiAYDAILGh4UHgV0bB40RzQl/MokNgE0JQM2JTQLAawUEHNKGBoeAhoeFkpzEBT+VAcMAQoCUg4OBQUCAwwGXkFUXAMcDhQMAQoWDB4CXFQYUjX9oSU0ATYkAl8lNDQAAAABAAD/ygOhA0AAHwAdQBoSDwoEAwUAAgFHAAIAAm8BAQAAZh0UFwMFFysBFA8BExUUDgEvAQcGIiY1NDcTJyY1NDclNzYyHwEFFgOhD8owDBUM+/oMFgwBMMsOHwEYfgsgDH0BGCAB6QwPxf7pDAsQAQeEhAcSCgQIARfFDwwVBSj+Fxf+KAUAAgAA/8oDoQNAAAkAKQAnQCQcGRQODQkIBwYFAwEMAAIBRwACAAJvAQEAAGYlJBcWEhADBRQrATcvAQ8BFwc3FxMUDwETFRQjIi8BBwYiJjU0NxMnJjU0NyU3NjIfAQUWAnuq62pp7Ksp09P+D8owFwoM+/oMFgwBMMsOHwEYfgsgDH0BGCABIqYi1dUiputvbwGyDA/F/ukMHAeEhAcSCgQIARfFDwwVBSj+Fxf+KAUAAAAAAgAA/7ECygMMABUAHgAlQCIABQEFbwMBAQQBbwAEAgRvAAIAAm8AAABmExcRERcyBgUaKyUUBiMhIiY1ND4DFxYyNzIeAwMUBiIuATYeAQLKRjH+JDFGChgqPi1JykoqQiYcCI98tHoEgqyERTxYWDwwVFY8KAFISCY+VFYBwFh+frCAAnwAAAMAAP+xBHgDDAAIACwATwB3QHQsJQIKByAfDgMDAjITAgQIA0cAAQcBbwAHCgdvDgEACg0KAA1tAAsNAg0LAm0MAQoADQsKDWAGAQIFAQMIAgNgAAgEBAhUAAgIBFgJAQQIBEwBAE1LSkhFREE/NjMxLykoJCIcGxcVEhAKCQUEAAgBCA8FFCsBIiY+AR4CBgUzMhYHFRQGKwEVFAYHIyImPQEjIiYnNTQ2NzM1NDYXMzIWFwEUFjczFQYjISImNTQ+BRcyFx4BMjY3NjMyFyMiBhUBiVl+Anq2eAaEAcPEBwwBCgjEDAZrCArFBwoBDAbFCghrBwoB/mUqHY8mOf4YQ1IEDBIeJjohCwssVGRULAsLSTB9HSoBXn6wgAJ8tHpJDAZrCArFBwoBDAbFCghrBwoBxAcMAQoI/r8dLAGFHE5DHjhCNjgiGgIKIiIiIgo2Kh0AAAAAAwAA/7EEcgMMAAgALABOAFRAUUkBAAckGxIDAggyAQYCA0cAAQQBbwUBBAcEbwkBBwAHbwoBAAgAbwAIAghvAwECBgJvAAYGZgEASEZEQ0E/NjMnJiIhFRQQDwUEAAgBCAsFFCsBIiY+AR4CBgUXFhQPAQYiLwEHBiIvASY0PwEnJjQ/ATYyHwE3NjIfARYUBwUHBhQfAQYjISImNTQ+BRcyFxYyNzYzMhcOAQcUFwGJWX4CerZ4BoQCBIsFBUwFDwWLiwUPBUwFBYuLBQVMBQ8Fi4sFDwVMBQX+X2UVFS4LDf4YQ1IEDBIeJjohCwtWuFYLCw8QDw4BFQFefrCAAny0erWKBRAFTAUFi4sFBUwFEAWKiwUQBUsFBYuLBQVLBRAFi2UUPBUuAk5DHjhCNjgiGgIKREQKBA8YFB4VAAAG////agQvA1IAEQAyADsARABWAF8Ab0BsTw4CAwIBRxEBCQsJbwALCAtvEAEIAghvDwECAwJvBwEFAAEABQFtDAoCAQYAAQZrAAYEAAYEawAEBG4OAQMAAANUDgEDAwBYDQEAAwBMXl1aWVZUUlBLSklHQ0I/Pjo5GRUUGTcjEyEQEgUdKwEGByMiJjc0MzIeATcyNwYVFAEUBiMhIiYnND4FMzIeAj4BPwE2NzIeBBcBFAYiJjQ2MhYBFAYuAT4CFgUUBicjJic2NTQnFjMyPgEXMicUBiImNDYyFgFLWjpLLUABRQQqQiEmJQMCg1JD/hhEUAEEDBAgJjohBiQuSFBGGSkQCCI4JiAQDgH9xlR2VFR2VAGJfrCAAny0egFDPi5LOVotAyUlIUQoBEVHVHZUVHZUAV4DRCwsxRYaAQ0VEE7+W0JOTkIeOEI4NCYWGBwaAhYQGgoCFiY0OEIcAo87VFR2VFT+71l+Anq2eAaE0ysuAUQDQU4QFQ0YGAGPO1RUdlRUAAEAAAAAA6UCmAAVAB1AGg8BAAEBRwACAQJvAAEAAW8AAABmFBcUAwUXKwEUBwEGIicBJjQ/ATYyHwEBNjIfARYDpRD+IBAsEP7qDw9MECwQpAFuECwQTBACFhYQ/iAPDwEWECwQTBAQpQFvEBBMDwABAAD/7wLUAoYAJAAeQBsiGRAHBAACAUcDAQIAAm8BAQAAZhQcFBQEBRgrJRQPAQYiLwEHBiIvASY0PwEnJjQ/ATYyHwE3NjIfARYUDwEXFgLUD0wQLBCkpBAsEEwQEKSkEBBMECwQpKQQLBBMDw+kpA9wFhBMDw+lpQ8PTBAsEKSkECwQTBAQpKQQEEwPLg+kpA8AAQAA//kDEgMLACMAKUAmAAQDBG8AAQABcAUBAwAAA1QFAQMDAFgCAQADAEwjMyUjMyMGBRorARUUBicjFRQGByMiJjc1IyImJzU0NjczNTQ2OwEyFhcVMzIWAxIgFuggFmsWIAHoFx4BIBboHhdrFx4B6BceAbdrFiAB6RYeASAV6R4XaxceAegWICAW6CAAAQAAAAADEgHtAA8AGEAVAAEAAAFUAAEBAFgAAAEATDUzAgUWKwEVFAYnISImJzU0NjchMhYDEiAW/VoXHgEgFgKmFx4Bt2sWIAEeF2sXHgEgAAAAAv/9/7EDXwMLABUAIgAwQC0HAQIBAUcABAAEbwAAAQBvAAECAW8AAgMDAlQAAgIDWAADAgNMFRcXFBQFBRkrATQvASYiDwEnJiIPAQYUHwEWMjcBNhcUDgEiLgI+ATIeAQLNCjMLHAvkfgscCzMKCsoKHgsBLwqMcsboyG4Gerz0un4BuBAKMgsL434LCzIKHwrKCgoBLwpLdcR0dMTqxHR0xAAC//3/sQNfAwsAJAAxADBALR4VDAMEAgABRwAFAQEAAgUAYAMBAgQEAlQDAQICBFgABAIETBUXFBwUGQYFGislNC8BNzY0LwEmIg8BJyYiDwEGFB8BBwYUHwEWMj8BFxYyPwE2NxQOASIuAj4BMh4BAoEKZWUKCjMKHgplZQseCjILC2VlCwsyCh4LZWUKHgozCthyxujIbgZ6vPS6fuAOC2VlCx0LMgsLZWULCzILHQtlZQsdCzILC2VlCwsyC411xHR0xOrEdHTEAAAC//3/sQNfAwsAIwAwAEFAPg0BAAEfAQQDAkcCAQABAwEAA20FAQMEAQMEawAHAAEABwFgAAQGBgRUAAQEBlgABgQGTBUVIyQlIyQUCAUcKwE1NCYHIzU0JicjIgYHFSMiBhcVFBY3MxUUFhczMjY3NTMyNjcUDgEiLgI+ATIeAQKnFg6PFg5HDxQBjw4WARQPjxYORw8UAY8OFrJyxujIbgZ6vPS6fgE6SA4WAY8PFAEWDo8UD0gOFgGPDxQBFg6PFDN1xHR0xOrEdHTEAAAAAv/9/7EDXwMLAA8AHAAdQBoAAwADbwAAAQBvAAECAW8AAgJmFRU1JAQFGCsBNTQmByEiBhcVFBY3ITI2NxQOASIuAj4BMh4BAqcWDv5TDhYBFA8BrQ4WsnLG6MhuBnq89Lp+ATpIDhYBFA9IDhYBFDN1xHR0xOrEdHTEAAIAAP/5AjkCwwAPADsAa7UAAQABAUdLsA9QWEAmAAQDAgMEZQACAQMCAWsABQADBAUDYAABAAABVAABAQBYAAABAEwbQCcABAMCAwQCbQACAQMCAWsABQADBAUDYAABAAABVAABAQBYAAABAExZQAknFCseJiQGBRorJRUUBgcjIiY9ATQ2FzMyFhMUDgMHDgEVFAYHIyImPQE0Njc+ATQmJyIHBgcGIyIvAS4BNzYzMh4CAYkOCIYJDg4JhgkMsRAYJhoVFx4OCYYIDEoqIRw0IiQYFCgHCgcHWwgCBFmqLVpILpWGCQwBDgiGCQ4BDAFFHjQiIBIKDTANChABFgkaLlITECAyIgEQDjIJBEYGEAiUIjpWAAAD//3/sQNfAwsADwA3AEQASEBFKQEFAwkBAgEAAkcABAIDAgQDbQADBQIDBWsABwACBAcCYAAFAAABBQBgAAEGBgFUAAEBBlgABgEGTBUeKxMWJiYjCAUcKyU1NCYrASIGHQEUFjsBMjYTNC4BIyIHBh8BFjMyNz4BMhYVFAYHDgEXFRQWOwEyNjQ2PwE+AxcUDgEiLgI+ATIeAQH0CghrCAoKCGsICo8+XDGIRwkNSgQGCQUeJTgqFhsjPAEKCGsIChgSHAoeFAzXcsboyG4Gerz0un5SawgKCghrCAoKAX8xVC53DQs3BAcmGx4SFRoMD0IlFAgKChIiCxAGGhwoUnXEdHTE6sR0dMQAA//9/7EDXwMLAB4ALgA7AElARiggAgYFDgYCAgEYAQIEAANHAAgABQYIBWAABgABAgYBYAACAwEABAIAYAAEBwcEVAAEBAdYAAcEB0wVFiYmJhEmIyMJBR0rJTU0JisBETQmKwEiBh0BFBY7ARUjIgYdARQWOwEyNgM1NCYrASIGHQEUFjsBMjYFFA4BIi4CPgEyHgECOwoHNgoIsggKCgg1NQgKCgj6BwpHCghrCAoKCGsICgFlcsboyG4Gerz0un5SWQgKAR4ICgoIWQgKswoIWQgKCgH8WQgKCghZCAoK4HXEdHTE6sR0dMQAAAAAAgAA//kBZgMLAB4ALgA/QDwfAQUGGhICAgMIAAIAAQNHAAYABQMGBWAAAwACAQMCYAQBAQAAAVQEAQEBAFgAAAEATDUmIyYhFjMHBRsrJRUUBgchIiYnNTQ2NzM1IyImJzU0NjczMhYXETMyFgMVFAYHIyImPQE0NjsBMhYBZRQQ/uMPFAEWDiMjDxQBFg7WDxQBIw8WSBYOjw4WFg6PDxRkRw8UARYORw8UAdYWDkcPFAEWDv6/FgJ1aw8UARYOaw4WFgAAAAACAAD/+QEwAwsADwAfACxAKRkREAMCAwFHAAMCA28AAgECbwABAAABVAABAQBYAAABAEw1JiYkBAUYKyUVFAYHIyImPQE0NhczMhYTAw4BJyMiJicDJjY7ATIWAR4WDo8OFhYOjw8UEhABFg6PDhYBDwEWDbMOFpp9DxQBFg59DhYBFAI+/lMOFgEUDwGtDhYWAAAAA//9/7EDWQMLAAwAHAAuAERAQSgeAgUEFhUOAwMCAkcGAQAABAUABGAABQACAwUCYAADAQEDVAADAwFYAAEDAUwBACwqIyEaGBIQBwYADAEMBwUUKwEyHgEUDgEiLgI+ARM1NCYrASIGBxUUFhczMjYnEzQnJisBIgcGFRMUFjsBMjYBrXTGcnLG6MhuBnq8wQoHawgKAQwHawcKAQoGBQh7CAUGCgoJZwgKAwt0xOrEdHTE6sR0/UhqCAoKCGoICgEMxwFaBwMFBQMH/qYGCAgAAAAB//MAAAHfAfAADQAGswYBAS0rATYXFg8BBi8BJjc2HwEBlRYaGhrEFhrEGhoYGqoB1hoaFhrAFhbAGhYYGJwAAf/0AAABFgJUAA0ABrMJAwEtKzcWBwYvASY/ATYXFg8B/BoaGhbAGBjAFhoaGpy0GhYaGsIYGsIaGhYarAAAAAH/8wAAARUCVAANAAazCwUBLSs/AScmNzYfARYPAQYnJg2enhoaGhbAGBjAFhoatKqsGhYaGsIaGMIaGhYAAAAB//QAAAHcAfAACwAGswUBAS0rNwYmPwE2HwEWBi8BPhowGMQaFsQYMBqq5hYuGr4aGr4aLhaeAAMAAP/iAvgC2gAHAA8AGAA4QDUAAAACAwACYAADAAUGAwVgCAEGAQEGVAgBBgYBVgcEAgEGAUoREBUUEBgRGBISERISEAkFGisRIAARIxAAIRUyABUjNCYjFzIWFAYiJjQ2AToBvnb+iP722gEydu6oci5ERFxERALa/kL+xgEKAXZ2/s7Ypu6yQl5CQl5CAAIAAAAAAsUCoAACAAUACLUFAwIAAi0rCQInLQECxf4sAdRG/u0BEwKg/r7+voW9vQAAAAACAAAAAAMQAqAAAgAFAAi1BQMCAAItKyUJARcNAQE8AdT+LEYBE/7tHAFCAUKFvb0AAAAAAgAA/7EDWgMLAAgAagBFQEJlWUxBBAAEOwoCAQA0KBsQBAMBA0cABQQFbwYBBAAEbwAAAQBvAAEDAW8AAwIDbwACAmZcW1NRSUgrKiIgExIHBRYrATQmIg4BFjI2JRUUBg8BBgcWFxYUBw4BJyIvAQYHBgcGKwEiJjUnJicHBiInJicmNDc+ATcmLwEuASc1NDY/ATY3JicmNDc+ATMyHwE2NzY3NjsBMhYfARYXNzYyFxYXFhQHDgEHFh8BHgECO1J4UgJWdFYBHAgHaAoLEygGBQ9QDQcHTRkaCQcEEHwIDBAbF08GEAZGFgQFCCgKDwhmBwgBCgVoCA4XJQYFD1ANBwhNGBoJCAMRfAcMAQ8cF08FDwdIFAQECSgKDwhmBwoBXjtUVHZUVHh8BwwBEB4VGzIGDgYVUAEFPA0ITBwQCgdnCQw8BQZAHgUOBgwyDxwbDwEMB3wHDAEQGRogLQcMBxRQBTwNCEwcEAoHZwkLOwUFQxwFDgYMMg8cGhABDAAAAAMAAP9qA1oDUgACABcALAAsQCkCAQBEAAABAHAAAgADBAIDYAAEAQEEVAAEBAFYAAEEAUwZGhkXEAUFGSslIQcBFAcGBwYiJyYnJjQ3Njc2MhcWFxYHNCcmJyYiBwYHBhQXFhcWMjc2NzYBXAExmQFmMTBRU8JTUS8xMS9RU8JTUTAxRycmQUOcQ0EmJycmQUOcQ0EmJ0bcAoNhU1EwMTEwUVPCU1EvMTEvUVNhTkNBJicnJkFDnENBJycnJ0FDAAYAAP+DA+gDOQAjACcAKwAvADMAPACIQIUhAQcABQEBDRcBCQIPAQMIBEcQAQARAQcGAAdeAAYADA4GDF4TAQ4ADw0OD2ASAQ0LBQIBAg0BXgoEAgIACQgCCV4ACAMDCFIACAgDWAADCANMNTQwMCQkAQA5ODQ8NTwwMzAzMjEvLi0sKyopKCQnJCcmJR0cGxkTEQsKCQcAIwEjFAUUKwEhIgYVERQWMyEVIyIGHQEUFjMhMjY9ATQmKwE1ITI2NRE0JgcRIREBITUhJyM1MyU1IRUlIgYUFjI2NCYD1vw9CAsLCAGAbAcLCwcBrQgKCghyAXQICgob/GICnP55AYeEhYX96AOe/jgJDQ0SDQ0DOQoI/WwICnQKCGYHCwsHZggKdAsHApQICiT+KQHX/JJBJXQkdHRMDBINDRIMAAAABf/2/8wD6QLxAEAATABYAHMAfgB1QHJ7ZUgxEAUHBkIBCgd1ZkcDCQpyAQwJcwELDAVHegEKAUYAAAMAbwADAAgFAwhgAAIABQYCBWAAAQAGBwEGYAAHAAoJBwpgAAkADAsJDGAACwQEC1QACwsEWAAECwRMcG5dW1VUT04VKCQfLyUkFBENBR0rASYiBwYHBgcGJyMmBwYHBgcuASMiBg8BOAExBwYHBhYfAR4BMzI2PwE4ATE3Njc2Jic2NzY3NhczFjc2NzY3NjQFByYjIg8BJz4BMhYDBiImND8BNjIWFAcDDgEjIiYvAS4BNj8BFwcOARUUFx4BMzI/ARc3Jzc2NTQnNx4BBgPjBg8FHhkUFgwZAR0RHBwhJiVdNTtwKwKrORYVIDQUJF82OnAsqwM4FhUeMh8bFhYOGQIcEBsaICQF/pJSExQfGCR5JlxcUIcKIxcMSAwhFwtJJmI0LlMeFC0bJzGeeQoLDBcKHQ8hFQt5GnkkFgtSKhshAusFBR4NCwEBBAUBAQ0QIyMlMCsCqzlKSZA0EyUmLyusAjhJSI80HQ4KAQEFBAEBDhAjBRCGUgsWJHkhJB/+6gwXIwpIDBcgDf6RJiohHxQtfYAxnnkLCh0PIRULDBcKeRp5JBgeFRNSK3d6AAAAAv///2oD9ANSACgATQAyQC89NiMRBAECAUcAAgMBAwIBbQABAW4AAAMDAFQAAAADWAADAANMSkg7OhYVIQQFFSsBJiMiBgcGDwEnJgcGBwYHBhcHBhQWMj8BPgE3Njc2Nz4BLwE3Njc+AQMHDgEfAQYHBgcGBwYHATY0JiIHATY3NjcXFjY/AT4BMzIXFgYDxCRAV+pzAwIrOgsHPCEaCQYCpwUMDQemW71QaksoEgQBAhR7BQFJHYOEBgUCFyARR2VMWU07AVgFCw8F/qMDFR8/PgcMAi9r3k4xGSQgAy4kfm0DBYEJAglLZUxUNymnBQ8LBacINCk1TCgVBAoFN0YCBHW7/udLAw0HOyIRRzMnGRUHAVgFDwsF/qNTUHZTCgEHBoxleRklpAAABgAA/3IELwNJAAgAEgAbAHoAtgDxAJxAme7ZAgQOal0CBQjQvHADAAW+rKB1UkxFIx0JAQCznkADAgE6LQIGApWAAgsDB0fn2wIORYIBC0QKAQgJBQkIBW0ABgIHAgYHbQAOAAQJDgRgAAkIAAlUAAUNAQABBQBgAAIGAQJUDAEBAAcDAQdgAAMLCwNUAAMDC1gACwMLTOXjx8aqqIuKbWxkYlpZNDIrKhMUFBQTEg8FGisBNCYiBhQWMjYFNCYOARcUFjI2AzQmIgYeATI2BxUUBg8BBgcWFxYUBw4BIi8BBgcGBwYrASImNScmJwcGIicmNTQ3PgE3Ji8BLgE9ATQ2PwE2NyYnJjQ3PgEzMh8BNjc2NzY7ATIWHwEWFzc2MhcWFRQPAQYHFh8BHgEBFRQHBgcWFRQHBiMiLwEGIicOAQciJyY1NDcmJyY9ATQ3NjcmNTQ/ATYzMhYXNxc2PwEyFxYVFAcWFxYRFRQHBgcWFRQHBiMiJicGIicOASInJjU0NyYnJj0BNDc2NyY1ND8BNjMyFhc3FzY/ATIXFhUUBxYXFgH0VHZUVHZUAa0sOCwBKjosASw4LAEqOizYCARXBgwTHwQEDEQQBUAVFgYHBA1oBgoNExdCBA0GUAQFJAgNB1UFCAgFVgcLEx8EBAxECgYGQBMYBgcDDWgGCgENExdBBQ0FUQQYEQgNBlUGBgFmUwYKHAJEAQUVHQsMCwcsAwFEAx0KB1NTBwodAzQQAQQqCBERHBcEAkMCHAkHU1MGChwCRAEFKggLDAsHLAREAx0KB1NTBwodAzQQAQQqCBERHBcEAkMCHAkHUwFeO1RUdlRU4x0sAigfHSoqAlkdKio7KirNZwYKAQ4TFxslBgwEEUIEMgsGPBsNCAZVBgwyBARLDwUFCCwMGBYNAQgHaAUKAQ4TFxslBgwFEEIEMgoIPBoNCAZVBgsxBARLDwQGHhUNGxMMAgj+z04JCA8OPw4CAigbJQEBCzQBKAICDj8ODwgJTgkJEA0/DgICHgk0DAEBKBcBJwICDj8NEAkCM04JCQ8OPw4CAic0DAEBDDQnAgIOPw4PCQlOCQgQDT8OAgIeCTQLAQEnFwEnAgIOPw0QCAAACQAA/7EDWQLEAAMAEwAXABsAHwAvAD8AQwBHAJ9AnCsBCwY7AQ0EAkcaERUDBxABBgsHBl4XAQoACwwKC2AZDxQDBQ4BBA0FBF4YAQwADQIMDWATAQIBAwJUFgkSAwEIAQADAQBeEwECAgNYAAMCA0xEREBAMTAhIBwcGBgUFAUEAABER0RHRkVAQ0BDQkE5NjA/MT8pJiAvIS8cHxwfHh0YGxgbGhkUFxQXFhUNCgQTBRMAAwADERsFFSs3FSM1JTIWHQEUBisBIiY9ATQ2PwEVITUTFSM1ARUhNQMyFgcVFAYHIyImJzU0NhcBMhYHFRQGByMiJic1NDYXBRUjNRMVITXExAGJDhYWDo8OFhYO6P4efX0DWf5lfQ8WARQQjg8UARYOAfQOFgEUD48PFAEWDgFBfX3+HkBHR0gWDo8OFhYOjw8UAdZHRwEeSEj9xEdHAoMUEI4PFAEWDo4PFgH+4hQPjw8UARYOjw4WAUdHRwEeSEgAAAMAAP+xBDADUgAIACIAKwBQQE0ABQIFbwQJAgIHAm8ABwAHbwgBAAEAbwABBgFvCgEGAwMGVAoBBgYDWAADBgNMJCMKCQEAKCcjKyQrHxwZFxIPCSIKIgUEAAgBCAsFFCsBMhYUDgEmPgElMhYHERQGIyEiJjURNDY7ATc+ATMhMhYfAQEyPgEmDgEeAQIYQl5ehGACXAHNO1QBUjz87jtUVDt9HAs4HgEeHTgLHf70Z5IClsqYBowB216GXAJggmLmVDv+DDtUVDsB9DtUTBsoKBtM/X2UzJYEjtSMAAAADP/9/3AD6gNOACcAKwAwAGAAagB1AIMAkgCfAK0AuwDKAUhADGNDPgMJDhIBAQICR0uwCVBYQEwXARQNCA0UCG0TARIEBQQSBW0VAQAADRQADWAKAQgRAQ4JCA5gEBYPAwkLBwIEEgkEYAwGAgUAAwIFA14AAgEBAlIAAgIBWAABAgFMG0uwClBYQFIXARQNCA0UCG0AEgQTBBITbQATBQQTBWsVAQAADRQADWAKAQgRAQ4JCA5gEBYPAwkLBwIEEgkEYAwGAgUAAwIFA14AAgEBAlIAAgIBWAABAgFMG0BMFwEUDQgNFAhtEwESBAUEEgVtFQEAAA0UAA1gCgEIEQEOCQgOYBAWDwMJCwcCBBIJBGAMBgIFAAMCBQNeAAIBAQJSAAICAVgAAQIBTFlZQDm9vGFhBgC8yr3KuLWmpXJwbWthamFpZmRaWVBPTUtIRkFAOzo3NTQzLy4tLCsqKSgWFAAnBicYBRQrATA5ATAxIg4CFRQWFxYXFh0BFBYzITI2PQEwMTQ3Njc+ATU0LgITIzUzAzMDIzQXBgcjEzMyNjQmIgcGBwYVIyY1JicmIyIGFBY7ARYVIyYnLgE1ND4CMh4CFRQGJzQ1NjMyFhQGKwIiJjQ2MzIXFhcTFjI2PwE2LgEGDwEGFiUeATMyNz4BLwEuAQ4BFwEXFjI+ASYvASYOARYTBw4BFxYzMj8BPgEuAQUnJg4BFh8BFjMyNzYmAzI/AT4BLgEPAQ4BFx4BAfM7a1ItNjELBwoLBwEgCAoKBwsyNS1Sa0L6+qFIA0LHJQM4AygZJCQzExcGAUsBBREUIBklJRknAzgDJSsvJ0hdaF1JJi+GBx8KDg8JuyYKDw8KEgoHAs4CCgoCQAMGDg4DQAMG/uoCCgUDBAcGAzwDDg4GA/7vlQIKCgUGB5QHDgYFnJUHBwMFDQQClgcGBQ8DNJUHDgYGB5YEAQwFAwWjBAOVCAYGDgeWBwYDAQoCfitSazpCcykIFiA4hgcLCweHOCAXCClxQjprUiv9F2EBJ/7+lhQfYwECJjMlEBMlAw4ICR8UFyY0JmOfYR8iZjkzXUcmJkddMzljggYFKQ8VEBAWEA8LEAFFAQYFlAcPBgYHlAgOBwUHAgIPB5UIBgYOB/7dQAEGDA4DQAMGDg7+zDwCDggLATwDDg4GQT8DBg4OA0ABCwcPATIBPAMODgYDPAMNCAUGAAABAAAAAAI8Ae0ADgAXQBQAAQABAUcAAQABbwAAAGY1FAIFFisBFA8BBiIvASY0NjMhMhYCOwr6CxwL+gsWDgH0DhYByQ4L+gsL+gscFhYAAAb////BA+gC+wAYADYAPwBIAIMAwQCBQH5lAQMAs1YCCwMCRwANDwwMDWUACwMJAwsJbQAJBAMJBGsACAAPDQgPYA4BDAAKAAwKYQAAAAMLAANgEAEEAAcGBAdgAAYABQIGBWAAAgEBAlQAAgIBWAABAgFMODe7uaOioZ2cm4uJa2lcWk9NRkVCQTw7Nz84Pz0uODERBRgrASYrASIGBwYHBhUUFjMhMjY1NCcmJyYnJhMUBw4BJyEGJicmNTQ3Njc2Nz4BOwEyHgEXFhceASUiBhQWMjY0JhcGIiY0NjIWFAEmJy4BIyIHBgcGFwcVHgEXFjMyNz4BNzY3Nj0BNDc+ATMyFxYXHgEdARQXHgEXFhcWFxY3Njc2NzU0BxQHBgcGIycmJyYnJj0BNCYnJicmLwEmLwEmByMiBwYHDgIdARQOAQcGBwYnJic1NyY3PgEzMhcWFx4BFQJdMTcBUIUvJxQSKiUCBSUrFBYpHyImggQEDAT9+wUMBAQRDyYhLhtEJwEmRDUUEhAlIP7mRF9eiV9hCiBZQD9bPwFZLklLsGCSd3Q4MwEBAgwNGzYSBjU4CwcCAgYUhU1APzceDg4BAg8NDxgbIkUiDAgGATcCAwYNHBE9DwQBARsXFB8dHQ0dDy8HDwolEyQlLUspAQQGEzUuDQgEAQEiMtOKwoA2JBUYAgcVVVFAUkxBRlBQRUhMUkExICX+Yx0YFRcCARYVGB49Q0BENyUWGBgrFxYcP4nbX4leX4Zh8CA/Wz8/WwHdMBocHSAgOTM/EicQJw8cAQcdGBAQDRkLBgYUHAoJDggNBggbDBEiCgsJCQQIIgwXExE4OUofDxMHCwEGFAUOCBkJFiQNCwkIBQIDAQQBAQICBQUdKh0LEQ0SBhEFBA4KGSMUKSIyODQVHBAqFwAE////sQOhAwsAAwAMABUAPQBZQFYNAQECFwEGAQJHAAMECQQDCW0IAQYBAAEGAG0ACgAEAwoEXgsBCQAFAgkFYAACAAEGAgFeAAAHBwBSAAAAB1gABwAHTDw6MzAtKxMzKRMTIREREAwFHSsXITUhNSE1IyImPQEhATQuAQ4BFj4BNxUUBgcjFRQGIyEiJic1IyImNzU0NhczETQ2MyEyFh8BHgEHFTMyFtYB9P4MAfRZFiD+mwKDFCASAhYcGEYMBn0gFv3oFh4BfQcMAUArJCAVAXcXNg9VDxgBIy0+B4/W1iAWWf53DxQCGBoYBBAR6AcKAVkWICAWWQwG6CxAAQEwFiAYDlUQNhaPPgAAAAIAAP/5A6EDUgApAFcARUBCAAgBCG8ABAUGBQQGbQAGAwUGA2sAAQACBwECYAAHAAUEBwVgAAMAAANUAAMDAFgAAAMATFNRTUslJRw1KSUzCQUbKwEVFAYjISImNRE0NjczMhYHFAcGBwYrASIGBxEUFhchMjY9ATQ3Njc2FhMHBiMiJyY9ASMiBwYXFg8BIi8BLgMnND4HNzM1NDc2MzIfARYUAxJeQ/4wQ15eQ44HDAEPKx8FBD4lNAE2JAHQJTQKEA8IF4TWCg8HBxZZtUBCGQINBwkFDAYgGBIBBAwSJChATGY7WRYHBw4L1gsBKpBDXl5DAdBCXgEMBg8DDxMCNCX+MCU0ATYkdwsFBw4JCgEK1gsDCRhrSU27DQYBBxEJPDJOHRswNC4sKBwaCAJrGAkDC9YKHgAAAAACAAAAAAPoArkAIwA3AClAJhsSCQMFBAFHAQEABABvAAQFBG8ABQIFbwMBAgJmJScUHBQWBgUaKwE3NjQvASYiDwEnJiIPAQYUHwEHBhQfARYyPwEXFjI/ATY0JwEHIyIGHQEUFjsBFxY3NjURNCcmA1iBDw8jDykPgYEPKQ8jDw+BgQ8PIw8qDoGBDykPIw8P/aPgXSMcHSJd4BcPExMPAV6BDyoOJA4OgoIODiQOKg+BgQ8qDiQODoKCDg4kDioPAcyvHCK8IhyvEAQEIQJkIQQEAAMAAP/HA+gC9QAPAB8AMwAkQCEYEQIBAAFHAQEARRkJCAMBRAAAAQBvAAEBZiooIyECBRQrAQcWFxYUBwYHFzY3NjQnJgUHFhcWFAcGBxc2NzY0JyYlByMiBh0BFBY7ARcWNzY1ETQnJgMwdUUmKCgmRXVWMDIyMP7neSkaHBwaKXk5IiMjIv7W4F0jHB0iXeAXDxMTDwL1ZDlOUbZRTjlkTWhr7mtoWmgSJCZYJiMTaCs9QY5BPYavHCK8IhyvDwMFIQJjIQQEAAAAAAIAAP9qA+gDUgAcACkAPkA7AgEABBoZGAMCAAJHHBsCAkQAAQAEAAEEYAUDAgACAgBUBQMCAAACWAACAAJMHh0kIx0pHikpGRAGBRcrJSMnPgE1NCcmJyYiBwYHBhQXFhcWMzI2NxcVATcBIi4BND4BMh4BFA4BAsotEiwwMzFUV8pXVDEyMzFUVmVFfC8SAR1W/YtGdkVFdox2RkV33RIvfEVlVlQxMzMxVFbKV1QxMzAsEi3+4lYBHUV3jHZFRXaMdkYAAAAABAAA/6gD6AMUAAMAFwAbACQAVkBTAAABAG8AAQIBbwAICQcJCAdtAAcDCQcDawUBAwYJAwZrCgECAAkIAglgAAYEBAZSAAYGBFYABAYESgYEIyIfHhsaGRgSEA8ODQsEFwYXERALBRYrEyEVIQUhIgYVERQWOwEVITUzMjY1ETQmASERISUUBiImNDYyFvoB9P4MArD8lRolJRq7AfS8GiQk/uz+iQF3AQgbJhoaJhsDFH0/JBr+xxok+/slGQE5GiT9jwE52hMaGiYbGwAAAAIAAP/6A+kCwwAjACYAH0AcJiUkAwIAAUcAAQABbwAAAgBvAAICZj8hFQMFFysBJicmJyYnJiciBwYHDgEHBhQXFhcWFxYXFjMWNzY3PgE3NjQBEQUD4AMPEBkeJra1yaYiHhohAwkJAxARGh0jubfGpCIdGyIDCP2PATgCGyQgJRYZAQ0BDgQbGEgjaZVpIyMmGBwEDAENBhsZSCJpnv77AWe0AAAAAAEAAP+xA2QDCwA1AB1AGjUsIxoRCAYAAQFHAAEAAW8AAABmKSY7AgUVKwEeAQ8BDgEvARUUBgcjIiY3NQcGJi8BJjY/AScuAT8BPgEfATU0NjczMhYdATc2Fh8BFgYPAQM7Gg4OIw86GZUqHUcdLAGUGjoOJA4OG5SUGhAPJA84G5QqHkcdKpUaOBAjDxAZlAEIDjoaPRoODlWrHSoBLByrVQ8QGT0aOg5WVg46Gj0aDg5Vqx0qASwcq1UPEBk9GjoOVgACAAD/+QOgAwsALQBCAE5ASzsBBAYlAQUEAkcABwECAQcCbQAGAgQCBgRtAAQFAgQFawAFAwIFA2sAAQACBgECYAADAAADVAADAwBYAAADAEwUFxUnNTk1MwgFHCsBFRQGIyEiJjURNDY3ITIXHgEPAQYjJyYjISIGBxEUFhchMjY9ATQ/ATYzMhcWEwEGIi8BJjQ/ATYyHwEBNjIfARYUAxJeQ/4wQ15eQwHQIx4JAwcbBgcFDQz+MCU0ATYkAdAlNAUkBgcDBAuB/jkNJA7wDg49DiQOkwFpDSQOPg0BS7FDXl5DAdBCXgEOBBMGHAUBAzQl/jAlNAE2JI0IBSMGAgQBBf46Dg7wDSQOPg0NkwFpDQ09DiQAAv/9/7EDXwMLABAAHQArQCgAAwQBAAEDAGAAAQICAVQAAQECWAACAQJMAQAbGhUUCQgAEAEQBQUUKwEiDgMeAj4DNC4CARQOASIuAj4BMh4BAa1JhGA4AjxciI6GXjo6XoYBZXLG6MhuBnq89Lp+AsM4YISShF48BDRmfJp8aDD+n3XEdHTE6sR0dMQAAAAAAwAAAAADEgHtAA8AHwAvACJAHwUDAgEAAAFUBQMCAQEAWAQCAgABAEw1NTU1NTMGBRorExUUBicjIiYnNTQ2NzMyFgUVFAYnIyImNzU0NjczMhYFFRQGJyMiJj0BNDY3MzIW1h4XaxceASAWaxYgAR0gFmsWIAEeF2sXHgEfIBZrFiAgFmsXHgG3axYgAR4XaxceASAWaxYgAR4XaxceASAWaxYgAR4XaxceASAAAAADAAD/+QDXAwsADwAfAC8ALEApAAUABAMFBGAAAwACAQMCYAABAAABVAABAQBYAAABAEw1NTU1NTMGBRorNxUUBgcjIiYnNTQ2FzMyFgMVFAYnIyImJzU0NjczMhYDFRQGKwEiJic1NDY7ATIW1h4XaxceASAWaxYgAR4XaxceASAWaxYgAR4XaxceASAWaxYgmmwWHgEgFWwWIAEeAQZrFiABHhdrFx4BIAEIaxYgIBZrFiAgAAAAAv/9/7EDWQNSACgANAAnQCQAAwIDbwACAQJvAAEAAAFUAAEBAFgAAAEATDMyLSwaGRQEBRUrARQOAiIuAjc0Njc2FhcWBgcOARUUHgIyPgI3NCYnLgE+ARceAQERFAYiJjcRNDYyFgNZRHKgrKJuSgNaURg8EBIIGDY8LkxqdGhQKgE8NhcKJDwXUVr+myo6LAEqPCgBXleedEREdJ5XZrI+EggYFzwRKXhDOmpMLi5MajpEdioSOjAIEj20AUj+mh0qKh0BZh0qKgAAB//6/7ED6gLDAAgASgBYAGYAcwCAAIYAe0B4d3ZAPgQJCHhtbGhnQi0HBQmDeSoDAQCGgHonEgUKBIIVAgsKBUcABwYIBgcIbQACCwMLAgNtAAYACAkGCGAACQAFAAkFYAAAAAEEAAFgAAQACgsECmAACwIDC1QACwsDWAADCwNMZmRfXVhWKhooKCcrGhMQDAUdKwEyFg4BLgI2FwUWBg8BBiInJQcGIxYHDgEHBiMiJyY3PgE3NjMyFzY/AScmJwYjIicuAScmNjc2MzIXHgEXFgcfASU2Mh8BHgEHBTYmJyYjIgcGFhcWMzIDPgEnJiMiBw4BFxYzMhMXNTQ/AScHBg8BBiMfAQEnBRUHHwIWHwEFNyUHBgcCGA4WAhIgEgQaswEbEAUQSAcTB/5/PgQDCAIENi9KUEwwMwcENi5KUS4mBQhERAgFJi5RSi42BAMWGS9NUEouOAMCCAc+AYEHEwdIEAUQ/WkaHC00NyoVGhwtMzgpGS0cGhYpODMtHBoVKjeXNhIILA8BBAkBAXg2AZpH/lNZBQQGBAIPAeJH/t5jAQYBXhYcFgISIBIi3gsoCCQEBNgkAxwaK1AdLywvRSpQHS8SCAUoKQUHES8eTishPBYsLx1OLBsbAyXYBQQkCScMTRhKHCEUGEgeIf51HEoXFCEcShcUAXchBxQLBBoOAgQJAYISAUEk8EA1BQMHBQEPsiPkTQICAAAAAAQAAP9qA+gDUgAIABgAGwA3AE5ASxIKAgQDMgECBBsBBQIDRwAHAQABBwBtAAgAAwQIA2AABAACBQQCXgAFAAEHBQFgAAAGBgBSAAAABlgABgAGTDUjNRMXJBMhEAkFHSsFIREjIiYnNSM3NTQmJyEiBhcVFBY3ITI2EzMnBREUBgchIiYnNSEiJicRNDY3ITIWBxUWHwEeAQGtAfTpFh4B1o4KB/53BwwBCggBiQcKj6enAR4gFv3pFx4B/tEXHgEgFgJfFiABDAjkEBZPAWYeF+ihJAcKAQwGJAcMAQr+kafu/okXHgEgFlkgFQLuFx4BIBa3BwjkDzYAAAQAAP+xA1kDCwADACEAMQBFAFFATisqIyIECAQBRw0BBAYBCAJGAAoHAQQICgRgAAgAAwYIA2AABgABAAYBXgUCAgAJCQBSBQICAAAJWAAJAAlMQD04NRcmMxETOxEREAsFHSsXITUhBTMRNCYvAS4BBxUUBiMhIiYnNSMRMzU0NjMhMhYHAzU0JisBIgYXFRQWNzMyNgURFAYjISImJxE0NjMhMhYfAR4B1gGt/lMB9EgMBZ0FHAgeF/6+Fh4BSEggFQHRFiAB1goIawcMAQoIawcMAWQeF/0SFx4BIBYCBRc2D5wQFgfW1gH0CBoHnAYMAegWICAW6P026BYgIBYBHrIICgoIsgcMAQoK/foWICAWAu4WIBgOnQ82AAAAAAP/+f+xA6kDCwBRAGEAcQBUQFE4AQUBUAEEBQ8NDAMCBgNHAAYHAgcGAm0AAgMHAgNrAAEABQQBBV4ABAAHBgQHYAADAAADVAADAwBYAAADAExubGZkXl1WVUtIRUI9OjUIBRUrARYHAw4BByEiJicmPwE2NzQmNTY/AT4BNzYmNj8BPgE3NiY3Nj8BPgE3NCY+AT8CPgE/AT4CFxU2MyEyFgcDDgEHISIGFxYzITI2NxM2JxYFBhYXITI2PwE2JichIgYPAQYWFyEyNj8BNiYHISIGBwOTFgyaCkAl/f0rUA8ODQEBAgQBBBINGAUCBAQHCgwWAwEEAgIKDQoaAwQCCAYKCQUGBgsFFBQQFQcBqSkuDZkUKDT+Gw8MBQ5DAgMQHgWnBAEV/boCBggBUwgOAgwCBgn+rQcOAjoDCAcBUwcOAwsDCAf+rQcOAwJHHyn+ByQwATwsJSIPDQcFDgQGBhoVPBUGFgsJDRQ+FAUYBAcKDQ5CFQQUCQwHCxEKFAoSCAoCBAEFQCj+BkImAREPJxIOAiYNEwgRBwoBDAYkBwoBDAazBwoBDAYkBwwBCggAAAAD////9gR3AsMAEAAhADYAJ0AkAAUCAQABBQBgAwEBBAQBVAMBAQEEWAAEAQRMNzglKBcUBgUaKwE0LgIiDgIUHgIyPgIlNC4CKwEeAQ4BBzMyPgI3FA4CJyEiLgM+AjchMh4CAoMuTGp0akwuLkxqdGpMLgGsLE5oO9hDTgJKRdg6akwuRzpehkf+U0iEYDgCPFyIRgGtSIRgOAFeOmpMLi5ManRqTC4uTGo6OmpMLjKWrJYyLkxqOkiGXD4DOGKAloBkNAI4YIQAAAACAAD/9wR4AsMAFAAlACpAJwAAAAMCAANgBAECAQECVAQBAgIBWAABAgFMFhUeHRUlFiU3NAUFFisRND4CMyEyHgMOAichIi4CBTI+Ai4DIg4DHgI6XoZHAa1IhGA4AjxciEb+U0iEYDgDETpqTC4CKlBmeGZQKgQySG4BXkmEYDg4YISShF48AjhigNMuTGp0akwuLkxqdGpMLgAD////sQOhAwsABgANAB0AOUA2BAEAAQFHAAUCAQEABQFeAwYCAAQEAFQDBgIAAARYAAQABEwBABwZFBELCgkIAwIABgEGBwUUKxchESERFBYlESERITI2ExEUBgchIiY3ETQ2NyEyFlkBVP6aDAMG/psBUwgKSDYk/RIkNgE0JQLuJTQHAoP9jwcMEwJx/X0KAq79WiU0ATYkAqYlNAE2AAAAAAr////5A6EDCwAPAB8ALwA/AE8AXwBvAH8AjwCfAHpAd4mBaWE5ODEHBwZ5cUlBGREGAwJZUSkhCQgBBwEAA0cAExAMAgYHEwZgEQ0CBw4IAgIDBwJgDwkCAwoEAgABAwBgCwUCARISAVQLBQIBARJYABIBEkyem5aTjYuFg317dXNta2VjXVtVU01LJiYmJiYmJiYjFAUdKyU1NCYrASIGBxUUFjsBMjY9ATQmKwEiBgcVFBY7ATI2BTU0JisBIgYdARQWOwEyNgE1NCYrASIGBxUUFjsBMjYFNTQmKwEiBh0BFBY7ATI2BTU0JisBIgYdARQWOwEyNgE1NCYrASIGHQEUFjsBMjYFNTQmKwEiBh0BFBY7ATI2PQE0JisBIgYdARQWOwEyNjcRFAYjISImNxE0NjchMhYBHgoIswcKAQwGswgKCgizBwoBDAazCAoBHQoHswgKCgizBwr+4woIswcKAQwGswgKAR0KB7MICgoIswcKAR4KCLIICgoIsggK/uIKB7MICgoIswcKAR4KCLIICgoIsggKCgiyCAoKCLIICkg2JP0SJDYBNCUC7iU0UmsICgoIawgKCt5sBwoKB2wHCgrPawgKCghrCAoKAbVrCAoKCGsICgrPbAcKCgdsBwoKz2sICgoIawgKCgG1awgKCghrCAoKz2wHCgoHbAcKCt5rCAoKCGsICgq6/aElNDQlAl8lNAE2AAP//f+xA18DCwAIABUAIgA8QDkAAQIAAgEAbQAAAwIAA2sABQYBAgEFAmAAAwQEA1QAAwMEWAAEAwRMCgkgHxoZEA8JFQoVExIHBRYrARQGIi4BNjIWJyIOAh4BMj4BLgIBFA4BIi4CPgEyHgECO1J4UgJWdFaQU4xQAlSIqoZWBE6OAVtyxujIbgZ6vPS6fgFeO1RUdlRU9VKMpIxSUoykjFL+0HXEdHTE6sR0dMQABQAA/7EEdwMLAAMABwANABEAFQBmQGMABQoFbw8BCgMKbwwBAwgDbw4BCAEIbwsBAQABbwkHAgMABgBvDQEGBAQGUg0BBgYEVgAEBgRKEhIODggIBAQAABIVEhUUEw4RDhEQDwgNCA0MCwoJBAcEBwYFAAMAAxEQBRUrAREjEQERIxEBFSERMxEBESMRJREjEQFljwFljgLK+4lHAsuPAWWPAV7+4gEeAR79xAI8/X1IA1r87gH0/lMBrdb9fQKDAAAAAAIAAP+xBHcDCwAFAAsANEAxCwoJAwMBAUcAAQMBbwADAgNvBAECAAACUgQBAgIAVgAAAgBKAAAIBwAFAAUREQUFFisFFSERMxEBEyEREwEEd/uJRwNajvxg+gFBB0gDWvzuAjv+DAFCAUH+vwAAAAAD//7/sQPEA1IACwAQABYALkArAAECAxABAgACAkcABAEEbwABAwFvAAMCA28AAgACbwAAAGYRFBEVIwUFGSsJAQ4BByIuAj4BMxMhFAYHEyERMh4BAa0BMDueV3XGcAR4vnloAa9CPVz+U3XEdAFh/tA9QgF0xOrEdP5TWJ47AXgBrXLGAAAAAgAA/7EEdwMLAAUAHwBLQEgYCwIEBRcSEAMDBBEBAgMDRwABBQFvAAUEBW8ABAMEbwADAgNvBgECAAACUgYBAgIAVgAAAgBKAAAdGxUUDg0ABQAFEREHBRYrBRUhETMRARUUBi8BAQYiLwEHJwE2Mh8BAScmNjsBMhYEd/uJRwPoFApE/p8GDgaC6GsBRwUOBoIBA0MJCA3zBwoHSANa/O4CuPIMCglE/p8GBoLpbAFGBgaCAQNECBYKAAAB//v/rQNeAxAAQQAaQBc9ODMuKSQfGRMLBQsARQAAAGYREAEFFCsBFxYGDwEXFgcGLwEHBgcGIyIvAQcGJyYvAQcGJyY/AScuAT8BJyY2PwEnJjYfATc+AR8BNzYWHwE3NhYPARceAQcDAE0RDRZpHgYREBdoGwUXBwQRC0tMDxgXBRtoFxARBx1pFg0RTU0RDRZpHQchF2gbBS4QTEsQLgUbaBchBh5pFg0RAV5LEC4GG2cXEBIHHmkXBwENTU0RBQcXaR4HEhAXZxsGLhBLSxAuBhtnFyIHHWgXDRJNTREMF2gdByIXZxsGLhAAAAAEAAD/zgPUAu4ACAAQABgAIABbQFggHRwDBQQUAQIFGBUMAwMCEA0CAAMERwAGAAcEBgdgAAQABQIEBWAAAgADAAIDYAgBAAEBAFQIAQAAAVgAAQABTAEAHx4bGhcWExIPDgsKBQQACAEICQUUKyUyFhQGIiY0Nic2MhcHJiIHJzYgFwcmIAcnNiAXByYgBwHqKjo6Ujo6qlj0WEY6pDrSkgGakEZ0/rp20swCPspGrv4UrpY8Ujo6UjxwWFhIOjrUlJRGdnbUzs5GsLAAAAAAAgAA//kDEwMLAA8AHwArQCgAAwQBAAEDAGAAAQICAVQAAQECWAACAQJMAgAeGxYTCgcADwIPBQUUKwEhIgYHERQWFyEyNjURNCYXERQGIyEiJjURNDY3ITIWAnH+MCU0ATYkAdAlNDR8XkP+MENeXkMB0EJgAsM0Jf4wJTQBNiQB0CU0Wf4wQ15eQwHQQl4BYAAAAAQAAP/5A1kC5wAJABEAGgBFAGVAYjoBAgMuHAIGCQJHDAELBAEDAgsDYAUPAgIAAAJUDQoCAAkJAFQOAQkIAQYBCQZgAAEHBwFUAAEBB1gABwEHTAsKQ0JCQT48ODYzMjIwKikmIyAeGRcVFA4NChELETMREAUWKyURIxEUFhczMjYDMycmIgYeASU0JgYPATMyNhcVFAYrARUUBgchIiY9ASMiJj0BNDY7ASImNDY3Mh8BNzYzMh4BBiczMhYCBrMUEGsQFP9tRg8uIAIcAZgeLw9FbBYg0QoINSAW/aEWIDUICgoI9TNKSjM8IkhHIjw0SAJMMvUICl0BkP5wDg4BEAHkWhEeLh41FiABEVogebMHCukWHgEgFekKB7MICkhqRgIrXFwrSmZMAgoAAAAC////sQQvA1IADwAvADVAMgkBAgEAIAEDAgJHAAMCA3AABQAAAQUAXgABAgIBVAABAQJYBAECAQJMNSY2JiYUBgUaKwERNCYnISIGBxEUFjMhMjYTERQGByEUHgEXFAYjISImJzQ+ATUhIiY3ETQ2MyEyFgPoCgj8gwcKAQwGA30HDEY0Jf7REhABFA/+4g8UARIS/tAkNgE0JQN9JTQBKAHRBwoBDAb+LwcKCgHY/aElNAEULiIHDhYWDggiLBU2JAJfJTQ0AAT////5BC8CwwAPAB8AKgAyAFVAUhkRAgIDAUcAAQADAgEDXgACCAEABAIAYAkBBAAHBgQHYAoBBgUFBlQKAQYGBVgABQYFTCwrISABADAtKzIsMSckICohKh0cFRMJBgAPAQ4LBRQrNyImNRE0NjMhMhYXERQGIwERFBY3ITI2NRE0JichIgYBMxUUBgchIiY3NQUyNCsBIhQz6CU0NCUCXyU0ATYk/Y8MBgJfCAoKCP2hBwoC/1k0JfyDJDYBAkQJCVkJCYg0JQGJJTQ0Jf53JTQB4v53BwwBCggBiQcKAQz99DYWHgEgFTY2EhIAAAP////5AoQDCwAIABgAKABeQAwSEQoDAgEAAQMAAkdLsAxQWEAeAAMAAANkAAQAAQIEAWAAAgAAAlQAAgIAWAAAAgBMG0AdAAMAA3AABAABAgQBYAACAAACVAACAgBYAAACAExZtzU2JikSBQUZKyU0LgEOARY+ATcRNCYjISIGBxEUFjMhMjYTERQGIyEiJjcRNDY3ITIWAWUUIBICFhwY1AoH/i8HCgEMBgHRBwpINCX+LyQ2ATQlAdEkNkAPFAIYGhgEEGsCFwgKCgj96QgKCgIf/aElNDQlAl8lNAE2AAAAAAQAAP/5Aa0CwwAIABgAIQAxAEJAPxIKCQMDAgABAQACRwAHAAQFBwRgAAUAAgMFAmAAAwAAAQMAYAABBgYBVAABAQZYAAYBBkw1NDE0JiUTEggFHCslNCYiDgEeATY3ETQmIyEiBhURFBYzITI2AzQrASIUOwEyNxEUBiMhIiY1ETQ2MyEyFgEDGiYYAhwiHnIKCP7iBwoKBwEeBwxsCVkJCVkJoSwc/uIdKiodAR4dKkATGhomGAIcawGICAoKCP54CAoKAeEJEhL9xB0qKh0CPB0qKgAAAAEAAAAAANwBzAAIACBAHQIBAAEBAFQCAQAAAVgAAQABTAEABQQACAEIAwUUKxMyFhQGIiY0Nm4uQEBcQEABzEBaQkJaQAAAAAH//wAAAnEClwAIABhAFQIBAAEAbwABAWYBAAUEAAgBCAMFFCsBMhYQBiQmEjYBOYK2tv78uAK0Ape4/v64ArQBBrQAAgAAAAADjwKtAAoAFQAtQCoEAQADAG8HAQMCA28GAQIBAQJUBgECAgFYBQEBAgFMEhETERIRExAIBRwrEyERFAYnNTI2JyMBIREUBic1MjYnIxIBT8SLXIQB3wIuAU/Ei1yEAd8Crf6yjMQBb4JeAU7+sozEAW+CXgAAAAIAAAAAA48CrQAKABUAL0AsBwEDAgACAwBtBAEAAG4FAQECAgFUBQEBAQJYBgECAQJMEhETERIRExAIBRwrJSERNDY3FSIGFTMBIRE0NjcVIgYVMwOP/rHGiV2C3/3S/rHEi12C3xABT4vCAW+EW/6xAU+LwgFvhFsAAAAB/+D/YgLAA1YAMgAhQB4SAQABAUctJggGBAUARAABAAFvAAAAZhkYFxYCBRQrFwYnJjc2NyY3HgI2LgE3PgE3DgEWFzI2NzYWFxYGBw4BBwYXFjcOAgcGFjcOAwc8BhQSAgQuZDAKLCwSEAYcFnQuGBIKEAyQIi6IDgwYHCzMDBAcNno4oGgCBGowHkIqbh6KFAwIGmR+mqIgXEQInq5GLGQULmA8AvACBEIgGG4cLCQGChgwHFBECAYYPBA4OA4IBAAABAAA/28DQgNNAAsAFQAgACkAS0BIEQYCBUQHAQEGAQAEAQBgCQEECAECAwQCYAADBQUDVAADAwVYAAUDBUwiIRcWDQwBACYlISkiKRwbFiAXIAwVDRUACwELCgUUKwEiBwYUHwE3NhAnJicyFhIHCQEmEDYTIgYUFxYyNzY0JicyFhQOAS4BNgGggF1bW93fWlpdgq7yAnv+2f7be/aqNE4nJmwmJ042S2xslmoCbgLlWlj+WdvbWAEAV1po8P6seP7eASJ4AVTw/uJOaiclJSdqTjRqmGoCbpRuAAMAAAAAArwCWAALABcAIwBCQD8AAwcBAgADAmAGAQAAAQQAAWAIAQQFBQRUCAEEBAVYAAUEBUwZGA0MAQAfHBgjGSITEAwXDRYHBAALAQoJBRQrATIWFAYjISImNDYzNSImNDYzITIWFAYjETIWFAYjISImNDYzAooWHB4U/agUHhwWFB4cFgJYFhweFBYcHhT9qBQeHBYBkB4oHh4oHmQeKB4eKB7+1B4oHh4oHgAAAf/9AAACnwLAABMAFUASCQEARQEBAABmAQAAEwESAgUUKzMiLwEmPgEWHwEBPgEXHgEHAQYj+SIWtBAILDoSdgEoEDYaGAwO/qIUJBzsGDgkCBiaAdoYDA4QNhr90CAAAQAAAAAB1gJiAB0AHkAbHRYOBgQAAgFHAwECAAJvAQEAAGYUGhQTBAUYKyUWFAYiLwEHBiInJjQ/AScmNDc2Mh8BNzYyFhQPAQHEEiQyEoSEEjISEBCKihAQEjIShIQSMiQSisISMiIQmJgQEBIyEpyeEjISEBCYmBAiMhKeAAAB//H/ngLvAx4AKgAGsxgHAS0rNz4BNxYXNjceBBc+ASceBA4BBzYCJxYGBzYmLwEGBw4BFhcuAQcKUAQnBpQGCh5WPjwEDwgNDzQ8NAocdF5ATnMKKiwHBgkKDDAaGggah1zuKbQ4SEm49AYWRFBwPiRWJQw2YGaGeIY1gQEqUCvEND9OFBFGRiY+YjhMnAADAAD/agLBA1IAHwA5AGQAP0A8YF1bWFVKRUJAPTYyMC0rFRENCwUUA0UAAwIDbwACAQJvAAEAAAFUAAEBAFgAAAEATGRjT04kIh4cBAUUKzU0PgEmJxceAxc2NxceAQc3PgEnFhIHDgMHIiY3FBYXMj4DNzYnBgc0JicGBzQuAScWBwYXND8BFxYXPwEVFBc+Aj8BFxYHBiMiJyY3NicGDwEnJicPAScmJwYVFCIkHgQfFBNAQEIPPwIfHUABDxAiAWBOHQ4iTohlibA/inBKbDwmEAYnZz1UFA8XWhhAKwgpHzIpEBATLzEvFyc6HBYbBhUpBAkEAg4GGwg6YA8GGAQ6EAwrFRkgh0y2gtJ1Dg0+THY7XlwjJIxFFBVOJHf++HUzQkYeAqpzWIYBFh42IiCfuWdFXKgdOn8IVp46fbmPaZJ1Lyk4bEpLNUJFFCoeGR4gd2MKAgYNSV9CLwYQQi1UFRdiM1SFEAAACgAA/2kD6QNSACUAMwBBAFYAZAByAHoAjQCjAKgCTUuwClBYQCiAARcVkwEWCVABGBY8CgIUD187AhIUqG1rXgQAEi8uJyYjGgYEBQdHG0uwC1BYQCiAAQkVkwEWCVABChY8CgIUD187AhIUqG1rXgQAEi8uJyYjGgYEBQdHG0AogAEXFZMBFglQARgWPAoCFA9fOwISFKhta14EABIvLicmIxoGBAUHR1lZS7AKUFhAXgASFAAAEmUAFQAWGBUWYAAXABgKFxhgAAkACgEJCmAAAQAIBwEIYAAHAA0MBw1gAAwAEA8MEGAADwAUEg8UYBkTEQ4LBgIHAAAFBAAFYQAEAwMEVAAEBANYAAMEA0wbS7ALUFhAWAASFAAAEmUAFQAWChUWYBcBCRgBCgEJCmAAAQAIBwEIYAAHAA0MBw1gAAwAEA8MEGAADwAUEg8UYBkTEQ4LBgIHAAAFBAAFYQAEAwMEVAAEBANYAAMEA0wbS7AnUFhAXgASFAAAEmUAFQAWGBUWYAAXABgKFxhgAAkACgEJCmAAAQAIBwEIYAAHAA0MBw1gAAwAEA8MEGAADwAUEg8UYBkTEQ4LBgIHAAAFBAAFYQAEAwMEVAAEBANYAAMEA0wbQF8AEhQAFBIAbQAVABYYFRZgABcAGAoXGGAACQAKAQkKYAABAAgHAQhgAAcADQwHDWAADAAQDwwQYAAPABQSDxRgGRMRDgsGAgcAAAUEAAVhAAQDAwRUAAQEA1gAAwQDTFlZWUAupaSioJeVjYuDgnp5eHd2dXRzcW9paGZlY2FcWlhXVFJLSSUiETQ5OCsiIhoFHSs1NDY3Mz4BMzIWFzc2HgEGDwEWFzMyFgcUDwEVFAYnISImJzUnJjcXFRQzITI9ATc0IyEiNzM+ATMyFhc3LgEjIgY3Jjc2JyM1NDMyFxYHBhcVFCMiJzUTMz4BMzIWFzcuASMiBhczPgIWFzM3LgEHIgYXMzYyFzMmIhM1Jjc2JzU0MhcWBwYXFhUUIyIXNSY3Nic1NDMyFxYHBhcVFhUUIyInEzM0JjUuIFQWvn5mqCqPDBgKBg2WBAJUIS4BEG0sIv2uISwBbRA/fQ8CUg99D/y0D4IiFZhkVIoiGyWYXm+uIRAgGQwCEAoEER8ZDQ8KBAghFHJLQmwZHiB6S1aGLCESTl5OEgUYFlw6PV4wJR1SGycljCcQHRwOGgMSHxoMAhAJmhAgGQ4QCgQRHxoMAg8KBJ4SAnQhLAF5oG5ZRgYIGBYHTAsKLiAYEXsYIS4BLCIYexEYjS8QEC+NDz9ffFxKD1JkkLknSj0dBg8JKUk+HQQQCAL+3URYSDsOQlJoUysyAjYpCzNAAUY3Hx8+AW8CJ0s8HgUQCilIPx0CAg9/AidIPhwGDwkoSjweAgIBEAr+2QIEAgAAAAAFAAD/TwPFA1IAFQAvADYAQwBTACBAHVNMS0M+PTYxLwoCAQwARSMiCwMARAAAAGYYAQUVKxM3EwcGFxYXFhc3EwcGJyYnJicmNzYXBwYHBhcWFxYXFj8BJwcGJyYnJicmNzY/AR8BNiYnJic3HgIXFgcnNi4CJzcWFx4BFxYHJzYnLgEnJieWdqlyChkYJSYXcKt3XnBmXVoyMwwOrCs/AgEvLUlLTlVBKV8qJi8sKSgXGAQEJiroegcFDBkyJzFRNAUFD0sLCCQ5Iz5MPT9OCAcWTRIGBj8yMT0DGzf+tzgZQj42OQE3/rY7KkE8g3+SmHN/BRUhZl1+eWxwNjweFLcVEx4bOzlARDM4FRWIJBgyFi4Qgw9CXTUzMhYjSUIuC88WMTOPUU5MFz0+QXMpJxIAAAMAAP+cA9YDFQAhACoARABAQD1DQT89PDs6OTg3NTMxLy4tLBESAUQDAQACAG8AAgEBAlQAAgIBWAQBAQIBTCMiAQAnJiIqIyoAIQEhBQUUKwEiBgcGFRQXFhcWFxYXFhcWFzY3Njc2NzY3Njc2NTQnLgEDIiY0NjIWFAYBJQcnBRM3FhcPAT8BBxc3FzcnHwEvATY3FwH0OGMdHwwKFAweIhEcExYLCxYTHBEiHgwUCgwfHWM4IS4uQi8vAcH+89Xg/v6hnxsPjUVrPBmoFBOmGD9tRZARGaIDFTcvMDclIRsdEiMoGCkqNT4+NSopGCgjEh0bISU3MC83/u0vQi4uQi/9mmFhYWEBaUAmIDicKGx6SFFRTHp0KKA4IiRAAAH//wAAAjsByQAOABFADgABAAFvAAAAZhUyAgUWKyUUBichIi4BPwE2Mh8BFgI7FA/+DA8UAgz6Ch4K+gqrDhYBFB4L+goK+gsAAAABAAAAAAFnAnwADQAXQBQAAQABAUcAAQABbwAAAGYXEwIFFisBERQGIi8BJjQ/ATYyFgFlFCAJ+goK+gscGAJY/gwOFgv6CxwL+gsWAAAAAAEAAAAAAUECfQAOAAq3AAAAZhQBBRUrARQPAQYiJjURND4BHwEWAUEK+gscFhYcC/oKAV4OC/oLFg4B9A8UAgz6CgAADwAA/2oDoQNSAAMABwALAA8AEwAXABsAHwAjADMANwA7AD8ATwBzAJ5Am0ElAh0SSS0kAxMdAkcgAR4aARIdHhJgIR8CHRMJHVQbARMZFw0DCQgTCV8YFgwDCBURBwMFBAgFXhQQBgMEDwsDAwEABAFeDgoCAwAcHABSDgoCAwAAHFgAHAAcTHJwbWpnZmNgXVtWU01MRUQ/Pj08Ozo5ODc2NTQxLyknIyIhIB8eHRwbGhkYFxYVFBMSEREREREREREQIgUdKxczNSMXMzUjJzM1IxczNSMnMzUjATM1IyczNSMBMzUjJzM1IwM1NCYnIyIGBxUUFjczMjYBMzUjJzM1IxczNSM3NTQmJyMiBhcVFBY3MzI2NxEUBiMhIiY1ETQ2OwE1NDY7ATIWHQEzNTQ2OwEyFgcVMzIWR6GhxbKyxaGhxbKyxaGhAZuzs9aysgGsoaHWs7PEDAYkBwoBDAYkBwoBm6Gh1rOz1qGhEgoIIwcMAQoIIwgK1ywc/O4dKiodSDQlJCU01jYkIyU2AUcdKk+hoaEksrKyJKH9xKH6of3EoSSyATChBwoBDAahBwwBCv4msiShoaFroQcKAQwGoQcMAQos/TUdKiodAssdKjYlNDQlNjYlNDQlNioABf///7EELwMLAA8AGQAjACcAKwBqQGcWEwICAyAdAgUHAkcKAQALAQMCAANgAAIABAYCBF4IAQYOCQ0DBwUGB14MAQUBAQVUDAEFBQFYAAEFAUwoKCQkGhoQEAEAKCsoKyopJCckJyYlGiMaIh8eEBkQGBUUCQYADwEODwUUKwEyFhURFAYHISImNxE0NjcVIgYHFSE1NCYjETI2JxEhERQWPwE1MxUzNTMVA9YlNDQl/IMkNgE0JQcKAQOhCggHDAH8XwwGNo9H1gMLNiT9WiU0ATYkAqYlNAFICgh9fQgK/TYKCAFT/q0HDAFHSEhISAAAAAIAAAAAAjoBzAAIABEALUAqBQIEAwABAQBUBQIEAwAAAVgDAQEAAUwKCQEADg0JEQoRBQQACAEIBgUUKxMyFhQGIiY0NiEyFhQGIiY0Nm4uQEBcQEABjC5AQlpAQAHMQFpCQFxAQFpCQFxAAAMAAAAAA5gBzAAIABEAGgA6QDcIBAcCBgUAAQEAVAgEBwIGBQAAAVgFAwIBAAFMExIKCQEAFxYSGhMaDg0JEQoRBQQACAEICQUUKxMyFhQGIiY0NiEyFhQGIiY0NiEyFhQGIiY0Nm4uQEBcQEABjC5AQlhCQAGMLkBAXEBAAcxAWkJCWkBAWkJCWkBAWkJCWkAAAAACAAD/uQNSAwMAFwAwADBALSokGwMCAw8GAgABAkcABAMEbwADAgNvAAIBAm8AAQABbwAAAGYUFTk6GAUFGSsBFRQGJi8BBwYiLwEmND8BJyY0NjsBMhYBFA8BFxYUBisBIiY3NTQ2Fh8BNzYyHwEWAa0WHAtRuQUQBEAGBrlQCxYO+g4WAaUGuVALFg76DhYBFB4KUbkGDgY/BgE6+g4WAglRugUFQAYOBrlQCxwWFgFpBwW6UAscFhYO+g4WAglQuQUFQAUAAAEAAP9qAYoDUgAgACFAHgAFAAVvBAEAAQBvAwEBAgFvAAICZhUhJRUhEwYFGisBFAYnIxEzMh4BDwEGIi8BJjQ2OwERIyImNj8BNjIfARYBiRYOR0cPFAIMjwoeCo8KFA9ISA4WAgmPCxwLjwsCnw4WAf3EFB4KjwsLjwoeFAI8FB4LjgsLjgsAAAAAAQAAAAAD6AIRACAAKEAlBQEDBANvAgEAAQBwAAQBAQRSAAQEAVYAAQQBShMTFxMTFAYFGisBFA8BBiImPQEhFRQGIi8BJjQ/ATYyFh0BITU0NjIfARYD6AuOCx4U/cQUHgqPCwuPCh4UAjwUHguOCwFeDguPCxYOSEgOFguPCxwLjwsWDkhIDhYLjwoAAAAAAwAA/2oDrANQAA8AIAAwABRAEQEBAAIAbwACAmYrKh8WAwUWKxMeAhUUBiImNTQ+ATc2MgUeAhUUBiImNTQ+Ajc2MgE2MhUeAhUUBiImNTQ+AagKUEJghGBCUAoCCgJoClBCYIRgKjY0CAIK/sACCgpQQmCEYEJQA0xWimw6Ql5eQjpsilYEBFaKbDpCXl5CMFpCdkQE/kAEBFaKbDpCXl5COmyKAAAAAgAA/34CMAM+ABEAIwAkQCEAAQIBbwACAwJvAAMAAANUAAMDAFgAAAMATCgUGBcEBRgrAR4DFRQGIiY1ND4CNzYyAzYnJiIPAQ4CFRQWMzI1NDcBIg5cXEim5KZIXFwOAhIqAgQGEAQoICAkIhg6KgM2dsp0nFJypKRyUpx0ynYI/nAECgYGOi4wZjIYIkRemAAAAAP/7//sA5sC3AAZADYAVQA2QDMAAwECAQMCbQACBQECBWsABQQBBQRrAAQEbgAAAQEAVAAAAAFYAAEAAUwdLx0sJxoGBRorEwYuATY3PgIeAjY3NhcWBwYjIicuAQ4BBTYWBw4CIyInLgEOAQcGJicmPgMWFx4BPgEXNhcWBgcOAiMiJy4BDgEHBiYnJj4DFhceAT4BVRAoHAQQMD50jrCGQjgmICAmenBkekRmVC4CtCZAJigyXjJgfkRmVC4sDioOIEwsXlKARkRmVC4sJiAOBBAoMl4yYH5EZlQwKg4qDiBMLF5SgEZEZlQuAhYOBB4sDigoKCBkBiYwHiQoIG5GJhwcHpIgTiAiJiZGJhwcHiQOBBAoQiAsAiAoJhwcHtwgJg4sDiImJkYmHBogJA4EEChCICwCICgmHBweAAAAAgAA/5wD6AMgABsAKgA5QDYGAQAFAG8AAQIBcAADBAIDVAAFAAQCBQRgAAMDAlgAAgMCTAEAKCYlIxgWCwkHBAAbARoHBRQrATIVERQrASI1ESMiJyYvASY0PwE2NzY7ATU0MwUWFA8BBiMGIyEnITIWFwGqFBQuFLAQDAwOeAoKeA4MCBSwFAJiCgp2FgQODv7SKAFWEhQQAyAU/KQUFAG4BgIKUgYUBlIKAgS+FNAGFAZSDAbmCAgAAAACAAD/zgH0Au4ADgAXADBALQYBAUQEAQECAXADAQACAgBUAwEAAAJYAAIAAkwQDwEAFBMPFxAXAA4BDgUFFCsTMhYUAg8BLgQ1NDYTMjY0JiIGFBb6aJJ8QD4KIlZCNpJoOFBQcE5OAu6S0v7uVlQMLoSApkJokv58UHBOTnBQAAUAAP/KA+gC9AAbAB8AIwAnACsAIUAeKyopKCcmJSQjIiEgHx4dHBgNCRMARQAAAGYWAQUVKwEWFREUBwYiLwEHBi8BBwYmNRE0PwE2HwE3NhcBEQcRIREnESERBxEhEScRA9gQEAgQCtjYEhDa2BAiEOoSENjaEBD9/KgBkqgBkqoBkqgCWAoU/bgUCgYGiIgKCoiIChQUAkgUCpIKCoiICgr9rAH6aP4GAfpo/gYB+mj+BgH6aP4GAAAAAgAA/7ADXgMOABMAFgAItRYUEgoCLSsBHgEOAgcGAg8BAyUkNz4DFgcBFwNQCAYKChwKNrpAQjb+hAG6/hQ4FhwSVP7QHAMACBAcGDYWcP6kdnYBfDj2egoeCggGaP7o6gAAAAT//P98A8IDQAALABQAIwAsAEJAPyscAgQDAUcABAMCAwQCbQUBAAADBAADYAYBAgEBAlQGAQICAVgAAQIBTA0MAQAoJxEQDBQNFAcFAAsBCwcFFCsBNgAXFgAHBgAnJgATPgECJgQGEhYnPgQ/AQ4CBw4BBxMGFBYyNzY3BgHaxgEcBAL+7MjG/uICBAEW1JzcBOL+xtoE4EwEEEJYojw8BBBCLCqkPHgWKjoUNCSIAz4C/uzGyP7kBAIBFsbIARz8qALgATzaBOD+xNqcGlCwWEAKChpQsCwqQAoBCBQ4LBY0hiQAAAAD//3/sQNZAwsADAG9AfcCd0uwCVBYQTwAvQC7ALgAnwCWAIgABgADAAAAjwABAAIAAwDaANMAbQBZAFEAQgA+ADMAIAAZAAoABwACAZ4BmAGWAYwBiwF6AXUBZQFjAQMA4QDgAAwABgAHAVMBTQEoAAMACAAGAfQB2wHRAcsBwAG+ATgBMwAIAAEACAAGAEcbS7AKUFhBQwC7ALgAnwCIAAQABQAAAL0AAQADAAUAjwABAAIAAwDaANMAbQBZAFEAQgA+ADMAIAAZAAoABwACAZ4BmAGWAYwBiwF6AXUBZQFjAQMA4QDgAAwABgAHAVMBTQEoAAMACAAGAfQB2wHRAcsBwAG+ATgBMwAIAAEACAAHAEcAlgABAAUAAQBGG0E8AL0AuwC4AJ8AlgCIAAYAAwAAAI8AAQACAAMA2gDTAG0AWQBRAEIAPgAzACAAGQAKAAcAAgGeAZgBlgGMAYsBegF1AWUBYwEDAOEA4AAMAAYABwFTAU0BKAADAAgABgH0AdsB0QHLAcABvgE4ATMACAABAAgABgBHWVlLsAlQWEA1AAIDBwMCB20ABwYDBwZrAAYIAwYIawAIAQMIAWsAAQFuCQEAAwMAVAkBAAADWAUEAgMAA0wbS7AKUFhAOgQBAwUCBQNlAAIHBQIHawAHBgUHBmsABggFBghrAAgBBQgBawABAW4JAQAFBQBUCQEAAAVWAAUABUobQDUAAgMHAwIHbQAHBgMHBmsABggDBghrAAgBAwgBawABAW4JAQADAwBUCQEAAANYBQQCAwADTFlZQRkAAQAAAdgB1gG5AbcBVwFWAMcAxQC1ALQAsQCuAHkAdgAHAAYAAAAMAAEADAAKAAUAFCsBMh4BFA4BIi4CPgEBDgEHMj4BNT4BNzYXJjY/ATY/AQYmNRQHNCYGNS4ELwEmNC8BBwYUKgEUIgYiBzYnJiM2JiczLgInLgEHBhQfARYGHgEHBg8BBhYXFhQGIg8BBiYnJicmByYnJgcyJgc+ASM2PwE2JxY/ATY3NjIWMxY0JzInJicmBwYXIg8BBi8BJiciBzYmIzYnJiIPAQYeATIXFgciBiIGFgcuAScWJyMiBiInJjc0FycGBzI2PwE2FzcXJgcGBxYHJy4BJyIHBgceAhQ3FgcyFxYXFgcnJgYWMyIPAQYfAQYWNwYfAx4CFwYWByIGNR4CFBY3NicuAjUzMh8BBh4CMx4BBzIeBB8DFjI/ATYWFxY3Ih8BHgEVHgEXNjUGFjM2NQYvASY0JjYXMjYuAicGJicUBhUjNjQ/ATYvASYHIgcOAyYnLgE0PwE2JzY/ATY7ATI0NiYjFjYXFjcnJjcWNx4CHwEWNjcWFx4BPgEmNSc1LgE2NzQ2PwE2JzI3JyYiNzYnPgEzFjYnPgE3FjYmPgEVNzYjFjc2JzYmJzMyNTYnJgM2NyYiLwE2Ji8BJi8BJg8BIg8BFSYnIi4BDgEPASY2JgYPAQY2BhUOARUuATceARcWBwYHBhcUBhYBrXTGcnLG6MhuBnq8ARMCCAMBAgQDERUTCgEMAggGAwEHBgQECgUGBAEIAQIBAwMEBAQEBgEGAggJBQQGAgQDAQgMAQUcBAMCAgEIAQ4BAgcJAwQEAQQCAwEHCgIEBQ0DAxQOEwQIBgECAQIFCQIBEwkGBAIFBgoDCAQHBQIDBgkEBgEFCQQFAwMCBQQBDgcLDwQQAwMBCAQIAQgDAQgEAwICAwQCBBIFAwwMAQMDAgwZGwMGBQUTBQMLBA0LAQQCBgQIBAkEUTIEBQIGBQMBGAoBAgcFBAMEBAQBAgEBAQIKBwcSBAcJBAMIBAIOAQECAg4CBAICDwgDBAMCAwUBBAoKAQQIBAUMBwIDCAMJBxYGBgUICBAEFAoBAgQCBgMOAwQBCgUIEQoCAgICAQUCBAEKAgMMAwIIAQIIAwEDAgcLBAECAggUAwgKAQIBBAIDBQIBAwIBAwEEGAMJAwEBAQMNAg4EAgMBBAMFAgYIBAICAQgEBAcIBQcMBAQCAgIGAQUEAwIDBQwEAhIBBAICBQ4JAgIKCAUJAgYGBwUJDAppc1ABDAENAQQDFQEDBQIDAgIBBQwIAwYGBgYBAQQIBAoBBwYCCgIEAQwBAQICBAsPAQIJCgEDC3TE6sR0dMTqxHT+3QEIAgYGAQQIAwULAQwBAwICDAEKBwIDBAIEAQIGDAUGAwMCBAEBAwMEAgQBAwMCAggEAgYEAQMEAQQEBgcDCAcKBwQFBgUMAwECBAIBAwwJDgMEBQcIBQMRAgMOCAUMAwEDCQkGBAMGAQ4ECgQBAgUCAgYKBAcHBwEJBQgHCAMCBwMCBAIGAgQFCgMDDgIFAgIFBAcCAQoIDwIDAwcDAg4DAgMEBgQGBAQBAS1PBAEIBAMEBg8KAgYEBQQFDgkUCwIBBhoCARcFBAYDBRQDAxAFAgEECAUIBAELGA0FDAICBAQMCA4EDgEKCxQHCAEFAw0CAQIBEgMKBAQJBQYCAwoDAgMFDAIQCBIDAwQEBgIECgcOAQUCBAEEAgIQBQ8FAgUDAgsCCAQEAgIEGA4JDgUJAQQGAQIDAgEEAwYHBgUCDwoBBAECAwECAwgFFwQCCAgDBQ4CCgoFAQIDBAsJBQICAgIGAgoGCgQEBAMBBAoEBgEHAgEHBgUEAgMBBQQC/g0VVQICBQQGAg8BAQIBAgEBAwIKAwYCAgUGBwMOBgIBBQQCCAECCAICAgIFHAgRCQ4JDAIEEAcABQAA/4gDrAM0AEMATABVAF4AZwByQG88MwIFChoPAgEFKyIZEAkABggBA0cACgsFCwoFbQ8MAggBCQEICW0ABgALCgYLYAcBBQMBAQgFAWAQDg0DCQAACVQQDg0DCQkAWAQCAgAJAExgX2RjX2dgZ11cWVhUU1BPS0oVNhY3GDYWNhQRBR0rJRYVFAYiJjU0NzU0KwEiJxUWFRQGIiY1NDc1BisBIg4BHQEWFRQGIiY1NDc1NDY7ATI9ASY1NDYyFhUUBxUUOwEyFhUFNCYiBhQWMjYTFBYyNjQmIgYTNCYiBhQWMjYFMjY0JiIGFBYDZEhGZEZITGQsIkhGZEZIHi5kIiYGSEZkRkhWWGRMSEZkRkhOZFZW/VoqOCgoOCrUKDgqKjgoiio4KCg4KgEYHCoqOCgocCJOMkZGMk4ick4MzCJOMkZGMk4izAwmHAxyIk4yRkYyTiJyQGw0jCJMMkZGMkwijDRsQOIeKCg6KCgC2BwoKDooKP0mHigoOigoKCg6KCg6KAAC//r/cAMaA1YAGQAtABBADRIBAEQAAABmKyoBBRQrARYGBwYnDwIGDwEGJi8BJjcBJicmNjc2Fgc2LgEGBw4BHwEeAR8BHgIyPgEDBhRgZkJAdkZoDiBMDBQCEAgUAQIYDhKOcmqybB4SVGQeCAgDBQIWB0MQDhgOFBACZHTGEgwKwgymHAQOBBAOYh4aAYIyRmqiFBSCvCxqPhQsDBYJEAcUBTEMCBACDgAABwAA/1QDQgNoABIAGwAuADcAWQBiAGsAg0CAVCwnHAQJBSoOAgcJQxALAAQCBwNHCwEFBAkEBQltDQECBwEHAgFtCAEDEAoPAwQFAwRgAAkABwIJB2ARDA4DAQAAAVQRDA4DAQEAWAYBAAEATGRjW1owLxQTaGdja2RrX15aYltiWFZPTkdFPj00My83MDciIRgXExsUGxUSBRUrNx4BFxQOASYnNDY3NTQ3FhcGFQcyPgEmIgYeAQEuASc0NjIWFxQGBxUUByYnNjU3Ig4BFjI2LgETHgEVFA4BJjc0NjcuASciJicuATU0NjIWBxQGBx4BNzIWASIGHgEyPgEmATI2NCYiBhQW0S06AVyCWgE6LkwxLkI1Fh4CIigiBBoB7S06AVyCWgE8LU8sM0Y1Fh4CIiggAhwaMDxcgF4BOCwNdkp1sA8wPFyAXgE4LA10Snaw/dYVIAIcLhwEJAH3FR4eKiAghRBSMkFaAl4/MlIQI2FFKBQnQ+oeKiAgKh4CehBSMUFcXEEyUBESaUslFCtQ2R4sHh4sHv2GD1IzQVoCXj8xUBJHXgGadA9QNEFcXEEwUBJHYAGcAggeLB4eLB78vx4qICAqHgAAAAMAAP+cAu4DIAAlACkAQwBlQGIRAQgCAUchAQUBRgAEBQcFBAdtAAcGBQcGawAGCQUGCWsAAQMBcAoBAAAFBAAFXgAJAAIICQJgAAgDAwhSAAgIA1gAAwgDTAEAQ0E6OCsqKSgnJiAfFRQODAkGACUBJAsFFCsTIgYVERQWMyEyNj0BMzIXFh8BFRQyNRE0Jy4BJyY9ASMnNTQmIwUhFSElMxUUFx4BFxYdARQHBg8BJyYnJj0BNCYrATIVHR8TAcITHxkLBwQCAZYQCTIJEDIyHRX+cAFe/qIBwjIQCTIJEAYFCAYGCAUGHxMyAyAdFfzgEx8fE/oGBQgGZEtLARMRFQwyDRQRljIyFR1kyDJLERQNMgwVEfoLBwQCAQECBAcLfRMfAAAAAwAAAAADUgKjAAgAHwA1AJNLsAlQWEAyCgEEAAECBGUIAQYHBwZkCQEAAAECAAFgAAIAAwUCA2ELAQUHBwVUCwEFBQdWAAcFB0obQDIKAQQAAQAEAW0IAQYHBnAJAQAAAQIAAWAAAgADBQIDYQsBBQcHBVQLAQUFB1YABwUHSllAISEgCQkBAC8uKyonJiA1ITQJHwkeFhQPDAUEAAgBCAwFFCsTIgYUFjI2NCYXFA4BKwEiBwYdARQzITU0JyYnJicmIwEiBh0BFBYyNj0BIRUUFjI2PQE0JiNkKTs7Ujs7bShFKUsNBAgZAzkEBxQaMDlY/doTHx8mHwKKHyYfHxMCoztSOztSO2QpRSgDBREyGWQcERwVGg4Q/tQfE5YTHx8TZGQTHx8TlhMfAAAAAAX//f9qA1IDUgAMABUAHgA4AE4AgEB9EAEAAgBvFAwTAwsDDgMLDm0ADgYDDgZrCggCBgcDBgdrDw0JAwcBAwcBawABAW4SBBEDAgMDAlQSBBEDAgIDWAUBAwIDTDo5Hx8XFg4NAQBIR0RDQD85TjpNHzgfODUzMC8sKygnJCIbGhYeFx4SEQ0VDhUHBgAMAQwVBRQrASIGFREUFjI2NRE0JgUiBhQWMjY0JiEiBhQWMjY0JgUDBhY7ARUUFjI2PQEzFRQWMjY9ATMyNicDISIGFREUFjI2NREzERQWMjY1ETQmIwHbCg8PFQ4O/uIpOztSOzsB5Ck7O1I7O/1/fAQSC0oPFQ5kDxUOSwsSBH0BdxUdDxUOlg8VDh0VA1IOC/xKCg8PCgO2Cw4yO1I7O1I7O1I7O1I7+v6JCRDhCg8PCuHhCg8PCuEQCQF3HRX9wQoPDwoBE/7tCg8PCgI/FR0AAAAAAgAA/3ID4ANSABAAGQAXQBQKCQcGBABFEAEARAAAAGYUEwEFFCs1ASY+AhcHHwE3Fg4CJwEnFBY+ATQuAQYBzxkecphHoi1zpBkgcpZJ/jEvHCYcHCYcFQHPRJpyHhmidS2kRppwIBj+MaEUHAIYLBYGIgAGAAD/tgPoAwYAJwAwAFgAgACLAJYAuEC1RQ8OBwYFBQBWVVNRTEpJERAFBAsDBWhlZGNfXlRQT0sVFAEADgIDaWddJRgFCAKBbSQiGxkGBwZ+fXt5dHEjGggBBwZHYAECagEIAkZCQUA/PTw7ODc2NQsJRXx4d3NyBQFEAAkACW8ABQADAAUDbQAIAgYCCAZtAAYHAgYHawAHAQIHAWsEAQAAAwIAA2AAAggBAlQAAgIBVgABAgFKlZOKiG9uW1pHRjMyLy4rKh8eGgoFFSs9ATc2Nyc3FzY/ATMXFhc3FwcWHwEVBwYHFwcnBg8BIycmJwcnNyYnNxQWPgIuAQYlNxc2Nyc3FzY/ARcHFhc3FwcWHwEHIwYHFwcnBg8BJzUmJwcnNyYnAzczNjcnNxc2PwEXFRYXNxcHFh8BByMGBxcHJwYPASc1JicHJzcmJzcGHgE+ASYnIyIGEwYeAT4BJicjIgZeCA88REoaHQhhCh0aSkQ8EAdeXgcQPERKGh0KYQgdGkpEPA8IfzRMMgI2SDgBQAhGCAwlNjEUFQ5IAhYROS0xCgJECEQIDic4LxYVDkYUETstMQgEJQYxBggaJSQNEAowEAwpHyMGBC8GMQQKHCgjDRAKMQ0OKR8jBgJFBBgoHAYaEgYRHBIEJDYqBCAcBxok9WEIHhlKRT0QB15eBxA9RUoZHghhCh0aSEY8DwheXggPPEZIGh07JTYCMk4wBDjLSAIWETktMQoEQghECA4nNjEUFw5GFBE7LTEIBEIGRggMJTYxFBX+UTIQDCshJQgCMAUxBgobKSMNEAwzDwwrISUIAjEGMwQKHCkkDRAZFR4EFi4YBhgBsBsqCCY0LAIiAAAFAAAAAAPqArEAEwAcACUAKgAzAEZAQyspKCcdFAYBBAFHAAUCBAIFBG0HAQQBAgQBawgGAwMBAW4AAAICAFQAAAACWAACAAJMJiYuLSYqJioYFBQUFBIJBRorNTQABAAHFAcjNjU0JgQGFRQXIyYTNDYeAg4BJjc0PgEeAQYuARM1NxcVEzQ2HgIOASYBJgGcASgCH4kr2v7G2iuJH/omMiQCKC4qviQ0JAIoMCgPMTFMJjIkAiguKrzPASYC/t7RXFRSXpreAtqcXlJUARAZJgIiNiIEKlMaJAIoMCgEIP58Mfb2MQFkGSYCIjYiBCoAAAAAAgAA/2oD6ANSAAsADwA6QDcCAQABAG8IBQIDBANwAAEABwYBB14ABgQEBlIABgYEVgAEBgRKAAAPDg0MAAsACxERERERCQUZKxUTMwczJzMTIQMjAxMzAyPJ+ghyCPrJ/l4KkAoMjAt2lgPo5ub8GAEf/uEBdQFUAAAAAAEAAAAAAa0CsQATAB1AGgoBAAEBRwACAQJvAAEAAW8AAABmEhYmAwUXKwERFAYmLwEjIiYnNTQ2NzM3NjIWAa0WHAu6kg8UARYOkroKHhQCjv2gDhYCCboWDtYPFAG6ChQAAAACAAAAAAKDArEAEwAuACpAJycKAgMEAUcAAgECbwABBAFvAAQDBG8AAwADbwAAAGYvFxIWJgUFGSsBERQGJi8BIyImJzU0NjczNzYyFhMUBgcGIyImNzQ+Ay4ENzQ2FzIXHgEBrRYcC7qSDxQBFg6SugoeFNcwJwUJDhYBDBYQEAQIGA4UBBQPCQUnMAKO/aAOFgIJuhYO1g8UAboKFP7BKkoPAxQQDBAMDB4gIAgSCBAPFgEDD0oABAAA/9EDoQLrABMALgBLAGwASkBHJwoCAwQ3AQUAVAEHBQNHaAECRQACBgJvAAYBBm8AAQQBbwAEAwRvAAMAA28AAAUAbwAFBwVvAAcHZlJQR0YoLxcSFiYIBRorAREUBiYvASMiJic1NDY3Mzc2MhYTFAYHBiMiJjc0PgMuBDc0NhcyFx4BFxQGBwYjIiY3NDc2Nz4BNCYnJicmNTQ2MzIXHgEXFAYHBiMiJic0PwE2Nz4BLgEnJicuAScmNTQ2NzIXHgEBrRYcC7qSDxQBFg6SugoeFNcwJwUJDhYBDBYQEAQIGA4UBBQPCQUnMI9gTQcHDxYBFSALKS4uKQsgFRQPCAdOXpCOdgcHDxQBFhkZFUROAkpGFRkEEgMWFg4HB3aOAo79oA4WAgm6Fg7WDxQBugoU/sEqSg8DFBAMEAwMHiAgCBIIEA8WAQMPSipVkiADFg4WCxAJHlpoWh4JEAsWDhYDIZBWgNgyAxYOFA0MDg4zmKqYMw8NAwYDDRQPFAEDM9YAAAABAAD/qgMRAxMACwAGswcCAS0rCQEGJjURNDYXARYUAwT9Gw0SEg0C5Q0BTf5kBwoPAzYODAj+ZAcUAAACAAD/sQNaAwsADwAfAB5AGxgQCAAEAAEBRwMBAQABbwIBAABmNTU1MwQFGCsBERQGIyEiJicRNDYzITIWBREUBiMhIiYnETQ2MyEyFgNZFBD+4w8UARYOAR0PFv4LFBD+4w8UARYOAR0PFgLn/O4OFhYOAxIOFhYO/O4OFhYOAxIOFhYAAAAAAQAA/7EDWgMLAA8AGEAVCAACAAEBRwABAAFvAAAAZjUzAgUWKwERFAYjISImJxE0NjMhMhYDWRQQ/O8PFAEWDgMRDxYC5/zuDhYWDgMSDhYWAAAABAAA//kD6AMLAA8AHwAvAD8ASkBHMAEGBygBBAUYEAICAwgAAgABBEcABwAGBQcGYAAFAAQDBQRgAAMAAgEDAmAAAQAAAVQAAQEAWAAAAQBMNTUmNSYmJiQIBRwrJRUUBgchIiYnNTQ2NyEyFicVFAYHISImJzU0NjchMhY3FRQGIyEiJic1NDYXITIWJxUUBichIiYnNTQ2MyEyFgPoFg78YA8UARYOA6APFNUWDv02DxQBFg4Cyg8UkBYO/KcPFAEWDgNZDhbXFA/9fQ8UARYOAoMOFmRHDxQBFg5HDxQBFshHDxQBFg5HDxQBFslIDhYWDkgOFgEUx0gOFgEUD0gOFhYAAAAABAAA//kD6AMLAA8AHwAvAD8ARUBCMAEGBxABAgMIAAIAAQNHAAcABgUHBmAABQAEAwUEYAADAAIBAwJgAAEAAAFUAAEBAFgAAAEATDU1JjUmJiYkCAUcKyUVFAYHISImJzU0NjchMhYnFRQGByEiJj0BNDY3ITIWNxUUBiMhIiY9ATQ2FyEyFicVFAYnISImNzU0NjMhMhYD6BYO/GAPFAEWDgOgDxTVFg7+DA4WFg4B9A8UkBYO/O4OFhYOAxIOFtcUD/6aDhYBFA8BZg4WZEcPFAEWDkcPFAEWyEcPFAEWDkcPFAEWyUgOFhYOSA4WARTHSA4WARQPSA4WFgAAAAQAAP/5A+gDCwAPAB8ALwA/AEVAQjABBgcQAQIDCAACAAEDRwAHAAYFBwZgAAUABAMFBGAAAwACAQMCYAABAAABVAABAQBYAAABAEw1JiY1JiYmJAgFHCslFRQGByEiJic1NDY3ITIWNxUUBgchIiY9ATQ2NyEyFjcVFAYjISImPQE0NhchMhY3FRQGJyEiJjc1NDYzITIWA+gWDvxgDxQBFg4DoA8UARYO/TYOFhYOAsoPFAEWDvynDhYWDgNZDxQBFg79fQ4WARQPAoMPFGRHDxQBFg5HDxQBFshHDxQBFg5HDxQBFslIDhYWDkgOFgEUx0gOFgEUD0gOFhYAAAAEAAD/+QPoAwsADwAfAC8APwBKQEcwAQYHKAEEBRgQAgIDCAACAAEERwAHAAYFBwZgAAUABAMFBGAAAwACAQMCYAABAAABVAABAQBYAAABAEw1JiY1JiYmJAgFHCslFRQGByEiJic1NDY3ITIWNxUUBgchIiYnNTQ2NyEyFjcVFAYjISImJzU0NhchMhY3FRQGJyEiJic1NDYzITIWA+gWDvxgDxQBFg4DoA8UARYO/GAPFAEWDgOgDxQBFg78YA8UARYOA6APFAEWDvxgDxQBFg4DoA8UZEcPFAEWDkcPFAEWyEcPFAEWDkcPFAEWyUgOFhYOSA4WARTHSA4WARQPSA4WFgAAAAAI////+APpAwsADwAfAC8APwBPAF8AbwB/AHZAc3l4cUlIQQYICWlhYCkhIAYEBVlYUVAZGBEQCAIDOTgxCQgBBgABBEcPAQkOAQgFCQhgDQEFDAEEAwUEXgsBAwoBAgEDAl4HAQEAAAFUBwEBAQBWBgEAAQBKfXt1c21rZWRdW1VUTUwmJhcmFxcXFxQQBR0rNxUUBicjIiY3NTQ2NzMyFicVFAYnIyImNzU0NhczMhYnFRQGByMiJjc1NDY7ATIWARUUBichIiYnNTQ2NyEyFgEVFAYrASImNzU0NjczMhYBFRQGJyEiJic1NDYXITIWJxUUBgchIiYnNTQ2MyEyFicVFAYjISImJzU0NjchMhaPCghrBwwBCghrBwwBCghrBwwBCghrBwwBCghrBwwBCghrBwwDWAoI/RIHCgEMBgLuBwz8pgoIawcMAQoIawcMA1gKCP0SBwoBDAYC7gcMAQoI/RIHCgEMBgLuBwwBCgj9EgcKAQwGAu4HDHZrBwwBCghrBwoBDNBrBwwBCghrBwwBCs5rBwoBDAZrCAoK/kxrBwwBCghrBwoBDAJ9awgKCghrBwoBDP5NawcMAQoIawcMAQrOawcKAQwGawgKCs9rCAoKCGsHCgEMAAH//f+OAa8DUgAWAB9AHAwBAQIBRwACAQJvAwEBAAFvAAAAZiQjJBQEBRgrJRYPAQYiLwEmNjsBETQ2OwEyFhURMzIBqwQHwwYPBcYICgt9CghrCAp9C30KCdcFBdcJFQK4CAoKCP1IAAAAAAEAAAAAA+gCNwAVAB5AGwEBAAEBRwABAAABUgABAQBYAAABAEwdIwIFFisBFRQGIyEVFAYvASY0PwE2Fh0BITIWA+gKCP1IFgjXBQXXCRUCuAgKAZRsBwp9DAoIxAUPBsUICQx9CgAAAQAAAAADxAI4ABYAHkAbDAEAAQFHAAEAAAFUAAEBAFYAAAEASiYXAgUWKwEUDwEGJj0BISImPQE0NjMhNTQ2HwEWA8QF1wgW/UgICgoIArgWCNcFAWAIBsUICQx9CgdsBwp9DAoIwwYAAAAAAf/+/2oBrwMuABYAH0AcBAEBAAFHAAMAA28CAQABAG8AAQFmFCQjIQQFGCsBBisBERQGKwEiJjURIyImPwE2Mh8BFgGrBQt9CghrCAp9DAgHwwUPBsYHAj8L/UgICgoIArgWCNcFBdcIAAAAAgAA/7EDWgMLABgAMAAxQC4oHxkDAgQSDAMDAAECRwAEAgRvAAIDAm8AAwEDbwABAAFvAAAAZjoUFxo3BQUZKwEUDwEXFhQGByMiJic1ND4BHwE3NjIfARYBFRQOAS8BBwYiLwEmND8BJyY0NjczMhYBpQW5UAoUD/oPFAEWHAtQugUOBkAFAbQUIAlQuQYOBkAFBbpRChQP+g8WAQUHBrlRCh4UARYO+g8UAgxQuQYGPwYB2/oPFAIMULkGBkAFDga5UQoeFAEWAAAAAQAA/2oD6ANSAEQAUkBPAAoJCm8LAQkHCW8NAQcIB28GAQABAgEAAm0EAQIDAQIDawADA24MAQgBAQhSDAEICAFWBQEBCAFKQUA9PDs5NDMuLBMXExElFSETFA4FHSsBFA8BBiImPQEjFTMyFhQPAQYiLwEmNDY7ATUjFRQGIi8BJjQ/ATYyFh0BMzUjIiY0PwE2Mh8BFhQGKwEVMzU0NjIfARYD6AuOCx4U10gOFguPCh4KjwsWDkjXFB4KjwsLjwoeFNdIDhYLjwscC48LFg5I1xQeC44LAV4OC48LFg5I1xQeCo8LC48KHhTXSA4WC48LHAuPCxYOSNcUHguOCwuOCx4U10gOFguPCgAAAAAB//n/sQMYAsMAFAAYQBUOAwIAAQFHAAEAAW8AAABmOCcCBRYrARYHAREUBwYjIi8BJjURASY2MyEyAw8JEf7tFgcHDwqPCv7tEhMYAsoXAq0WEf7t/mIXCgMLjwsOAQ8BExEsAAAAAAEAAP+xA1oDCwBFADJALz41MyIEAgM0ISAbEhEQAgEJAAICRwQBAwIDbwUBAgACbwEBAABmJjo3Gzo5BgUaKwEHFzc2Fh0BFAYrASInJj8BJwcXFgcGKwEiJic1NDYfATcnBwYjIicmPQE0NjsBMhcWDwEXNycmNzY7ATIWBxUUBwYjIicCzMbGUBEsFBD6FwkKEVHGxlARCQoX+g8UASwRUMbGUAsOBwcWFg76FwoJEVDGxlERCgkX+g8WARYHBw4LAiTGxlASExj6DhYXFRFRxsZRERUXFg76GBMSUMbGUAsDCRj6DhYXFRFRxsZRERUXFg76GAkDCwAAAAYAAP/UA+kC5wAIABEAIQAqADoASgBfQFxEPDsDCgs0LAIICRsTAgQFA0cACwAKBgsKXgAHAAYDBwZgAAkACAIJCGAAAwACAQMCYAABBQABVAAFAAQABQReAAEBAFgAAAEATEhGQD84NiUTFRcWExQTEgwFHSs3FAYuATQ+ARY1FAYiJjQ2MhYBFRQGJyEiJj0BNDY3ITIWARQGIiY0NjIWARUUBiMhIiY9ATQ2MyEyFgMVFAYHISImPQE0NjMhMhbWPlo+Plo+Plo+Plo+AxIKCP1aCAoKCAKmBwz87T5aPj5aPgMSCgj9WggKCggCpgcMAQoI/VoICgoIAqYHDEAsQAI8XDwCQPItPj5aPj7+62sHDAEKCGsHCgEMAgAtPj5aPj7+62wHCgoHbAcKCgEWawcKAQwGawgKCgAGAAD/agPpA00AHwA9AE0AXQBtAH0CF0A3WllVAxQPd24CDhRvAQ0OMAEHCGcvKgMKEkccAgMFPx0OAwsEBgEBAgUBAAEJR18BChcTAgMCRkuwDFBYQGMADxQPbxUBChIRCQplAAQDCwMEZQACCwEDAmUAFA4NFFQWEAIOEwENCA4NXgAIAAcSCAdgABIAEQkSEWAACQAGBQkGXwADBAUDVAwBBQALAgULXgABAAABVAABAQBYAAABAEwbS7AlUFhAZAAPFA9vFQEKEhEJCmUABAMLAwRlAAILAQsCAW0AFA4NFFQWEAIOEwENCA4NXgAIAAcSCAdgABIAEQkSEWAACQAGBQkGXwADBAUDVAwBBQALAgULXgABAAABVAABAQBYAAABAEwbS7AqUFhAZQAPFA9vFQEKEhESChFtAAQDCwMEZQACCwELAgFtABQODRRUFhACDhMBDQgODV4ACAAHEggHYAASABEJEhFgAAkABgUJBl8AAwQFA1QMAQUACwIFC14AAQAAAVQAAQEAWAAAAQBMG0BmAA8UD28VAQoSERIKEW0ABAMLAwQLbQACCwELAgFtABQODRRUFhACDhMBDQgODV4ACAAHEggHYAASABEJEhFgAAkABgUJBl8AAwQFA1QMAQUACwIFC14AAQAAAVQAAQEAWAAAAQBMWVlZQCxOTiAge3lzcmtpY2FOXU5dXFtSUVBPS0lDQiA9ID08OyQbFhESGBMjIhcFHSsXFAYHIic3FjMyNjU0Byc2PwE2NzUiBicVIzUzFQceARMVIyY1ND4DNzQmByIHJz4BMzIWFRQOAgczNQUVFAYnISImPQE0NjMhMhYBFSM1MzU0NzUjBgcnNzMVBRUUBiMhIiY9ATQ2MyEyFgMVFAYHISImPQE0NjMhMhbVPiw8JB8cIBAYOw4EDhgKCgkkCTu6NRwiAcoEHCIoFgMSDRkULw02ICg4Ji4mAUcDTQoI/VoICgoIAqYHDPztuzwBAQUXKEw7A04KCP1aCAoKCAKmBwwBCgj9WggKCggCpgcMNi0yASUxGRAQIwQfBhIfDQgBAgEeVTFBBioBQlkUCh0uHhgYDQ4QASAhHCAuKBwuGh4PIrJrBwwBCghrCAoMAfA4OEMtFwcKFCpH4dhsBwoKB2wHCgoBFmsHCgEMBmsICgoAAv///9UCPALnAA4AHQAjQCAAAQABAUcAAwIDbwACAQJvAAEAAW8AAABmFTQmFAQFGCslFA8BBiIvASY0NjchMhYnFAYjISIuAT8BNjIfARYCOwr6CxwL+gsWDgH0DhYBFA/+DA8UAgz6Ch4K+grzDwr6Cwv6Ch4UARbIDhYWHAv6Cwv6CgAAAAEAAP/VAjwBFwAOABdAFAABAAEBRwABAAFvAAAAZiYUAgUWKyUUDwEGIi8BJjQ2NyEyFgI7CvoLHAv6CxYOAfQOFvMPCvoLC/oKHhQBFgAAAf//AAACOwLnAA4AEUAOAAEAAW8AAABmFTICBRYrARQGIyEiLgE/ATYyHwEWAjsUD/4MDxQCDPoKHgr6CgHJDhYWHAv6Cwv6CgAAAAcAAP+xA+gCwwAIABEAIwAsADUAPgBQAGRAYS0BAgY2CQIDByQAAgEAA0cIAQIGBwYCB20ABwMGBwNrCQEDAAYDAGsEAQABBgABawALAAYCCwZgBQEBCgoBVAUBAQEKWAAKAQpMTUxFQj08OTg0MzAvKyonJhMUExIMBRgrNzQmIgYeAjYTNCYiDgEeATYXNzYuAQYPAQ4BBwYeATY3NiYlNCYiDgEeATYBNCYiDgEeATYXNCYiDgEeATYXFAcGIyEiJyY1ND4CMh4C1io6LAIoPiZtKD4mBC42MOs5AxAaHAM4ITYICyxYSg0JGgFWKjwoAiw4Lv6YKD4mBC42MPYoPiYELjYwr08KFPzyFApPUIS8yLyEUM8eKio8KAIsARYeKio8KAIs8NUOGgYMENUDLCErTBguKyFAJR4qKjwoAiwBgR4qKjwoAixPHioqPCgCLN6RfBERe5JmuIhOToi4AAAAAQAA/7ED6AMLAFUATkBLAAwLDG8NAQsKC28PCQcFAwUBAgACAQBtCAQCAABuDgEKAgIKVA4BCgoCVgYBAgoCSlRST01MSkVCPTs6ODUzNSERJTUhESUzEAUdKyUVFAYrASImPQE0NhczNSEVMzIWFxUUBisBIiYnNTQ2FzM1IRUzMhYXFRQGKwEiJic1NDYXMzU0NhchNSMiJic1NDY7ATIWFxUUBgcjFSEyFgcVMzIWA+ggFrIWICAWNf7jNRceASAWshceASAWNf7jNRceASAWshceASAWNSoeAR01Fx4BIBayFx4BIBY1AR0dLAE1Fx6asxYgIBazFiABa2seF7MWICAWsxYgAWtrHhezFiAgFrMWIAFrHSwBayAVsxYgIBazFh4Bayoeax4AAgAA/2oDEgNTAC0AQgAxQC4uIhYABAEDDQQCBQECRwYBAwEDbwIBAQUBbwAFAAVvBAEAAGY2EzUVGx83BwUbKwERFAYHERQGKwEiJicRLgE1ETQ+ARYHFRQWMjY9ATQ+ARYHFRQWMjY9ATQ+ARYFERQGKwEiJicRIyImNRE0NhczMhYBZSgfKh5HHSoBHygWHBYBFhwWFhwWARYcFhQeFgGsKh5HHSoBfQcKaEqPDxQDLv6bIjgL/k0dKiodAbMLOCIBZQ8UAhgN6A4WFg7oDxQCGA3oDhYWDugPFAIYDfyDHSoqHQEeCggBvkpqARYAFAAA/2oDEgNSAA8AHwAvAD8ATwBfAG8AfwCPAJ8ArwC/AM8A3wDvAP8BDwEfAS0BPQIPQU4BLgABACUAKQEZARgBEQEQAQkBAQEAAOkA4QC5ALgAsQAMABYAFwD5APgA8QDwANkA0QDQAKkAoQB5AHgAcQAMAA4ADwDJAMgAwQCZAJEAaQBhADkAOAAxAAoABgAHAIkAiACBAFkAUQApACEAGQAYABEACgACAAMASQBBAAkAAQAEAAAAAQEtASYAAgAkACcBNgABACgAJAAIAEdLsAlQWEBjACcAJCQnZQApACUXKSVeIyEdAxciIBwDFg8XFmAfGxUDDx4aFAMOBw8OXhkTDQMHGBIMAwYDBwZeEQsFAwMQCgQDAgEDAl4JAQEIAQAnAQBeJgEkKCgkUiYBJCQoWQAoJChNG0BkACcAJAAnJG0AKQAlFyklXiMhHQMXIiAcAxYPFxZgHxsVAw8eGhQDDgcPDl4ZEw0DBxgSDAMGAwcGXhELBQMDEAoEAwIBAwJeCQEBCAEAJwEAXiYBJCgoJFImASQkKFkAKCQoTVlBTgE8AToBNAEyASoBKAElASQBIwEiASEBIAEdARsBFQETAQ0BCwEFAQMA/QD7APUA9ADtAOsA5QDjAN0A2wDVANQAzQDLAMUAxAC9ALsAtQCzAK0AqwClAKQAnQCbAJUAlACNAIsAhQCEAH0AewB1AHQAbQBrAGUAZABdAFsAVQBUAE0ASwAXACYAFwAXABcAFwAXABcAFAAqAAUAHSs3FRQGByMiJjc1NDY3MzIWNRUUBicjIiY3NTQ2NzMyFhcVFAYnIyImPQE0NjczMhYnFRQGJyMiJjc1NDY7ATIWARUUBgcjIiYnNTQ2NzMyFicVFAYnIyImPQE0NjczMhYnFRQGJyMiJj0BNDY7ATIWJxUUBicjIiY3NTQ2OwEyFgEVFAYnIyImJzU0NjczMhYnFRQGJyMiJj0BNDY7ATIWJxUUBicjIiY9ATQ2OwEyFicVFAYrASImNzU0NjsBMhYBFRQGJyMiJic1NDY7ATIWJxUUBicjIiY9ATQ2OwEyFicVFAYrASImPQE0NjsBMhYFFRQGJyMiJic1NDY7ATIWJxUUBisBIiY9ATQ2OwEyFhcVFAYrASImJzU0NjsBMhYDMxEhETM1NDY7ATIWBwERFAYHISImJxE0NjchMhbWCggjBwwBCggjCAoKCCMHDAEKCCMICo8KCCMICgoIIwgKjwoIIwcMAQoIIwgKAa0KCCQHCgEMBiQHDJAKCCQHCgoHJAcMkAoIIwgKCggjCAqPCggjBwwBCggjCAoBrQoIJAcKAQwGJAcMkAoIJAcKCgckBwyQCggjCAoKCCMICo8KCCMHDAEKCCMICgGtCggkBwoBDAYkBwyQCggkBwoKByQHDJAKCCMICgoIIwgKAR4KCCQHCgEMBiQHDJAKCCQHCgoHJAcMjgoIJAcKAQwGJAcMkNb9fdcKCLIHDAEBHhYO/TYPFAEWDgLKDxR2JAcKAQwGJAcKAQyJJAcMAQoIJAcKAQwGJAcMAQoIJAcKAQyJJAcMAQoIJAcKCv7bJAcKAQwGJAcKAQyJJAcMAQoIJAcKAQyJJAcMAQoIJAcKCocjBwwBCggjCAoK/tskBwwBCggkBwoBDIkkBwwBCggkBwoKhyMHDAEKCCMICgqHIwgKCggjCAoK/tskBwwBCggkBwoKhyMHDAEKCCMICgqHIwgKCggjCAoKlyMHDAEKCCMICgqHIwgKCggjCAoKCCMICgoIIwgKCvz4A1r8pn0ICgoIAwD8YA8UARYOA6APFAEWAAAC////sQKDA1MAJwAzAGdACxwBBAUTBAIAAwJHS7AJUFhAIgAFBAVvAAQDBG8AAwAAA2MCAQABAQBUAgEAAAFZAAEAAU0bQCEABQQFbwAEAwRvAAMAA28CAQABAQBUAgEAAAFZAAEAAU1ZQAkVGx0jMyUGBRorARUUBgcVMzIeAQYjISIuATY7ATUuATc1ND4BFgcVFBY+ASc1ND4BFicRFA4BJicRNDYeAQKDpHqPDxQCGA3+mw8UAhgNj3mmARYcFgGUzJYCFhwWj2iWZgFolGoByUd8tg1KFhwWFhwWSg22fEcPFAIYDUdnlAKQaUcPFAIYyf7jSmgCbEgBHUpqAmYAAAMAAP+xAwsDUwALAEMASwCUQBRFHxMNAQUABhQBAQA0MiMDAgEDR0uwCVBYQC8ABwYHbwAGAAZvAAABAG8AAQICAWMABQIDAgUDbQQBAgUDAlQEAQICA1kAAwIDTRtALgAHBgdvAAYABm8AAAEAbwABAgFvAAUCAwIFA20EAQIFAwJUBAECAgNZAAMCA01ZQBNKSD8+NzYxLywpJiQXFRIQCAUUKxMHJj0BND4BFh0BFAEHFRQGByInBxYzMjYnNTQ+ARYHFRQGBxUzMhYOASMhIiY+ATsBNSYnBwYiLwEmNDcBNjIfARYUJwERNDYXMhaXOBgWHBYCdspoSh8eNTY8Z5QBFhwWAaR5jg8WAhIR/psOFgISEI9GPY4FEAQuBgYCsQUOBi4G2v6lakk5XAFDOTo+Rw8UAhgNRx4BL8pHSmgBCzYckmhHDxQCGA1HfLYNShYcFhYcFkoHJo4GBi4FEAQCsQYGLgUQRf6mAR1KagFCAAQAAP9qA6EDUgADABMAIwBHAIdADBUFAgcCHQ0CAwcCR0uwClBYQCwLCQIHAgMDB2UKAQgEAQIHCAJgBQEDAAEAAwFfAAAGBgBSAAAABlgABgAGTBtALQsJAgcCAwIHA20KAQgEAQIHCAJgBQEDAAEAAwFfAAAGBgBSAAAABlgABgAGTFlAEkZEQT47OjMlNiYmJiQREAwFHSsXIREhNzU0JisBIgYdARQWOwEyNiU1NCYrASIGHQEUFjsBMjY3ERQGIyEiJjURNDY7ATU0NjsBMhYdATM1NDY7ATIWBxUzMhZHAxL87tcKCCQICgoIJAgKAawKCCMICgoIIwgK1ywc/O4dKiodSDQlJCU01jYkIyU2AUcdKk8CPGuhCAoKCKEICgoIoQgKCgihCAoKLP01HSoqHQLLHSo2JTQ0JTY2JTQ0JTYqAAAC//3/sQMSA0AACABNANlLsAlQWEAPOgECASUWAgUCIQEDBQNHG0uwClBYQA86AQQBJRYCBQIhAQMFA0cbQA86AQIBJRYCBQIhAQMFA0dZWUuwCVBYQCcABQIDAgUDbQADA24ABgAAAQYAYAcBAQICAVQHAQEBAlgEAQIBAkwbS7AKUFhAKAAFAgMCBQNtAAMDbgAGAAABBgBgBwEBAAQCAQRgBwEBAQJYAAIBAkwbQCcABQIDAgUDbQADA24ABgAAAQYAYAcBAQICAVQHAQEBAlgEAQIBAkxZWUALFB4mJzcsExIIBRwrATQmIgYUFjI2JRUUBwYjIi8BLgE1IxUeAQcRFAYjISImJxE0Njc1IyIOAwcGIyInLgE/AT4DNyY1NDYyFhUUBzM0Nj8BNjMyFxYBHhYcFhYcFgH0BwQHAgL6BgiPPlIBFg7+4w8UAUY3EiE+KCIMAQoWCQcNCgcIBSAkOiAONEo0B6gIBvoCAgcEBwLnDhYWHBYWILMJBQQBNQIKBjkNYkD+QQ4WFg4BvzteET4aIigUBBMEBxoPDgkqJCgJFxklNDQlExEGCgE2AQQFAAAAAAQAAP9qA58DUgAKACIAPgBOATFADxcBAAM0LAIGCCYBAQkDR0uwE1BYQEoRAQMAA28ABwYCBgdlBAECCgYCCmsTAQoJCQpjAAAADQwADV4UEhAOBAwPAQsIDAteAAgABgcIBl4ACQEBCVQACQkBWQUBAQkBTRtLsBRQWEBLEQEDAANvAAcGAgYHZQQBAgoGAgprEwEKCQYKCWsAAAANDAANXhQSEA4EDA8BCwgMC14ACAAGBwgGXgAJAQEJVAAJCQFZBQEBCQFNG0BMEQEDAANvAAcGAgYHAm0EAQIKBgIKaxMBCgkGCglrAAAADQwADV4UEhAOBAwPAQsIDAteAAgABgcIBl4ACQEBCVQACQkBWQUBAQkBTVlZQCg/PyMjP04/Tk1MS0pJSEdGRURDQkFAIz4jPj07EREZFBQjJB4QFQUdKwEzLwEmNSMPAQYHARQPAQYiLwEmNjsBETQ2OwEyFhURMzIWBRUhNRM2PwE1IwYrARUjNSEVAwYPARU3NjsBNRMVIzUzJyMHMxUjNTMTMxMCmWIoBgICAQICA/7aBrIFDgazCAgNawoIawgKawgKAdL+us4HBQYIBgqCQwE9zgQIBggFC4t1oSoaiBoqoCeAW4ACbnoaCQILCgoG/UYGB7IFBbMJFQMACAoKCP0ACkqCMgEnCwUFAQJAgDL+2AQKBwEBAkIB9Tw8UFA8PAFx/o8AAAAABAAA/2oDnwNSAAoAIgAyAE0BQ0AMRj4XAw4DNgENEQJHS7ATUFhAUQAPDhIOD2UUARIRERJjAAsNAg0LAm0EAQIADQIAaxABAwAODwMOXgARAA0LEQ1fAAAABwYAB14TDAoIBAYBAQZSEwwKCAQGBgFWCQUCAQYBShtLsBRQWEBSAA8OEg4PZRQBEhEOEhFrAAsNAg0LAm0EAQIADQIAaxABAwAODwMOXgARAA0LEQ1fAAAABwYAB14TDAoIBAYBAQZSEwwKCAQGBgFWCQUCAQYBShtAUwAPDhIODxJtFAESEQ4SEWsACw0CDQsCbQQBAgANAgBrEAEDAA4PAw5eABEADQsRDV8AAAAHBgAHXhMMCggEBgEBBlITDAoIBAYGAVYJBQIBBgFKWVlAKDMzIyMzTTNNTElFRENCQUA1NCMyIzIxMC8uLSwREREUFCMkHhAVBR0rJTMvASY1Iw8BBgcFFA8BBiIvASY2OwERNDY7ATIWFREzMhYFFSM1MycjBzMVIzUzEzMTAxUhNRM2PwE1IgYnBisBFSM1IRUDDwEVNzM1ApliKAYCAgECAgP+2gayBQ4GswgIDWsKCGsICmsICgIEoSoaiBoqoCeAW4AL/rrOBwUGAQQDBgqCQwE9zgwGCJszehoJAgsKCQd/BgeyBQWzCRUDAAgKCgj9AAqROztQUDs7AXL+jgKDgzMBJwoFBQICAQJAgDL+2Q8FAgJDAAAFAAD/agPoA1IAFwAnADcARwBXAF9AXFFJDAMKAkE5AggJMSkCBgchGQIABQRHAwEBBgUGAQVtCwECAAoJAgpgAAkACAcJCF4ABwAGAQcGYAAFAAAFVAAFBQBYBAEABQBMVVNNS0VDFyYmJiYUIyQUDAUdKyUUDwEGIi8BJjY7ARE0NjsBMhYVETMyFgUVFAYjISImPQE0NjMhMhYDFRQGIyEiJj0BNDYzITIWAxUUBgcjIiY9ATQ2OwEyFgMVFAYrASImPQE0NjsBMhYBmwayBQ4GswgIDWsKCGsICmsICgJNCgj+MAgKCggB0AgKawoI/psICgoIAWUICmsKCPoICgoI+ggKawoIjwgKCgiPCAouBgeyBQWzCRUDAAgKCgj9AApPawgKCghrCAoKARZrCAoKCGsICgoBFWsHCgEMBmsICgoBFmsICgoIawgKCgAFAAD/agPoA1IADwAnADcARwBXAF9AXFFJHAMKBEE5AggJMSkCBgcJAQIAAQRHBQEDBgEGAwFtCwEEAAoJBApgAAkACAcJCF4ABwAGAwcGYAABAAABVAABAQBYAgEAAQBMVVNNS0VDFyYmFCMkFyYjDAUdKwUVFAYrASImPQE0NjsBMhYlFA8BBiIvASY2OwERNDY7ATIWFREzMhYlFRQGKwEiJj0BNDY7ATIWExUUBgchIiY9ATQ2MyEyFhMVFAYjISImPQE0NjMhMhYCpwoIjwgKCgiPCAr+9AayBQ4GswgIDWsKCGsICmsICgF3Cgj6CAoKCPoICmsKCP6bCAoKCAFlCAprCgj+MAgKCggB0AgKGWsICgoIawgKCj8GB7IFBbMJFQMACAoKCP0ACs9rCAoKCGsICgoBFWsHCgEMBmsICgoBFmsICgoIawgKCgAEAAD/agM+A1IACgAiAEAAUgBnQGRPTklIRhcGCwQ1AQgBLgEHCC0BAgcERwwBBAsEbw4NAgsACgkLCl4ACQAAAQkAYAUDAgEACAcBCGAABwICB1QABwcCWAYBAgcCTEFBQVJBUlFQRURDQj89JScoFCMkFiMiDwUdKyU0JiciBhQWMzI2BRQPAQYiLwEmNjsBETQ2OwEyFhURMzIWJRQOAyMiJyYnNxYXFjMyNjcjDgEjIiY+ATMyFgMVITUzNTQ3NSMHBg8BJzczEQLvMCIdIigmHCj+qwayBQ4GswgIDWsKCGsICmsICgGiDiAsQiYjGQ4KFgkIFRUvOAkBCy4YO0wBUD1FXBH++l0BAgMFCiMta0R1JDoBKj4sHjAGB7IFBbMJFQMACAoKCP0ACh8jQj4sHAkEBD8EAgdCMA0QUHNSagE4QED8BwIJBwcKIDBn/pMABAAA/2oDPgNSAAoAIgA0AFIAdUByFwEABEYBDAE/AQsMPgEKCzEwKyooBQMIBUcACAoDCggDbQUBAwcKAwdrDQEEAAABBABgAAEADAsBDGAACwAKCAsKYA4JAgcCAgdSDgkCBwcCWAYBAgcCTCMjUU9LSURCPDojNCM0GxEUFCMkFiMiDwUdKwE0JgciBhQWNzI2ARQPAQYiLwEmNjsBETQ2OwEyFhURMzIWBRUhNTM1NDc1IwcGDwEnNzMRExQOAyciLwE3FhcWMzI2NyMOAQciJjc0NjcyFgLvMCIdIigmHCj+qwayBQ4GswgIDWsKCGsICmsICgGS/vpdAQIDBQojLWtEbQ4gLEImIxkYFgkIFRUvOAkBCy4YO0wBUD1FXAKxIzwBKj4sAR79lAYHsgUFswkVAwAICgoI/QAKjEBA+wYECQcHCiEwaP6TAuYiQj4sHgEJCT8EAghCMA0OAVA4O1ABagAABAAA/44EdwMLAAgAEgAbAEUAV0BUHQEGAQFHDQsCAgMAAwIAbQQBAAEDAAFrBQEBBgMBBmsKCAIGBwMGB2sJAQcHbgAMAwMMVAAMDANYAAMMA0xEQj88OTcxMC0sExMlExYjEhMSDgUdKyU0JiIOARYyNjchJy4BJyEiBhUBNCYiBh4BMjY3FRQGKwEVFAYiJj0BIRUUBiImJzUjIiY9ATQ2FzM3PgE3ITIWHwEzMhYBDDRKNAI4RjgSAjcyAQ4E/lMFDgLMNkg2AjJMMlsKCDY+Wj79xT5aPgE1CApKMxA6DVo3Aa02XAw6EDRI8yU0NEo0NNfIBAoBDAP+hiU0NEo0NFrWCApHLT4+LUdHLT4+LUcKCNY0SgHqNUYBSDTqSAAAAAcAAP+xBQcDCwAFAAwAFQAZADoARQBVAIFAfjoSBAMACSokDgMHACsBAgwDRwoFEAMEAQYJBgFlAAkABgkAawAABwYAB2sABwwGBwxrAAwCBgwCaw0LBAMCCAgCYwAPAAYBDwZgAAgODghUAAgIDlkADggOTQ0NVFFMSUVEQkFAPz07ODYuLCgmHRsZGBcWDRUNFRknEBEFFysBIzY/ARcFJyYrAQcWNwcnLgEnEzMTAzMTIwUmIyIGFQYXHgEXFAYjIi8BBxYzMjY3NCcuAT4BMzYfATcjIgcDMzczFhczExEUBgchIiY1ETQ2NyEyFgROTQgdDAf87yAGJJUCrpdaCg5CKEtikRRcOlwBciYtRFgBUhsUASIVMCcNDSo+SFgBThsaARwZJx4J+kgkDIphFHYDCFZIKh77iR0qKh0Edx0sASoUTyMfQ6QfCCw09TInQhH+4wFm/pkBZwkPQjU4KQwWChESEwZRE0I5OyYOEhkSAQ4FVx/+uDYMKgIZ/TYdKgEsHALKHSoBLAAAAAALAAD/sQUHAwsACwAXACMAOgBSAG0AhACdAKsAtgDGAX1AEIxCAgIJWgEACJZMAgcAA0dLsApQWEBkABwGHG8XEAIGAwZvFAEKAwkDCgltEw4NAwkCAwkCaxIBCAEAAQgAbRgWEQwEBwALAAcLbRUBCw8ACw9rAA8bAA8bawAbG24aAQMZAQIBAwJgBQEBCAABVAUBAQEAWAQBAAEATBtLsAtQWEBYABwGHG8XEAIGAwZvFBMODQoFCQMCAwkCbRIBCAEAAQgAbRgWFREMCwYHAA8ABw9tAA8bAA8bawAbG24aAQMZAQIBAwJgBQEBCAABVAUBAQEAWAQBAAEATBtAZAAcBhxvFxACBgMGbxQBCgMJAwoJbRMODQMJAgMJAmsSAQgBAAEIAG0YFhEMBAcACwAHC20VAQsPAAsPawAPGwAPG2sAGxtuGgEDGQECAQMCYAUBAQgAAVQFAQEBAFgEAQABAExZWUA0xcK9urWzsK6qp6KhnZqUko6NioiDgXl3c3BpZ15cV1VST0pIRENAPic0NCQlIyQkIh0FHSsBFAYjIiYnNDYzMhYlFAYHIzc2OwEyHgEXFAYjIiY1NDYzMhYlNCYHIyIPARQWOwEyPwE+AhY7ATI2Fzc0JgcjIgcmIgYVFBYXMjY3BhUUOwEyNzQmByMiDwEnJisBIgYUHgEXBhUUOwEyPwE2NzQmByMiDwEUFjsBMj8BPgIWOwEyNhc3NCYHIyIHJiIGFRQWFzI2NwcGFRQ7ATI3NTQrASIPARQWFzMyNyUOAQcjNzY7ATIWAREUBgchIiY1ETQ2NyEyFgGgHBUREgEcFQ8UAbcYGRIJAQcKDA4OxB4TEBQcFBAU/QUqI1oKASUEBCoLAQoBBgwGCAgwNq0XBAQqCAIPTjgmIQ8iCgIHJgv7BAMrBgQ7GQMJKgMEFhgBLQcrBgSOAdQqI1kLASUEBC0HAgoBBgwGCAgwNq0XBAQqCAIOTzgmIRAiCQEBByYLewcpBgElBAQkCwH8QQMYFRMKAQYLFhQEKCoe+4kdKiodBHcdLAFYFBwSEBUcEkMYEAE8BgIMXxQcEhAVHBJPIR4BCuQDBgs9BQQEAjZ+kQQGARIWPCkhJgEOCwcFCZ4CBgEFV1MJBAU+TAE/BAcFzgEeIR4BCuQDBgdBBQQEAjZ+kQQGARIWPCkhJgEOCwUEAwnvAQcG6QMEAQuZEwwBPAYOAQz9Nh0qASwcAsodKgEsAAAAAwAA//kEdwLEABIAGwAlAH+1BAECAAFHS7AkUFhALQAEBQRvAAUHBW8ABwYHbwkIAgYAAAZjAwEBAgFwAAACAgBUAAAAAlcAAgACSxtALAAEBQRvAAUHBW8ABwYHbwkIAgYABm8DAQECAXAAAAICAFQAAAACVwACAAJLWUARHBwcJRwlNRMVJBEREyAKBRwrEyEyFhcVIzUhFSMRNDYXMzIWFwU0JiIGHgEyNgU1NCYHISIGBxWPA8QPFAGP/KePFg5HDxQBAUFUdlQCUHpQAql+WP53DxQBARcWDvqPjwKmDxYBFBDWO1RUdlRUVCRZfgEUD9cAAAAG//7/agTAA1IAAgAFADUAPgBYAHEAckBvMiQCBQYcCQIMChcPAgMCA0diSAIAAUYABwYHbwAKBQwFCgxtDgEMAAUMAGsIAQYPCQIFCgYFYAEBAA0BCwIAC2AEAQIDAwJUBAECAgNYAAMCA0wGBmtqXl1RUERDNzYGNQY0EhImFCYmFRIREAUdKwEDIQEDIRMOAQcRITIWHQEUBiMhIiY9ATQ2MyERLgEnISImPQE0NjMhPgEyFhchMhYdARQGIwUyNjQuAQ4BFgEUDgMuAjc0PwE+Ajc2Mh8BFh8BHgEFFA4DLgI3ND8BPgI3NjIXHgQDxNYBrfxf1gGs9AgiFwFTCAoKCP0SCAoKCAFTFiIJ/u4ICgoIARIMNkY2DAESCAoKCP6JExoaJhgCHAJwNE5USFRMOAIUMx86OAMKKgsfHRw7Hyr9NDROVEhUTDgCFDMfOjgDCioKAzo2QiYCWP53AYn+dwH0FiQH/S8KByQICgoIJAcKAtEIIhcKCCQICh8oKB8KCCQICgkaJhgEIB4i/hkpQCYQBBgeSCUGJ2I7ZGoCExM3MzRtOVIEKUAmEAQYHkglBidiO2RqAhMTBGZoclIAAAIAAP9qA1kDUgAtAE0ARUBCKiICAwQaAwIAAxMLAgEAA0cABAYIBQMDAAQDXgcCAgABAQBSBwICAAABWAABAAFMAABEQzQzAC0ALCYWJiYWCQUZKwEUBgceARczMhYdARQGIyEiJj0BNDY7ATQ2Ny4BJyMiJj0BNDYzITIWHQEUBiMBPgMnIRQeAhceAgYHDgMXITQuAicuAjYDEnhYWXYBNQgKCgj8ywgKCgg1eFladgE1CAoKCAM1CAoKCP6hK1BAKAH9xSZCTiwLDAIQCSpSPioCAjsmQk4sCwwCEAMLkuA7O+CSCgckCAoKCCQHCpLgOzvgkgoHJAgKCggkBwr+dRBGZIZLSohiSA8EFBQUAxFGZIZLSohiSBADFBQUAAkAAP+xA1kDCwADAAcACwAPABMAKAArAC4APgCEQIEcGxoVBAMKIgEMBAJHABAODQsDCgMQCl4VCRIDAwgBAgEDAl4UBxEDAQYBAAUBAF4TAQUABAwFBF4ADA8PDFQADAwPWAAPDA9MEBAMDAgIBAQAAD06NTIuLSsqJiQeHRkXEBMQExIRDA8MDw4NCAsICwoJBAcEBwYFAAMAAxEWBRUrARUjNTcVIzUBFSM1NxUhNSUVITUBETQmByMHJwcnIyIGBxEUFjchMjYBNyMFNyMFERQGIyEiJjURNDYzITIWAR+MjIwCM76+/okBd/6JAcMIAxLTdXbTEQUGAQgEArQEBv4kZ+MBbHvjAZwwIv1MIzAwIwK0IjABVkhIjkdH/uNISI9ISI5HR/4gArQECAGPYGCPBgX9TAQIAQYCcFRUVAv9TCMwMCMCtCMwMAAAAAEAAAABAACXlclXXw889QALA+gAAAAA1jMMLwAAAADWMwww/+D/IQUHA5sAAAAIAAIAAAAAAAAAAQAAA1L/agAABQX/4P/uBQcAAQAAAAAAAAAAAAAAAAAAAQ8D6AAAA+j//QPoAAADIAAAA1n//QMRAAACygAAAxEAAAR2AAADEQAAA1n//wR2AAAD6AAABHYAAAPoAAADWQAAA1kAAAI7AAAEdgAAA1n//QPoAAADWQAAAjsAAANZAAADWQAAAsoAAAPoAAADoAAAA1n//wUFAAAD6AAAA1kAAAMRAAADWQAABHYAAANZAAAEdgAAA+gAAAR2AAADWQAAA1kAAAPoAAADWQAAA+gAAAMR//8DWQAABHEAAALKAAAD6AAAA+gAAANZAAAEdgAAA1kAAAR2AAAEdgAAA1kAAAOgAAAD6AAAA1kAAAPoAAAELwAAAsoAAANZAAACOwAAA+gAAAOgAAADWQAABC///wR2AAADWQAAA+j//gOgAAAD6P/+AxH//gNZAAADWQAAA1kAAANZ//0DWQAAA+gAAAOYAAAC1gAAA4QAAAL+AAAD6AAAA+gAAAPoAAAD6AAAA2L/8wHR//QB0f/zA2D/9AMMAAAD6AAAA+j/+gOEAAAD6AAAA+gAAAPoAAAD3gAAA3UAAAQvAAADEQAAAoIAAAOgAAACggAAA6AAAAOgAAADoAAAA+gAAAPo//8DoAAAA6AAAALKAAAEdgAABHYAAAQv//8D6AAAAxEAAAMRAAADEQAAA1n//QNZ//0DWf/9A1n//QI7AAADWf/9A1n//QFlAAABZQAAA1n//QHS//MBCf/0AQn/8wHQ//QC+AAAA+gAAAPoAAADWQAAA+gAAAPoAAAD6P/2A+j//wQvAAADWQAABC8AAAPo//0COwAAA+j//wOg//8DoAAAA+gAAAPoAAAD6AAAA+gAAAPoAAADoAAAA6AAAANZ//0DEQAAANYAAANZ//0D6P/6A+gAAANZAAADoP/5BHb//wR2AAADoP//A6D//wNZ//0EdgAABHYAAAPo//4EdgAAA1n/+wPUAAADEQAAA1kAAAQv//8EL///AoL//wGsAAAA3AAAAnH//wOgAAADoAAAArr/4ANBAAACvAAAApv//QHWAAAC7P/xArAAAAPoAAAD6AAAA+gAAAI7//8BZQAAAWUAAAOgAAAEL///AjoAAAOYAAADWQAAAawAAAPoAAADrAAAAjAAAAOJ/+8D6AAAAfQAAAPoAAADXAAAA8D//ANZ//0DrAAAAwz/+gNCAAAC7gAAA1IAAANS//0D1gAAA+gAAAPoAAAD6AAAAawAAAKCAAADoAAAAxEAAANZAAADWQAAA+gAAAPoAAAD6AAAA+gAAAPo//8BrP/9A+gAAAPoAAABrP/+A1kAAAPoAAADEf/5A1kAAAPoAAAD6AAAAjv//wI7AAACO///A+gAAAPoAAADEQAAAxEAAAKC//8DEQAAA6AAAAMR//0DoAAAA6AAAAPoAAAD6AAAA1kAAANZAAAEdgAABQUAAAUFAAAEdgAABQX//gNZAAADWQAAAAAAAACmAjICkALSA7YE5AVoBmYHGAdkCGQI0gpqCqQK7As4C3gMAA0sDXIOhA6+Dw4PaA/sEQoRsBICEnYS4BMoE3IUTBTkFbIWThbqF4AX5hw0HHIdIB1WHhwemiB+IQYhsCJwIq4jXiZMJqgnUigIKLApaCngKm4q1CtgK8osGCx6LOotXC48LvgvoDBsMKwxijHaMoo01jUiNUQ1+jaMNyg3mDfkOJA40DlEOao6KjpOOnI6ljq4OvY7dDwcPHw80j1EPZY+ED6ePxA/hj/OQCBAhkDuQc5CzEMAQ5BD1EQuRHJFHkW+RoJGukcER0xHdkfISC5IlkjUSWBJ5kpeSsJLDEt2S5ZLtkvWS/JMOkxUTG5NME2QTjBPJk+8UWBSHFKMVFJUelXSVlpW+FdiV8hYLFiUWOhZSlnWWh5adlrSWzhcSFzGXVZeMF6WXuRfNmBEYJxg/mE2YXph2GJQYrhjAmOaY/5kdmToZVRleGWaZdhmFmZ4ZuZnPmduZ65n9misasBrWmvqbBBsOGxabUptxG36bkRuqG7ubzZvim/UcHRw0nEScXBxonIWdhp23nc0eBp4rnlGefh6Mnt2e/B8LnxgfLx9gH2efeJ+DH6QfxB/kIAUgQKBOIFsgaKB2II+gsaC+oN4hBaFzoYShjqGYIcSh6iIIIrKi0yMBoyqjYaOko+kkEyQ9JGeklKS5JOslXyV+Jbal2qYEQABAAABDwH4ACcAAAAAAAIAugDKAHMAAAH6C3AAAAAAAAAAEgDeAAEAAAAAAAAANQAAAAEAAAAAAAEAEAA1AAEAAAAAAAIABwBFAAEAAAAAAAMAEABMAAEAAAAAAAQAEABcAAEAAAAAAAUACwBsAAEAAAAAAAYAEAB3AAEAAAAAAAoAKwCHAAEAAAAAAAsAEwCyAAMAAQQJAAAAagDFAAMAAQQJAAEAIAEvAAMAAQQJAAIADgFPAAMAAQQJAAMAIAFdAAMAAQQJAAQAIAF9AAMAAQQJAAUAFgGdAAMAAQQJAAYAIAGzAAMAAQQJAAoAVgHTAAMAAQQJAAsAJgIpQ29weXJpZ2h0IChDKSAyMDE3IGJ5IG9yaWdpbmFsIGF1dGhvcnMgQCBmb250ZWxsby5jb210cnhfYWRkb25zX2ljb25zUmVndWxhcnRyeF9hZGRvbnNfaWNvbnN0cnhfYWRkb25zX2ljb25zVmVyc2lvbiAxLjB0cnhfYWRkb25zX2ljb25zR2VuZXJhdGVkIGJ5IHN2ZzJ0dGYgZnJvbSBGb250ZWxsbyBwcm9qZWN0Lmh0dHA6Ly9mb250ZWxsby5jb20AQwBvAHAAeQByAGkAZwBoAHQAIAAoAEMAKQAgADIAMAAxADcAIABiAHkAIABvAHIAaQBnAGkAbgBhAGwAIABhAHUAdABoAG8AcgBzACAAQAAgAGYAbwBuAHQAZQBsAGwAbwAuAGMAbwBtAHQAcgB4AF8AYQBkAGQAbwBuAHMAXwBpAGMAbwBuAHMAUgBlAGcAdQBsAGEAcgB0AHIAeABfAGEAZABkAG8AbgBzAF8AaQBjAG8AbgBzAHQAcgB4AF8AYQBkAGQAbwBuAHMAXwBpAGMAbwBuAHMAVgBlAHIAcwBpAG8AbgAgADEALgAwAHQAcgB4AF8AYQBkAGQAbwBuAHMAXwBpAGMAbwBuAHMARwBlAG4AZQByAGEAdABlAGQAIABiAHkAIABzAHYAZwAyAHQAdABmACAAZgByAG8AbQAgAEYAbwBuAHQAZQBsAGwAbwAgAHAAcgBvAGoAZQBjAHQALgBoAHQAdABwADoALwAvAGYAbwBuAHQAZQBsAGwAbwAuAGMAbwBtAAAAAAIAAAAAAAAACgAAAAAAAAAAAAAAAAAAAAAAAAAAAAABDwECAQMBBAEFAQYBBwEIAQkBCgELAQwBDQEOAQ8BEAERARIBEwEUARUBFgEXARgBGQEaARsBHAEdAR4BHwEgASEBIgEjASQBJQEmAScBKAEpASoBKwEsAS0BLgEvATABMQEyATMBNAE1ATYBNwE4ATkBOgE7ATwBPQE+AT8BQAFBAUIBQwFEAUUBRgFHAUgBSQFKAUsBTAFNAU4BTwFQAVEBUgFTAVQBVQFWAVcBWAFZAVoBWwFcAV0BXgFfAWABYQFiAWMBZAFlAWYBZwFoAWkBagFrAWwBbQFuAW8BcAFxAXIBcwF0AXUBdgF3AXgBeQF6AXsBfAF9AX4BfwGAAYEBggGDAYQBhQGGAYcBiAGJAYoBiwGMAY0BjgGPAZABkQGSAZMBlAGVAZYBlwGYAZkBmgGbAZwBnQGeAZ8BoAGhAaIBowGkAaUBpgGnAagBqQGqAasBrAGtAa4BrwGwAbEBsgGzAbQBtQG2AbcBuAG5AboBuwG8Ab0BvgG/AcABwQHCAcMBxAHFAcYBxwHIAckBygHLAcwBzQHOAc8B0AHRAdIB0wHUAdUB1gHXAdgB2QHaAdsB3AHdAd4B3wHgAeEB4gHjAeQB5QHmAecB6AHpAeoB6wHsAe0B7gHvAfAB8QHyAfMB9AH1AfYB9wH4AfkB+gH7AfwB/QH+Af8CAAIBAgICAwIEAgUCBgIHAggCCQIKAgsCDAINAg4CDwIQAAVzcGluMwVzcGluNQVzaGFyZQNhZG4HYW5kcm9pZAlhbmdlbGxpc3QFYXBwbGUHYmVoYW5jZQliaXRidWNrZXQKYnV5c2VsbGFkcwJjYwhjb2Rlb3Blbg5jb25uZWN0ZGV2ZWxvcARjc3MzCGRhc2hjdWJlCWRlbGljaW91cwpkZXZpYW50YXJ0BGRpZ2cIZHJpYmJibGUHZHJvcGJveAZkcnVwYWwIZmFjZWJvb2sGZmxpY2tyCGZvcnVtYmVlCmZvdXJzcXVhcmUDZ2l0BmdpdGh1YgZnb29nbGUFZ3BsdXMHZ3dhbGxldAtoYWNrZXItbmV3cwVodG1sNQlpbnN0YWdyYW0HaW94aG9zdAZqb29tbGEIanNmaWRkbGUGbGFzdGZtB2xlYW5wdWIIbGlua2VkaW4FbGludXgGbWF4Y2RuCG1lYW5wYXRoBm9wZW5pZAlwYWdlbGluZXMGcGF5cGFsDnBpZWQtcGlwZXItYWx0CXBpbnRlcmVzdAJxcQZyZWRkaXQGcmVucmVuBnNlbGxzeQxzaGlydHNpbmJ1bGsLc2ltcGx5YnVpbHQIc2t5YXRsYXMFc2t5cGUFc2xhY2sKc2xpZGVzaGFyZQ1zdGFja292ZXJmbG93BXN0ZWFtC3N0dW1ibGV1cG9uDXRlbmNlbnQtd2VpYm8GdHJlbGxvBnR1bWJscgZ0d2l0Y2gHdHdpdHRlcgR2aW5lCXZrb250YWt0ZQZ3ZWNoYXQId2hhdHNhcHAFd2VpYm8Hd2luZG93cwl3b3JkcHJlc3MEeGluZwR5ZWxwB3lvdXR1YmUFeWFob28GY2lyY2xlBWxlbW9uCnNvdW5kY2xvdWQOZ29vZ2xlLWNpcmNsZXMHbG9nby1kYgZzd2VkZW4IZXZlcm5vdGUFaGVhcnQLaGVhcnQtZW1wdHkDZXllB2NvbW1lbnQEZG93bgRsZWZ0BXJpZ2h0AnVwBnBlbmNpbAlzaGFyZWFibGUFdG9vbHMGYmFza2V0BXJlcGx5CXJlcGx5LWFsbAdmb3J3YXJkBGVkaXQIZmVhdGhlcjMEY29kZQZhdHRhY2gEbG9jawlsb2NrLW9wZW4DcGluBGhvbWUEbGluawZ1bmxpbmsIZG93bmxvYWQEbWFpbARzdGFyCnN0YXItZW1wdHkIdXNlci1hbHQJdXNlci1wbHVzCnVzZXItdGltZXMLdXNlcnMtZ3JvdXACb2sGZGVsZXRlBHBsdXMFbWludXMKb2stY2lyY2xlZA5kZWxldGUtY2lyY2xlZAxwbHVzLWNpcmNsZWQNbWludXMtY2lyY2xlZARoZWxwDGhlbHAtY2lyY2xlZAxpbmZvLWNpcmNsZWQEaW5mbwlhdHRlbnRpb24RYXR0ZW50aW9uLWNpcmNsZWQJZG93bi1taW5pCWxlZnQtbWluaQpyaWdodC1taW5pB3VwLW1pbmkDcnNzC3NsaWRlci1sZWZ0DHNsaWRlci1yaWdodANjb2cDZ3BzB21vbml0b3IFbW91c2UHZmVhdGhlcgRjb2dzB3NsaWRlcnMGY2FtZXJhBGxhbXAIZG93bi1kaXIJdGVsZXBob25lBXByaW50BmV4cG9ydARtdXRlBnZvbHVtZQZzZWFyY2gGcHJpbnQyCHlvdXR1YmUyCGFzdGVyaXNrCGNoZWNrYm94C2NpcmNsZS10aGluCGVsbGlwc2lzDWVsbGlwc2lzLXZlcnQDb2ZmCHNjaXNzb3JzBXBhc3RlBmZsb3BweQRib29rCnRvZ2dsZS1vZmYJdG9nZ2xlLW9uB2NvbHVtbnMFdGFibGUKY2lyY2xlLWRvdAljaGFydC1iYXIKY2hhcnQtYXJlYQljaGFydC1waWUKY2hhcnQtbGluZQtjZXJ0aWZpY2F0ZQZzaWduYWwOY2hlY2tib3gtZW1wdHkEZ2lmdAdkZXNrdG9wBmxhcHRvcAZ0YWJsZXQGbW9iaWxlA2RvdAZyZWNvcmQLcXVvdGUtcmlnaHQKcXVvdGUtbGVmdAhmZWF0aGVyMhBsb2NhdGlvbi1vdXRsaW5lBG1lbnUFY2hlY2sGY2FuY2VsBGZpcmUKZmlyZS1saWdodApmb29kLWxpZ2h0B3Bob25lLTIDbWFwBnVwLWRpcghsZWZ0LWRpcglyaWdodC1kaXIIY2FsZW5kYXILY3JlZGl0LWNhcmQEZG90MgRkb3QzDHJlc2l6ZS1zbWFsbA9yZXNpemUtdmVydGljYWwRcmVzaXplLWhvcml6b250YWwFd2F0ZXIHZHJvcGxldANhaXIHYWRkcmVzcwhsb2NhdGlvbgVtYXAtMglkaXJlY3Rpb24HY29tcGFzcwVnbG9iZQlmbG93LXRyZWUDa2V5CmZsb3ctY3Jvc3MEZnVlbAdsb2RnaW5nBnRvaWxldAZ3cmVuY2gGY29ncy0xB2dhdWdlLTEEcm9hZAp2b2x1bWUtb2ZmC3ZvbHVtZS1kb3duCXZvbHVtZS11cARwbGF5BXBhdXNlBHN0b3AKYWxpZ24tbGVmdAxhbGlnbi1jZW50ZXILYWxpZ24tcmlnaHQNYWxpZ24tanVzdGlmeQRsaXN0CmFycm93LWRvd24KYXJyb3ctbGVmdAthcnJvdy1yaWdodAhhcnJvdy11cAtyZXNpemUtZnVsbARtb3ZlBmZpbHRlcg9yZXNpemUtZnVsbC1hbHQLbGlzdC1idWxsZXQNbGlzdC1udW1iZXJlZARzb3J0CXNvcnQtZG93bgdzb3J0LXVwBWdhdWdlB3NpdGVtYXAEZm9vZAhidWlsZGluZwNtaWMGbXV0ZS0xDmNhbGVuZGFyLWVtcHR5DGV4dGluZ3Vpc2hlcgxzb3J0LW5hbWUtdXAOc29ydC1uYW1lLWRvd24Lc29ydC1hbHQtdXANc29ydC1hbHQtZG93bg5zb3J0LW51bWJlci11cBBzb3J0LW51bWJlci1kb3duA2NhcgdjYy12aXNhCWNjLXBheXBhbANiZWQNYmFsYW5jZS1zY2FsZQlob3VyZ2xhc3MHd3Bmb3JtcwAAAAEAAf//AA8AAAAAAAAAAAAAAAAAAAAAABgAGAAYABgDm/8hA5v/IbAALCCwAFVYRVkgIEu4AA5RS7AGU1pYsDQbsChZYGYgilVYsAIlYbkIAAgAY2MjYhshIbAAWbAAQyNEsgABAENgQi2wASywIGBmLbACLCBkILDAULAEJlqyKAEKQ0VjRVJbWCEjIRuKWCCwUFBYIbBAWRsgsDhQWCGwOFlZILEBCkNFY0VhZLAoUFghsQEKQ0VjRSCwMFBYIbAwWRsgsMBQWCBmIIqKYSCwClBYYBsgsCBQWCGwCmAbILA2UFghsDZgG2BZWVkbsAErWVkjsABQWGVZWS2wAywgRSCwBCVhZCCwBUNQWLAFI0KwBiNCGyEhWbABYC2wBCwjISMhIGSxBWJCILAGI0KxAQpDRWOxAQpDsAFgRWOwAyohILAGQyCKIIqwASuxMAUlsAQmUVhgUBthUllYI1khILBAU1iwASsbIbBAWSOwAFBYZVktsAUssAdDK7IAAgBDYEItsAYssAcjQiMgsAAjQmGwAmJmsAFjsAFgsAUqLbAHLCAgRSCwC0NjuAQAYiCwAFBYsEBgWWawAWNgRLABYC2wCCyyBwsAQ0VCKiGyAAEAQ2BCLbAJLLAAQyNEsgABAENgQi2wCiwgIEUgsAErI7AAQ7AEJWAgRYojYSBkILAgUFghsAAbsDBQWLAgG7BAWVkjsABQWGVZsAMlI2FERLABYC2wCywgIEUgsAErI7AAQ7AEJWAgRYojYSBksCRQWLAAG7BAWSOwAFBYZVmwAyUjYUREsAFgLbAMLCCwACNCsgsKA0VYIRsjIVkqIS2wDSyxAgJFsGRhRC2wDiywAWAgILAMQ0qwAFBYILAMI0JZsA1DSrAAUlggsA0jQlktsA8sILAQYmawAWMguAQAY4ojYbAOQ2AgimAgsA4jQiMtsBAsS1RYsQRkRFkksA1lI3gtsBEsS1FYS1NYsQRkRFkbIVkksBNlI3gtsBIssQAPQ1VYsQ8PQ7ABYUKwDytZsABDsAIlQrEMAiVCsQ0CJUKwARYjILADJVBYsQEAQ2CwBCVCioogiiNhsA4qISOwAWEgiiNhsA4qIRuxAQBDYLACJUKwAiVhsA4qIVmwDENHsA1DR2CwAmIgsABQWLBAYFlmsAFjILALQ2O4BABiILAAUFiwQGBZZrABY2CxAAATI0SwAUOwAD6yAQEBQ2BCLbATLACxAAJFVFiwDyNCIEWwCyNCsAojsAFgQiBgsAFhtRAQAQAOAEJCimCxEgYrsHIrGyJZLbAULLEAEystsBUssQETKy2wFiyxAhMrLbAXLLEDEystsBgssQQTKy2wGSyxBRMrLbAaLLEGEystsBsssQcTKy2wHCyxCBMrLbAdLLEJEystsB4sALANK7EAAkVUWLAPI0IgRbALI0KwCiOwAWBCIGCwAWG1EBABAA4AQkKKYLESBiuwcisbIlktsB8ssQAeKy2wICyxAR4rLbAhLLECHistsCIssQMeKy2wIyyxBB4rLbAkLLEFHistsCUssQYeKy2wJiyxBx4rLbAnLLEIHistsCgssQkeKy2wKSwgPLABYC2wKiwgYLAQYCBDI7ABYEOwAiVhsAFgsCkqIS2wKyywKiuwKiotsCwsICBHICCwC0NjuAQAYiCwAFBYsEBgWWawAWNgI2E4IyCKVVggRyAgsAtDY7gEAGIgsABQWLBAYFlmsAFjYCNhOBshWS2wLSwAsQACRVRYsAEWsCwqsAEVMBsiWS2wLiwAsA0rsQACRVRYsAEWsCwqsAEVMBsiWS2wLywgNbABYC2wMCwAsAFFY7gEAGIgsABQWLBAYFlmsAFjsAErsAtDY7gEAGIgsABQWLBAYFlmsAFjsAErsAAWtAAAAAAARD4jOLEvARUqLbAxLCA8IEcgsAtDY7gEAGIgsABQWLBAYFlmsAFjYLAAQ2E4LbAyLC4XPC2wMywgPCBHILALQ2O4BABiILAAUFiwQGBZZrABY2CwAENhsAFDYzgtsDQssQIAFiUgLiBHsAAjQrACJUmKikcjRyNhIFhiGyFZsAEjQrIzAQEVFCotsDUssAAWsAQlsAQlRyNHI2GwCUMrZYouIyAgPIo4LbA2LLAAFrAEJbAEJSAuRyNHI2EgsAQjQrAJQysgsGBQWCCwQFFYswIgAyAbswImAxpZQkIjILAIQyCKI0cjRyNhI0ZgsARDsAJiILAAUFiwQGBZZrABY2AgsAErIIqKYSCwAkNgZCOwA0NhZFBYsAJDYRuwA0NgWbADJbACYiCwAFBYsEBgWWawAWNhIyAgsAQmI0ZhOBsjsAhDRrACJbAIQ0cjRyNhYCCwBEOwAmIgsABQWLBAYFlmsAFjYCMgsAErI7AEQ2CwASuwBSVhsAUlsAJiILAAUFiwQGBZZrABY7AEJmEgsAQlYGQjsAMlYGRQWCEbIyFZIyAgsAQmI0ZhOFktsDcssAAWICAgsAUmIC5HI0cjYSM8OC2wOCywABYgsAgjQiAgIEYjR7ABKyNhOC2wOSywABawAyWwAiVHI0cjYbAAVFguIDwjIRuwAiWwAiVHI0cjYSCwBSWwBCVHI0cjYbAGJbAFJUmwAiVhuQgACABjYyMgWGIbIVljuAQAYiCwAFBYsEBgWWawAWNgIy4jICA8ijgjIVktsDossAAWILAIQyAuRyNHI2EgYLAgYGawAmIgsABQWLBAYFlmsAFjIyAgPIo4LbA7LCMgLkawAiVGUlggPFkusSsBFCstsDwsIyAuRrACJUZQWCA8WS6xKwEUKy2wPSwjIC5GsAIlRlJYIDxZIyAuRrACJUZQWCA8WS6xKwEUKy2wPiywNSsjIC5GsAIlRlJYIDxZLrErARQrLbA/LLA2K4ogIDywBCNCijgjIC5GsAIlRlJYIDxZLrErARQrsARDLrArKy2wQCywABawBCWwBCYgLkcjRyNhsAlDKyMgPCAuIzixKwEUKy2wQSyxCAQlQrAAFrAEJbAEJSAuRyNHI2EgsAQjQrAJQysgsGBQWCCwQFFYswIgAyAbswImAxpZQkIjIEewBEOwAmIgsABQWLBAYFlmsAFjYCCwASsgiophILACQ2BkI7ADQ2FkUFiwAkNhG7ADQ2BZsAMlsAJiILAAUFiwQGBZZrABY2GwAiVGYTgjIDwjOBshICBGI0ewASsjYTghWbErARQrLbBCLLA1Ky6xKwEUKy2wQyywNishIyAgPLAEI0IjOLErARQrsARDLrArKy2wRCywABUgR7AAI0KyAAEBFRQTLrAxKi2wRSywABUgR7AAI0KyAAEBFRQTLrAxKi2wRiyxAAEUE7AyKi2wRyywNCotsEgssAAWRSMgLiBGiiNhOLErARQrLbBJLLAII0KwSCstsEossgAAQSstsEsssgABQSstsEwssgEAQSstsE0ssgEBQSstsE4ssgAAQistsE8ssgABQistsFAssgEAQistsFEssgEBQistsFIssgAAPistsFMssgABPistsFQssgEAPistsFUssgEBPistsFYssgAAQCstsFcssgABQCstsFgssgEAQCstsFkssgEBQCstsFossgAAQystsFsssgABQystsFwssgEAQystsF0ssgEBQystsF4ssgAAPystsF8ssgABPystsGAssgEAPystsGEssgEBPystsGIssDcrLrErARQrLbBjLLA3K7A7Ky2wZCywNyuwPCstsGUssAAWsDcrsD0rLbBmLLA4Ky6xKwEUKy2wZyywOCuwOystsGgssDgrsDwrLbBpLLA4K7A9Ky2waiywOSsusSsBFCstsGsssDkrsDsrLbBsLLA5K7A8Ky2wbSywOSuwPSstsG4ssDorLrErARQrLbBvLLA6K7A7Ky2wcCywOiuwPCstsHEssDorsD0rLbByLLMJBAIDRVghGyMhWUIrsAhlsAMkUHiwARUwLQBLuADIUlixAQGOWbABuQgACABjcLEABUKyAAEAKrEABUKzCgIBCCqxAAVCsw4AAQgqsQAGQroCwAABAAkqsQAHQroAQAABAAkqsQMARLEkAYhRWLBAiFixA2REsSYBiFFYugiAAAEEQIhjVFixAwBEWVlZWbMMAgEMKrgB/4WwBI2xAgBEAAA=1
data:application/octet-stream;base64,d09GRgABAAAAAOA8AA8AAAABZAAAAQAAAAAAAAAAAAAAAAAAAAAAAAAAAABHU1VCAAABWAAAADsAAABUIIslek9TLzIAAAGUAAAAQwAAAFY+aVPdY21hcAAAAdgAAAYdAAAQ1u8/BMhjdnQgAAAH+AAAABQAAAAgB2f+cmZwZ20AAAgMAAAFkAAAC3CKkZBZZ2FzcAAADZwAAAAIAAAACAAAABBnbHlmAAANpAAAxRIAATAibgJS72hlYWQAANK4AAAANAAAADYQbFwAaGhlYQAA0uwAAAAhAAAAJAg8BW1obXR4AADTEAAAAaIAAAQ8oJv+y2xvY2EAANS0AAACIAAAAiDq6zphbWF4cAAA1tQAAAAgAAAAIAReDjRuYW1lAADW9AAAAZcAAAMtsK8W43Bvc3QAANiMAAAHNAAACzQFxGuMcHJlcAAA38AAAAB6AAAAhuVBK7x4nGNgZGBg4GIwYLBjYHJx8wlh4MtJLMljkGJgYYAAkDwymzEnMz2RgQPGA8qxgGkOIGaDiAIAJjsFSAB4nGNgZM5lnMDAysDAVMW0h4GBoQdCMz5gMGRkAooysDIzYAUBaa4pDA4vGD7NYA76n8UQxTyb4T5QmBEkBwD0QQzOAHic3ddnkJ1lGcbx/3Oy2VSWZIlxbRFQBBRwQ2JQ7LRYMEYBqQmBCCqIBRUVCypIryoYBQWxUpQQAROUak+wgogSYiHitVJ832NC7PE6+1yz44yf+Go2v8zsTs7M7pl97/t/A+OBcbaT9fnvLAq9Lw35q2X06+OYPPr1vs5D/nyYrf3/punBkcGRoWZ+s7xZ0axp1jXrGzUbm03t7HZuu7hd2q5qm3ZDd153QXdhd9nmzSBGthx7xepm7dgrhts57aJ2yf++4jH9KQx3+jtTxz4GOoNjHzM6MztDnVn//TH6io5/tj6/A/1MYCKT/HNOYSpbMMCWTGM6g2zFDB7HTB7PEE/giTyJJ/MUZvFUvwvbsC1P4+lsxzPYnh3YkWfyLL9fO7MLz/b7NJtdmcNcnsM8duO5PI/deT4v4IW8iBfzEl7KHuzJXuzNPsznZbycV/BK9uVVLODVLOQ1vJb92J8DeB0HchAHcwiHchiLWMzhLOEIjmQpr+cojuYNvJE3cQzH8maO4y28lbfxdo7nHbyTd3EC7+Y9vJcTeR/v5wN8kJP4EB/mI5zMKXyUUzmN0zmDMzmLszmHczmP87mAj/FxPsGFXMQnWcan+DQXcwmf4bNcymV8jsv5PF/gi3yJL/MVruBKruJqvsrXuIblXMsKvs51XM8NfIOVrOJGvsm3uImbuYVbuY3b+Tbf4bt8j+/zA37IatZwBz/ix/yEn/Izfs6d3MUvuJtfcg+/4tfcy1ruYx2/4bf8jt9zP+v5Aw/wx96vF3/iQR7iYR7hzzS0dPkLG9jIo2zir/yNv/MP/sm/+DebC6WUThlX+sr40l8mlIllUplcppSpZYsy4F+O/sf4+/f/+Gfq6D8r6ye9d0VUvcmg8FOEojdJFL1pouhNGYWfNhR+7lD4CUThZxFFb/oo/Hyi6H13Cj+zKOh9n+HnGIWfaBR+tlH4KUfh5x2Fn3wUngEoPA1QeC6g8IRA4VmBwlMDhecHCk8SFJ4pKDxdUHjOoPDEQeHZg8JTCIXnEQpPJhSeUSg8rVB4bqHwBEPhWYbCUw2F5xuK3sZQeOah8PRD4TmIwhMRhWcjCk9JFJ6XKDw5UXiGovA0ReG5isITFoVnLQpPXRSevyg8iVF4JqPwdEbhOY3CExuFZzcKT3EUnucoPNlReMaj8LRH4bmPwhsAhXcBCm8FFN4PKLwpUHhnoPD2QOE9gsIbBYV3CwpvGRTeNyi8eVB4B6HwNkLhvYTCGwqFdxUKby0U3l8ovMlQeKeh8HZD4T2HwhsPhXcfCm9BFN6HKLwZUXhHovC2ROG9icIbFIV3KQpvVRTeryi8aVF456Lw9kXhPYzCGxmFdzMKb2kU3tcovLlReIej8DZH4b2OwhsehXc9Cm99FN7/KFwCKNwEKFwHKNwJKFwMKNwOKFwRKNwTKFwWKNwYKFwbKNwdKFwgKNwiKFwlKNwnKFwqKNwsKFwvKNwxKFw0KNw2KFw5KNw7KFw+KNxAKFxDKNxFKFxIKNxKKFxNKNxPKFxSKNxUKFxXKNxZKFxcKNxeKFxhKNxjKFxmKNxoKFxrKNxtKFxwKNxyKFx1KNx3KFx6KNx8KFx/KNyBKFyEKNyGKFyJKNyLKFyOKNyQKFyTKNyVKFyYKNyaKFydKNyfKFyiKNykKFynKNypKFysKNyuKFyxKNyzKFy2KNy4KFy7KNy9KFzAKNzCKFzFKNzHKFzKKNzMKFzPKNzRKFzUKNzWKFzZKNzbKFzeKNzgKFzjKNzlKFzoKNzqKFztKNzvKFzyKNz0KFz3KNz5KFz8KNz+KHwFoPA9gMKXAQrfCCh8LaDw3YCiF7YK3xIofFWg8H2BwpeGL9rKNwcj0ypfH4xMr3yHMDJY+SJhZKjybUIzv/KVQrO88r1Cs6Ly5UKzuvINQ7Om8jVDs7byXUNzX+ULh2Zd5VuHZn3lq4dGle8fmo2VLyGaTZVvItrhytcR7ewKX+HtnKqX+u3cqviTdlFV3P3t4qq4+9slVXH3t0dUxd3fHln1Lqt2aVXc/e2qqrj726Yq7v52Q1Xc/d15VXH3dxdUxd3fXVgVd393WVUG/gOYTjQGAAAAeJxjYEADEhDIPPu/IggDABOQA914nK1WaXfTRhQdeUmchCwlCy1qYcTEabBGJmzBgAlBsmMgXZytlaCLFDvpvvGJ3+Bf82Tac+g3flrvGy8kkLTncJqTo3fnzdXM22USWpLYC+uRlJsvxdTWJo3sPAnphk3LUXwoO3shZYrJ3wVREK2W2rcdh0REIlC1rrBEEPseWZpkfOhRRsu2pFdNyi096S5b40G9Vd9+GjrKsTuhpGYzdGg9siVVGFWiSKY9UtKmZaj6K0krvL/CzFfNUMKITiJpvBnG0EjeG2e0ymg1tuMoimyy3ChSJJrhQRR5lNUS5+SKCQzKB82Q8sqnEeXD/Iis2KOcVrBLttP8vi95p3c5P7Ffb1G25EAfyI7s4Ox0JV+EW1th3LST7ShUEXbXd0Js2exU/2aP8ppGA7crMr3QjGCpfIUQKz+hzP4hWS2cT/mSR6NaspETQetlTuxLPoHW44gpcc0YWdDd0QkR1P2SMwz2mD4e/PHeKZYLEwJ4HMt6RyWcCBMpYXM0SdowcmAlZYsqqfWumDjldVrEW8J+7drRl85o41B3YjxbDx1bOVHJ8WhSp5lMndpJzaMpDaKUdCZ4zK8DKD+iSV5tYzWJlUfTOGbGhEQiAi3cS1NBLDuxpCkEzaMZvbkbprl2LVqkyQP13KP39OZWuLnTU9oO9LNGf1anYjrYC9PpaeQv8Wna5SJF6frpGX5M4kHWAjKRLTbDlIMHb/0O0svXlhyF1wbY7u3zK6h91kTwpAH7G9AeT9UpCUyFmFWIVkBirWtZlsnVrBapyNR3Q5pWvqzTBIpyHBfHvoxx/V8zM5aYEr7fidOzIy49c+1LCNMcfJt1PZrXqcVyAXFmeU6nWZbv6zTH8gOd5lme1+kIS1unoyw/1GmB5Uc6HWN5QQuadN/BkIsw5AIOkDCEpQNDWF6CISwVDGG5CENYFmEIyyUYwvJjGMJyGYawvKxl1dRTSePamVgGbEJgYo4eucxF5WoquVRCu2hUakOeEm6VVBTPqn9loF488oY5sBZIl8iaXzHOlY9G5fjWFS1vGjtXwLHqbx+O9jnxUtaLhT8F/9XWVCW9Ys3Dk6vwG4aebCeqNql4dE2Xz1U9uv5fVFRYC/QbSIVYKMqybHBnIoSPOp2GaqCVQ8xszDy063XLmp/D/TcxQhZQ/fg3FBoL3INOWUlZ7eCs1dfbstw7g3I4EyxJMTfz+lb4IiOz0n6RWcqej3wecAWMSmXYagOtFbzZJzEPmd4kzwRxW1E2SNrYzgSJDRzzgHnznQQmYeqqDeRO4YYN+AVhbsF5J1yieqMsh+5F7PMopPxbp+JE9qhojMCz2Rthr+9Cym9xDCQ0+aV+DFQVoakYNRXQNFJuqAZfxtm6bULGDvQjKnbDsqziw8cW95WSbRmEfKSI1aOjn9Zeok6q3H5mFJfvnb4FwSA1MX9733RxkMq7WskyR20DU7calVPXmkPjVYfq5lH1vePsEzlrmm66Jx56X9Oq28HFXCyw9m0O0lImF9T1YYUNosvFpVDqZTRJ77gHGBYY0O9Qio3/q/rYfJ4rVYXRcSTfTtS30edgDPwP2H9H9QPQ92Pocg0uz/eaE59u9OFsma6iF+un6Dcwa625WboG3NB0A+IhR62OuMoNfKcGcXqkuRzpIeBj3RXiAcAmgMXgE921jOZTAKP5jDk+wOfMYdBkDoMt5jDYZs4awA5zGOwyh8Eecxh8wZx1gC+ZwyBkDoOIOQyeMCcAeMocBl8xh8HXzGHwDXPuA3zLHAYxcxgkzGGwr+nWMMwtXtBdoLZBVaADU09Y3MPiUFNlyP6OF4b9vUHM/sEgpv6o6faQ+hMvDPVng5j6i0FM/VXTnSH1N14Y6u8GMfUPg5j6TL8Yy2UGv4x8lwoHlF1sPufvifcP28VAuQABAAH//wAPeJzUvAl8G9d1L3zPnX0wGAwGgwEIgiAIgABIQiAIYqFIioQoiqQoSqIoiiIpiqI2RpZESZFoW7ZlWXEcx1Fk13Fsx3Fc242XOHbsOotjN3HiNHEcZ2mS9n1f0yxNmqVt2qZJmuWliwl/5w4oW07a976vfe/7/R5BYO7cmbkzc5dz/v9zzr2Evrry6hHuH7gJkiLjZHtla8IWOaBjAwWO5+gwAcpR4JYk4HjK8UdFIIQCoQuEFwR+kvC8ME0EXhhrSQMZ3tjRnh5vGbdMTSUpSMmC1QYxScSPZTdCZ75YKuOnM28HJBEz7D5ohyx4IJlKQszPzhPjsVQyVS4l2yGpQyNEoB/sgN2ZZxeWC5gNP33rm5c2bMS785M+odi5Y9eBbbcVuhWq/cZlqXw3NZX1g7Nz0OkcnDowPrKx2CNT1z+vHlUrg7N7Fm988/EBpwxuotJ39PhbZIWCuX/H9vaOvq61io/Lc4pt/FB2ib1DyXSVrx2KRn73GLv6RlnGOiFEIwTr8sdYlx7SRIpkE5kjS+QcuZ08TJ4jXyLfIk9UHtOAQpinhO7cQnly3ekj+3lOfCfIwovgkr7xPFVcXwNVkYfdeB7WPlky8JgkyNISkVyC5DpKFJfqUtQlDfCePJAFHXjCCTy34AGRCLIoLHgBT3BN4salThPVpY59+cuPPnL8+J498RghX/7Wl7/53/70s5955LlHn3vH24+fO3791VfuWdpzbPFgrBgv4rPrSVPwY8uJDWDZPZAvrYNCMh5IYvnYan671A9OAwkxD7BGynWwZmKNWXTych2Xmq6TZTp5TnvjhbmO2qUdv1X672bgRfFLV712u/ilknMdrxXNsvyXniDX8YbbsQtzHYHfKhu+yksSPyRIkvAxkd/NUaGXV+luSvl1UB3HX57iniI4W44e4unv42CIcwr/+4BZce6Vr8lcHE+/Hy+rbekXeEkUnhVEUXilnRX8cZakWyUuBpefSFde4mitFKryTrEifI2ntVuqtVtz1QsS5zwOr9A5HHe9v8eKHGJFchN4m9V7tYPICq7dQVBoHC4r1nla8SF47UVY6ZIosjJff+V/EIWh1bIF59epl/eKr1UIewIQ4LVnY6WJ18LrlcHuJ1LxtTdkz9HlPJ7E4w+OC+ynr97HRbkoypjByvomEHjLRSmXlLCLc8MoSvgTROCEE4Sj3AmCY+MEyhkgJwjAIpBopD7k8+qawDOhIqFQac7blhhLFgulYjNKjGQBZUqgucAy2BGUIYJtSUKJXuibnj47TauvtOYx1VdK4hNjxnRfIVn9V0pBTLw8dQ53RYO/L4oHIvfxBt83jXnR++SYfF+EcCgfP8zt5Vz4WAqxSVslLQARYJgIBB+YcPiUHHAnKAAPJ1AeLvotr+n1ikKoDQJxoVOBznJTs6VDLEv7IB8BePLk96G3+CqpvlrshjjUn3rpxy8fF699/lefOAe/eeJ6uLF6bqZ05YvLyy/+PfshBOvw1Ss4k3MTmXhJhHSRLWSGfPLZTUMVjrhgePPTyvh0pUJchLgOuHVKVUWlypIHFE5VuKMaym4VZbcsUl5QeeGoBIJwHKWHqpJJJkTUXUQl6ub6Sj8W4Trxny9hptLc2Ogzp3dNbB8ZXtfb2NXYVezMtWfa0qlErC5oRnyRoGEIdhsOxCzo1A7kSwWU8xEQ8rbkZ22K47MkeC2xDfxYZ8lUMe5s2wGbOeVtjoC/qVAqp5LlUiOU8oFyyZZ8ly7sAxt8ik5VW+aNXyqaZmK6OhSIQTQXi9E3Jepao/kobIl2RAFaQjGAG3pGVl4ZWpfiRZlPF68qpnmd/2GsPYb/dKNzuS3T1e0VscDPg7FY8OeBmKt6ayhxQzBKE/YNuIFY4IZECE7/IHJ8YOB4ZJPMc9JoMDgqSXL1A7Vr2ElOOx6hL6J+kIib1JFWcpzcSx6tPPQWHQeChXpWh4vXUFE/NeLi3NIBhXLu3aCpE6C4JFTFRCegLxFR53WRX5JB4t285F4ibo53c0wvCC5FWEIBTokHNbSBI88gC3gVL+n8AnZVVePUeVRTLkVzLRDB6xUmiSB4p4lX8I69565b3n7D9WeuWjq6eGjvnpldU5MxO50M+eOtzabQ0AZSoFQsxGNcgFU/ZwXYmEsl4zGRsyJQzqN2TmU5KYa6PuDsM0mbykIKAYAVoXm7zPQ+0/E6IBzwS6I/mRLjNjaexIZymWl5vAMrUcImZoMZ70CdjS9Q7uMCeTxZinABS6dSDIumVmVgzm78uun3pe0HZhRTaRpsqXepa7pHLFkDU7IjaV0LT+tNF6ZveEJXG5+qWJIUTObyWcPt9nJGMmYmcmABNyYIJmQas/NmrK1RMvYbwUglVzAG40Zgd7Zt0zEh7UrGsr50diaWsUUoLFzY1de341p6w7PaK83RKtcR0CUefl3+ici9eK1ZHbPmxsGQ3BlvtpDmIi8F4tvn4FO3N7szSjgMIpcIGxpP/Zbh0dyhsaRZ8Yo4ok4DL0XSML3GZ7Z2y7LvbL5x7aCn1YgPygA9a7qqz7uPN06UMrQr3fsbOVbKN++440gvBKJ3o4yl2Lc+zCnYt6IkR05X1DTwXAiFEkXxoKJ4qFuVsDxKWB5Q4KKEPcFgy2L95qddeIJfgH/v4P/gwpmZitLUlGgy40zaNa+itxj+1lqNNSg2odPqfsvmLAfhSX1QjgDqY07xt4+M1HfmhmYbdj5ybiG97Ks7mR4oNjRkrMTYA02JSMRK0h37gX5oaONx00xC/O03vD+WTFiJ5oZC/8aT9C2xyXhElbgdZwJUpiJParLyn/kz9EXs7gppJEmSJeuh65kyqJRJSh++6TghbnATWCKgSXAAMZPCC4dwSGqSW1sgkgeoKtF9KAxVzqWygSMLnDxvABt3k1isLir6Au7y4gwReXEL1qCF5W7/3XJlQVn6rxRcmbisTDdoR/8XFIrNlnKpAr++v6M9m2lJJROxaEM44Pd6dLfa6GqUJV4RFK/hZYK6yd/ExnRnksMR3smUbZk1bQTHsNRk2c0I6gttUOxk478NUk35CGWDFHCQcqkmXqr+EBoudvZxP1Tn4gPKdeVnr74Nbl/ecqoboPquysrkI6dOPHZfJg9H3vU+GMuNDcQWKhUIZytD6eoT9K6NH+zuXKp+IhF54o5rlu8dO7tF8fYNNuw5eKS1dfyMkRjJH8p65ze0DGWjBnZIAdv+btSTnaiM/KSFDJCDJFZpnOrvjaLG3shwCEwipiDTDJOM9a3Ld1BGUWwRhQnyC3zqLKB4QvnVB74sw5cSipoI4kuboUufzklMJ2U55CjIS6LYj0WfyOE5IuZkaTtFedfH9bPCsNvbFnyBrzT6Dd22WiN98vFyvBW4icXBG1xpLf3+e4OhmMsoeDpuuC7vyXfwKh/25ZaP9dSlswmX7uXUs9B3VqPyIU87Fwz6Lr78zu2yJoPYKOoCNcyYXD90xX97dCqmwOl4xqdks4pLjqq9lTrPYLJzRJmCfR6LSqF6XjQ9hkVFwyNRa+WrelcyrdWHEMepVsRXWlKEHTtQhFPffPXn3rApD/k9/aIRlFqfjO1P6SHD5NSQ6u+oa3Mhd0A89CrKmdlVPFRHuipFxgcVrFVki8gNKeurAh4V6DyH8oeHCdwAP82Ex1ix6PWahiMu4vXQycW5zjKgupeasGN5Uew35W149eGJG5985tfPPPV/w8z8hpW/G1iA+Q00MLDwKyhUg7R35cWn4dqVHw/Mw8J6GmQbJEJM/vFX43PVIfPaRXaTn2x+2sBB2augWCM8dwghpSCQAwZ4iEY92oKM4wZlJOUXXCBIAG4B9hG3rrsnidutTxHdrY/iwPZiGesuL4MnwtH/b4VU+lavJ0v/qQJwwEamp6d3T++endm+rX9dIZ9pZYjKi/orHsNxitq5E7UqA8JlVLJx7MVMD0doZ765dqB8+ZGAc4TR6RTjVU1RxqEkBsciFPt+Z5R1YOzu3iYvfHxZnt80e/jw1h3z0pu5WEM0BqIesYtw12mJHYDDWyfmpVM0Fo4mgDfCgfrol806jvfnqk9UH2pXJZWrM8AM8qrGB791L0x2+EUIGcf+7R0QnTkIN37nRtg/k0jD4PpQOmltZVknlt6Q17p4+mRM4PREQuRlvunkj082IcnlTTOh80LTSdrwyqPcLCLjS9ybQx2gIugxUQbUkTVkTaW1LhjwW6bX0N0aUmvkTljh4EdJMOwoM+zWi60t0UYmDMpCMSWVU9CcklJl9i26IVCUys1+RKUSiLEUJIveQpmBT7CvgfFP/NGxY/BF2P6eT7Tdc889Wz5RfZo+eeyP3lP9Q/iir1rWglq17PPBFzGBGS99/4tnrZGRav/3D54dXVxcLJz94vfvGbndOvj9LwarXw+4q1+TJOhwByAXcEOHJFW/5saHC7B3w749QYbIVkT+C+QQOYK84ypyHTlPbiG3kjvI3Ygkf588SB4hT5KnyUfJx8kL5HuV7/RkqUd8AryeP3zqrnfd/nu3vuOWOVX1fur5Tz795Icee+j9v3/fve+95+6L77zw9recu+7aa644/KaDu6Z2Tm5bn46baqOI0PeZjy5zulanUWAQVEVqo5oIPcWgQT1e0TOvSFQgXlXwLtQF7AZfWDSRrfktQdNNbZ7oLqJPusGFEgCJCu7rZBo5I7bO2Mc+tri4b9/HPv6xj3/kww8+cOe7rz975urTp44vLR5ZPLLv0L5DC3vn9+ye3bplbPPoppHh/r61XWVEh535jpwX/yKNQl0bWKIHGIB0fnVIxbF58JtMFcoo0YvOb6HUj6l+cMhhoLP2tQOWVIOT2N+hMxWXMBPCIDVCuZgSpeZ4oBkLAixBiuO3EfohHhA6y3F/wE51llMe6CxKtjeHMEYKFMv+QLkdJH851RwXAn4pUG5O+QWpsxzwpeIppCbtwAWgKPmwWKmfJovlFMJo/mpdO0V17SiY9cpfKRHlu2q9CfSoptPTLt1QT/iWqRVyfQePfM85ctpt8odd+sq3vvnCthe+qNor/wLL8hWHJQWu+4sjULxPCcFbaFz1um99JP6nSvPPPlGV6Qtfp7L6V4kPTR/bvYfye707Hz17PT11BH6iVB+5+tGnHqneMwaeQPvDb9sEoAlnpF89WW3fjX90vn6TfRro3pE2Cns1k74kCJrBPS/wbhNUl8tl6rz0SWq6BOElzrRN+hnOUr4k8tjsGiNenPSy6ZbkZ6hZ7fr85xV4nrq4L3InPntMgH89cUJZOcRxyUzPnU8k/sTz5Avi5z/JcX/W/NE9112xX4AvASjSgbvFJ6effutZ/s7Wk8L11wef/sgTytb7r6v79kWY4zR85T/jqtVnIXj9/VXv/fefO5f6ksApj1Qfz9KaveE27vuoCzykvZJBPMPxMEiAwkkcTSiG+XnCUcpkBUenCOXoqNdrWYaAfcrXxAnN5U4p0FxuYp97ueE7q/3V61KPGv8ARnJlTxN9v70yz7lWgnfd9dLEzMynHzlKVvH3EcQeEwjM6klnJecBlDHDApCN7ChH6AIPOAy4SdxwME1wZ0zX9Xo9VC7EBCHQhtqvs6mMujCOurDYnEIqhFpR9HstO7C4Ce7//OKm6timRfr0gURd9RehRDII39h05OVXvjJ65MiodfAfQ0lI1Fd/GkoAeY0PzGAduEkDex7C3p/QJXwWoMgWBcLMGAgXeZ6bxIpgCppjCrrJ1+RYL5pR/OP9A2yTL/lWlXRxVUlzxeqZ6q8KowDvAFdhNM709IZ5pqY3zE+ABu8Y7az+qnr1KN38RkXN2ubDtAfrycewAwFeUPHBEDsIPLIMTJ1EXY5NxM0TBtUmmP1oionpUZ/X5/OajmGFC3T6mzw0XsTxVWzqp52054P6+6p/U7fN+9gH3fdBPSY+QD9Y/aT3x8Z7vY/DRu/feu/xsnqR2Q9/NX0GK0DBuvGijmggzYgWL1TeHgCZyKgOJBSuAqBCdi0RyQYR8d28R6HU56bMDD5fZwV1v8CbKBUFHua94FJV14Rjbp0ycHSoo8lkKKTrqiqKyZZkSzrVnIjHmqKNkVBDqCFcj/oIZY/P1L261/CobtWtuURFVEyv1wgJwTZfJ1Z6p7cY9/twk/J3FgPYCMXOYrzM8i5LP3uq+o1nN/71qVOnstCCyWdx51KCPrPybXhb9Rtf/SrmXAdve/DUqQdXfrE7O8cyVhNEfs2+pTtsaQ2yx14ySfZBqmZWCgz3l4sxgXJe5JLr2loCLioSiRuur9HKyw4Lbzj8H144M1MrOC8KlMf25hEvSti+ElnCFuGowi1g7wWJMlgny/gsuJnGhpPHVu/ZR9iVAr9EeJHy4lEiAhXh6P/rUv4zt0YM5t87PzO9Y2L7+LYtY6OFfLLZyqhIkZqTqD5QGKaQ7nLMpIFUN8BIQB8gKUBglReSEuYAxHJCMh5jaa7sS6Yk1FtIHZBcMDMWEqd8I1xmJ6Q9gTJKwsjEyKilvOmtm2Iu86kv5daEJ7YO+v1UXbthaMsR3wdp6soTHXbfZBVH4uibLrRlNlVSg+mocBPdDoIYNDMDLXUc5Vr86WQ0apvC4GXWRvfNtwOntea3tomTcLI+XtA2nuvomM6nEYTQM1fPJW6ZfFuT921vaT0Pf799t7r3ak8yEhOr//aWgyCJdb5Iq6eIzBP1OU9FTrjcYlnjYh/mXuQMHMs+RDD12Ls8FS0SDgVtC4kIEda0+QSpWfAL/qJUbC4GysVA0R+AgJAS8MuO/RVYL1R/Rn9Y/SlUfzbxAnymev6F6k+epz96vvqzF14A7/PVn8DLTzzwkft7H0aGAQ/3lh5g2wfoxx744N133/ORB+CXH7n7gzVucApl4QixkRvsRsz0REWfAokrAJHo8DKIG2smkF7Gj0+s2qNlxx4tUY55XrBTHGASlGA3k1GEyhRFmaI4dFKZIQooyNXX/ceXU4kc/Z9cP1Ox9i1MbN+yeeOG/nU93dk1rXUJFfUC9h4G4VNJZkhDuJIv99FyCbsW60uiJAZsBtbzpXzJLgWw3zDrG2L7LI0hIhJrJjnRMcn1Ibrnys7pZUunSGMLfQLrpywDwT9eKtJ3cqq30jIS51wyz/t6S+FALshLQZfLHQm5jbAuibJOZV6URVWWPaaMbyu4/1jUQvGREcvT2lrobqrMAbQayVR0YnDA52lNJjUrZHrM8OBV93zovjNDSJxzybzt7nFFvVaIG4nWLQQ1K5vORK24S0Z4EaYSpwmmTqmlieJoSFZEKai7eN4FsixiX5NlWaUgfVALBY1sDiAYidkwXe5vcKmQaE1SiKUTQM1QYPDU7vsPV/je5Xt35+dGejMxU4iItu7Jr5myjYwua+n0wNACWfVRfJgGUC9ZjrYEFCrDzB9xkpmUQCQLAgClMIEboFM801mjcQZFfU2SUN8G/jhzMnVKcS9+UDwzKwkN7MrFHrZve+K225b3TXCb351OH3mkOg2PPXLt4VPMd3BJR3tIkDSRTKUF+SElJ3jmdT0hAHMsrPpAGsP1AdtnKiJBocF8IIDw9XKd7CskdRqBUjMzqFuYoM8xfVzTyn89tH+QjsyPQtfgwUH851wL6y/Xy9UdHUN0YHGADnVcSpDauPkoPp+KfMoiEdSRgYqVTsabgqbh5hQyyIhTGpivECU7Auw+CDjmPtxJlQhXItirsO8mBRSLzOwnSjZVPlz97xtcp146nX2pkP5m9TPrCrE+6P3cekh+wZYf+teBbho9tm/zVO9zp1xrErS6ofqLj+RzKFtgS6Kzv/qZb7XkvwF9K7u+AK3rO7s3/OsjsiucaNdOPde3c9N+UqvTp+kfcTtInPSRDaS7UpaBIxXAOh1WgB9kkokTCLOTUYRoOAx53hmGqxaKnrZiqivhoIxyKZlyEJDFBgnzHjIvdFJirghs3wDj0CjAdZ75SjkcbU5LBBAdSRwOKZr1c4ZWRdQO3PvdpvdmxM9uiRruhw0LbM8fq9Z5pRVJM9X1sO89kvp3WqsYac3Cz4oJbdrnzdCFY3ippa68l+df9MiGMhLTbLCNgGGDfnPLXzylalpQV13VXyAR1lo5X2MJerurw/um/7xmBz3CfRb7M/YY0kOGUf4sA6kEZyZ8Xp5TRzqoh9uUoZKHGzZAgKHNT+soAWeJ5jVk7RARZYpDbYlwqkflPCjCPIpHUpYIE1XMwuMlhuA1FpilRxXogttFZR1UTlb34e0U4lF+p2LrK7tZ4V7NWPrfUPpMJX761InjR69404H9+/bO756d3jU2umFgXW9P99pyMhGLNzWZiKyaC/GYhXq6kEzF/Jjw+bFPMheEDn4rIgSsOKpfJI5F5pEoZiGF7ZkP5H3xEjZtqpOh8Wa/iCdx65ABxmOpmMTGOjvS6Y8lmdeqM4+8lOlwG8bmphcmm2LRjRsH7raCysRG2w4l89lWm345OdiXWEzG0wU4srWULf36LKVnOZhIr43nwwaPZJvT/CX+Bm6vHJXbc7HqtzKVDGQGWoWu0/D9WAa2bwY4KYnBwNBBt2AFvLauWnau8XE92tsy18TZuXUezj2f3XIYQtX2ug6YLPp8+eoHOw4ct4OR7kziRez8R1ojVmDjEfqVTTQezUNuIAd5sjruP8z9Af0c0RAdd5JZsrkyMjOxdZinshvlE8dGkiRLJwg246qwwuHEnUC8LjDoLIqOY0mcJqIgju2cjDdsLsfMtrBPFRramC80y/WhrBJeSwUKjjKLOf4kyUIt1ZlHkGQxXBXL8inWGuyLxJ15FJi6Qu5uwyE9lk1o1IjmIyYcuGxneuv6wFR6IbUzODAGidLEaHY+OzrRFTsXs0cnj0zl20bmto51++JjnvC62XUTsztGu+d6GjxjT9jZNE3k04UY35oJvmFnwzwqI21+Q8dIxtaoHEqP3bG8sa0vZmH3U4OxrsTG5Ztm1uQrazPtlplthbWVjjUzBBx76QjK+DgpVTpRFFAfsBpk9YhAgCkfZhGcx14MTkAN44Y8jPmb46lmx1IKTY51g3W6PopvL2ElOSLeqaM4PAl3SovPXzN9/zKK7ZPvn/rAmSsHF0euHcH/3EQhbQi/hPc1x6759LHBUw8+9eCpwTef3DB67d3XjoaTpYz/Eld8URDpb/AZ28meyqwHtRvyGIpPqVIBhyCOUCSHEreEepEiX1uQQeQFcUJzKShLeUlgjBrlKiOSzLrOkbFEItGeaM+uybShivSyt4m7maGS2WlwjBX+vVcpNtnN/rg/XmQKtNPPxfZ/5Mod9xyvVI7fs+PBUyfW79+4PDi4vDG7NZ80+B/DjRL86Er2Bzuv/NhhwLMexZOPHu0fPHPxzGAomcuatyYSVy0v4/+lfl2zEarExJ6dJusrfV5sDY8bqXEYX5oFI3D8CRFYbxZWYxAoIC+liz5st+aYr85XF7CxxVRQmRr2MYUXRzBWKgsiU3tlu2ybgThVwELwxw6g4rAD9n/3qXcV/2X4ZlFFYVbfljkQoFdd/9bHfK8Eqj+kV3YlH9LXUFV9WTP5Cnxb/8qP/vuHFBO+cOLYk/dfd/7T3/1Ydf57cBo+W33hH/8CuiDx2P2Krms/upznuxBjI4JQBOxdBLELz0zyPJnHTsbRCXwDbprhmbFiwfR7makDfHHEj+0Q9/k74bfoPbx4Z/8u3RXYteHda+Guy8k9xMB+qj7Y+VT1H5+Bf/0tK3zteW7jTHweg/jJ2krJcokcdbQuL5B5kcUqASP3DpgiDEsx0j9KiIlCnxh+y+uVUFBDucnX5AF8ukboLPuaUhwzzNCrlaoZgint+HFpn/Yl+nK4+l75Vc4cqX66+gIV9lf//HxDw9b3lcuQOwTiK385O/s6F2F1xOInQkjrlsiBygKORRbHoVJJUg8Rt0unouAWmdLB8ej4ywn2g4VLXV6RqaRp0iTbStoM0SRtS7T+yKH5mYnt63q7Hftk/WR0h8/Cj+lhA7eQxN5tI0pAhQB91MZtLAulvN0cQ8jAbO6O2V3Ej8XCmhi6txHG2zVI3keTJfwUWJBcKguxpIh9Ci8RmfM7lTTYOaUow+027Zk4M0Gnlqc2n//4jfTcJ872RzJhGk3Hqn/Dp3qswaw33KqJMnI1/BNVrTVs5AZax9TRTKXgDmfU1w+5WhuM7FByHB7nhPOn89X88nmBw+RyB5CO5XMiB/M9k5NXTU727GY3OkdvvOCPRFojkUXkBC5W7mByXBxPDgbT4VaXqPLsT6bqv3uo+v7zHU754rkrnfIvpR0c91H+am4r6qAM2Ua2VEYxxXMav+AGToZV7IaNC4S5TlQQJQEbT1IUaZJIkjJNFEkZ2zo2OjJQWdeDGCAWbzbjic687kghx8rGLG44Ngup1XSWNUrAYggO5W2TI5ZomQWjMAlMU4j7nGijHmZNxiN4bWfe5nIhu3qNFQ5b8HZ/+Gr3ynec9L91PPziY/tBowl/GPAMsePhfaM37+/+WtjapIycfXzPO35QPsLOHFVHr318HveusMJwI+akMTPXHk6Fx+f3P7YfU+nwtvnuhVv+whfOte/50Jmt3J3XYF57bs/jZ0fg7jPhVdn2tNPH60mJTJDjZFNl6IpCA474A/t3z06Nbx4daEs2R+qZ1Qno+nUCh717WAIWciUyNoPyjjlDeObZXzq6sLcu1R6MpGRmCWT+oRST28kUi8wo9UMAuaid76dcQEqxTt4IEuulZWZ1dwI8SzarY7xATLZDOYCDoNBOy6yTSxFgkQC26IFUuYRDBLf9CJeYVs/bdOfMocT+rFJJtw9APqmFEtKk6G/p9h+aPSLtlPzdaWp/enL2UDKop/KD7a0VqX0e/nYg11KRc4eT4qRkdbf6vU/tfMpIhLS2Luhq00PNIl7Y2m29sHN2p9F8uF2sZNoH/21mMR7SUgUYbG/pU3L749JO0d/dYi3OQFpyzvd/eufMYvPhnIzPMtiVdoVWbmkfLKWMYBKPW+ley8DbeOP7s+IAHW0bEHKLzewA3v+FnTM7vc0hT2sXDK7KxH/hz3ASts02sqMybhEqIZ8QpN4E5YUm4Hh+mElBVDYSnFBBEqQTMghIVzgUREwboWrFzSXdunVs44Z4IhlvTsZbii7Wn5k/Hru0U/1O6EyZoSRmDkAlxcJnU8wyxYRPZx5hbr6UYghYYmjKlpyGaqdZKiGN+cd1W+GmPStb9t7U1ynNrS+2tT58cM99c7ASnN+4ZW3IKze3NbZCpiGYTSTS2Up8cB7mB8fLhebWhiy0NgYzZnPKyvax/IfqTg7uvlE8v2fd4YgdrMxC09QRmL1392OD412NlpxI9iSDiVwmbdHxgcGtUOqNJxqiSdtqzQZjYbrV4eT/wv2YLqIQLlQ6ZpLNhKcAw6hEJGDWO+TkWLd0EjeUTHOMO49l2ltS6eZMmyyEcZgHIhwztbJXF7CDcgxu+K1aPHFAlDqcOkk5YCQirkYgZUWGN0tMrnZEKGKUVAeDpfRPRcEMBX3PXLWjqTvTGo4aumXGcoNrivu7rpo+sKbR0y4bm35v4sIo5CaO93SMd+eiMTumF7esqdixbC6fjvF0f19bLiTqOj/i8bhb65PwRc4ybEOU8m/ffsyK5nOD2ebimu683XewOHNzMdGw02ftnL59e8/JyYIdK3WPDIw3niytCUYtQ0fM2aIofbNAtaBoBLlyvaYlyCoH/jB/Nf00i1dE7neysuQDiW9vpJq6ttCaCAkgsqFPBl0IYjTUfgiAGLg9wDHIc1IAXgZJ5aUFBXUigDjJtiLMYOWLsCWTCQYyPZnurlI+l13TkopFI+FAW7AtFjdjMa/BFJ/PQfKSA+pxj2F2/HIoF7hL+RyTn4FSmRNXd4GdFOCjuzYNnzh2bsfEuWMnhzdyu66//cadUzfe/p6R5V0bF45fP7nj+uMLG3sGFwonFxZuabxqx+TZ/bP9G5cHlucW3kyvXumOdu7Y0RmlLw339Ky8O9pMuzPbtmVWXgqGTFi3zoR/4yZ3Na/8Mhxe28tdqquvcDP0VUzppJWMVoZjSIdhWFIoyAKOwiWRp4gJTjK4LjOlg3nyJJFlFvkuC2OEtKSaouF62/Iabk0RGRPyqoK/zeeNex3lwVQGQircrUW3IYuMl9ZBqtMfR9Sbtz/33IvdWch2dc910Xc+m83Fs27xOYDnwBVM9sb2LsOvV75BW55oKZUmSqVqpfo5SPcMJBu84eqXv3fhkfpxMxQ14BySZ3yXw9wUt4NI+C5N2JZuCEMLrIPvcxnHdL6+DRpAJVeSozikZogbQaOEl+EzQ4jcx4I2UJF8hnSQBKsY3Ithf5ARB30bTuJRA9O/Id/GFLvB9/AYu14iw7UQsv+gdP6/XPr/rse+5Io4QhQPeBRYwgJRzIpLROSR4BxFyAq84PjKBGa/lbHUo0Q2QDaOEkMHQz9KdAl06SiRXCC5jmrg8uL/UeLBocJ5EBJ7VdU7SbxeddoNqle95MI4+dodEcgggcY7sxsf/a/fGIH1f3BfZuE+eNmb8qh3llCW/q9/x/8/K3RmZmZ9Cr4KfwKfhk/BB+EDcCUsw26YhV0wBTthArbAGOSgnayQV8ivyC/JB8gj5A/Ig+Qd5BZyDTlDriCHyV7kSWUETiY+mtWGcCcuspBUMSmVArYUYxFeARYxUyrkU8VUUiikaui8FuKK9I5Z4h2UXgPrfImFiZVYeLJol3GwZ2k7iAErngUsOOkYORjGlxxI5ehpnfpZ6BnqK8yvhZBFENSKDvhKWqicnGzUZh5wMpn3CPkli63UKbOzipYTh5Ysl+LMLdAINsNbooRKrOQ8GSICu+w8FJ7JyiuWELOVOguI1krJeNKPClASUQ5nRTEu2g5MyDrzK+yA5TgVgMV3Iji2bPaEhXyJ3QBvHxNTDp1hsXEozbHCnJqgjBeXsk44keNkYA8oieyxLCQ97BkjlNVkOzhvgoq3j2LJzuuXHVZd6iwx1wR7IYfpsNtwcVadyXISK4xV8GrxTv2XyhEBTqG24tQyJ4s6T7/AUcrzgkBVJDjMQfSXjatkh6dCq8/ty5mi7ZWpIGiCwosgm4YqarKlRGVe0/2GiHxJ4vDr6VVBsA2z0aC8hmRRZLxGV7FYTbUlpD+aaLjqIxCUvCoVRLyr7LLq6hoigqoHVEvtqLm6BY7nRE8mGghoFAxDVt0ZNhQ1k3EajlohzuV2tRcUahp8UETqQGVEO6oY2jBa59bALfAatolMdcVKtlafYr431MsUB9rfA68JPHs5yXYJ4kFRFHjmaxKwlmUqI+Hi8J1FXlBFWId815RDchj8JY/S7Vc10TIO+111aSscnYuvVYMaL5hYsEgFKad6NdAiZtgnIC7geDCpT4t3ubsS7mAQH821oT5Zh9QQVEPQVXx9V58sUQivsRORbn80STmfryuSlwVeFQVDj5qqrmGTgmbLssslRAr+plhLJITN4DMRGsuyrup0CVTgJHx5FTEC93O8lDWOSNkLArys6h7JkA0RG4+r73O5ErPrbaDBoTp/TNbxNeNZww4kTIEaNBwGmvCoqkBNv9fWsIQhRcDmaUxGvXLQBOoCw6WZELSogg8ms/ZVEWoqiJNYu3JUlIFT8El5hEZuEIUQQnZgER6UORbkmO6OewXK67Fw0uDmo2qXoGvehMdQuUSXpLjcyVaFtWM0EnQnBZlDkis0KEraL4fcSbehDni17ryu+k0RXlQMEPBex/A1eZGKVIlw6vVIllnXoR7KwVuBNaqMooEXsDNh9oqNkFI1eNOkrrSh8CrWMVJkw9QhJqlUliUtLyhhM4jNz6uW2WK6OJDkoCqJmifpFXjJxZky5YKRhMs60tDqE9yKZoRCrnTYE7fUbQ39xzsHgxp21sB0qjjQ39O0nAunLQ5M28Auh90fLDnbmBpKpKkvbHpUy9IksTUpm2ETK/KSf+1fuG/Rz7HI3AoOXIAhFgmGcBMpPDj2YkAIj9hrLOb1IlaqBXrEfaWks4njN8XYOtLHr8594oDc2Lj31CdOPYjfnfTlrv2xpiA8VJ2Crzc2r/yEWuz78Uxr+thr9uyan62P7CAHyHRlZwCYN5bAVmaRGiZu6j6hoKBAEuaSRY4nKuHVJUmgq5PsiKpp6iRRVW2aaKo2tn/v7K6JbWObNg4UmvGTLyYTjmEBuQazEbBpLGzCg4DCns2BTK5Op+uB/KVD/95ec+10MeCvHXOmrPkuxQR5a/YK+h3D/Wa3gT+6Xv1ZIjKa9BjJTQ0JV6NmuItuw9mW3IYW0WBTsuHdDUnQGl1m/EgkMTxWXHm8NDZWolPFMTjbrxuge/p1VLy3vjOSaGhIRN6paefZvvv864n1U5FEIvIjTTsYSMCVlwrA39fijJhN1UR2Kz9TZ1FC17SBV0LhX0Cx7HcIV8ArBJpRoBftAJ2/54avXwUnXzxzzX0feit1+6vfnhiYvfcUN/HKB0a02dvHt16Y0xf857btPO+lv/m3b/a3p4wFH4uiYrb0I5yO91oik5Xt0+PbertzzRLHH4r7sZeJdLgBheDQIPAbHTMu4QSOeSOEE8wdRkVsRRQcdJJgM08zu+7YsaP7FnZNpVPxlCUJgbZmnYsxzeKEzDJCwvx7qNH6gKnQMnJH1Gk82xUaoVRkar4c4UVHH/vLfbwd0BGjiEk2MU9CJcZcG5zuzRe6uwqZmKz2v3ilalBN2/foWiuNyjOX9VVOjg5EjQYPr6V92fpMPhbiUkNduViYub9RCyWjYTVY39Ibs3AX5Q8vcOFIrjSSBDuWCeTqkklJcYc5KezPDAxs/Yc1lYSh6oYgnr8DdFs/cxiFvhhKj6ypV81Ma92mGdQNAmeFM31pQ5ZDkWQ0IimDLbKQTlf6xpv1dDZXyFhxj6wMqmIiEjWpu20kk5B0CWUOnRjjxYAXJX5wNd5tFtsiSQaZ3fm3JvCxUXdpvggsVtZ1lToyXaVOEWsZUGU3IQ/yUB0YOWL1VC71gANN2CePmAsbxJk3HGfzhzg2jzhZ9mF3WpUA46o7V/11ULcp18jZ+kUNVaKimSLn37R57f6+tRG3iNKSZnaG1lxX2ZLvLKs0Kz2smdyNNGTAFt9IqLcP/r59wz+bHtcXPaahzfdVrm3yU7fdU5xMxfFlmw72jtyYtVFOlfjqX4qmmysaFuiuwByKBvLqCZ69+43kefIl8lXkFj8gf0N+TH5CfgpNld7nHqKq687rz546viSKyne/g+jxL2/cxRHpKwBk7/oAKuyv/kk8ysvCN0DT/+avdZVH5jj89H3UtXHz02nE6dPEpbpOEFVRTxBFVE54GBI8wVgLi0xjDBSZA8+C0RBi6zynH8WRrGn6ATZMEF0jSyU8lfkFornd2iTRNDfyJs29pb4y858qmte1o/+zsmcqiR/98Ad/9e1vfvELn3nhwQfefftVpw/un53euWNwoLd7TVtri98yvCxaoIQoF0cUouqsEPcguIzwCDEtFv5EpaQziwjRdx+iR8nxFrFAKt6xXpWbkyygt5Qv52tmxk424RNHn7hqu6HlQjmFiVTN0FXWOamc5dppks3xYKJZYgCTTUGiPeAPsEEq9QPz/7J6iKCsciwR+IDsMbhyQArYFhaSYuAbN2z6uq8zIEGxAaRiP9DHW8e6upIBXz6WDA1O+euiphnJZ1AtC1xQRByCMBBQ6YI14rMRTkEsAm6XNRnTuyo676r+0lQ0UCXw8CIOb4NyGi/r/G5EjKq8CHPu0HgoEkaREuSysbpIUFNlVakHO2RCjKo8thaDCXiJkB7qVOy0EVITomSamui+sDHstkxd13REBNRec/FQp6bS4AX7cAPCA0QmGzbG4u+u703/mFqRaAhRZcaM/XOR97lF9SqvGICfM6w8BqHkYKG1sTec8EYSsjW9cHiyhIQVhQhv8qpHCLpMTyzYqoAmKt4WtxSNuUCPFGBoSuX0Ps2rQ4+syZRBFlP1a6ZGbcWzOFtvmbzsUVRXsEU3FSqqppnw6AGb8uoZTpUdrwFF8UEh6MXhifBCEEJ6KxSLtmprITWitSpCJDd3vI5dHKXSyq/0oBENxqBOhD+WDtQ/LvMqq/wgMGfBXpfCc9X3ZiVuGTUA+38t5udL3A4ySjZWBuIgUB8DdcNhgEEcAwiehSWUayhzWd/nKWFeIRbDS14L4d042LO2wzE5ioLd5i2waYqsF+kcs5ZLuuABx5pYC0Av5x1XLvbVPr7sGIP8FpswJcaROLWOLhzvnr5n3spVFrqTo16PKuuGGTMlQQnWNZjda2LJHOQTjYVEyBDh2gMn7taxHd1KQyaoUaH3yHh3BEZvmyktLgxlaaKxvyXYZefSYU6c9nae3/fmRHf7OGRjzReGs+Fcd6U3tHDs9hN12VCI9+RByfR1O/VxhPseyrVF5qveOxOSEfrsKOXxbdnkHscbysElKc9TZ77zyMaB9b3dqWRGYDYv5y2TjCmzkRKIINdj9leEN3mpZqSO4ZiXHFLKKCsb1YwySzUHN7vOoblFh7DGmLuLeRGw2PcIGlIBeXF4y5s2j9ZnYyFb1wVoRGDclkfhgUd1HGbANbVoWaSAlEu8raGSjbvlBB9YyFrJgSziIK8YxVKgfgAxvaCmA0xJuOF2l+mKyVpM2vporLnRFYm1pkvZKG1vliPYg2jlZG+wImtY2ZROpVxWKEh1rqRqLkZE6hDW61FfwDJBYwOGiocTVAskkCQ11t3r+B4PIz6aXI3x2kzmyNHK4c7WFk5W1iIxEjdVKOUQgeqKjgJZVpj9XxZlSVwisgsJiCwusJmZr3u8NAZHXxO900z0js1Mbx/HrtjdVc7nLJN5IO2Az8OiLWwnrAKVasDO42+KzaYulJwJerUE9kPmuC4HLNuh0DEpxVZ6kJJsopAdYD0UmEB1ggY5x3Mf4egBRYndG1MUTuXrb67n1cci6Qj+f6e2uZjs9o0cip8Mt0ZoKBDRz6p88tCIb20acNjf/+37eK/18vhNz7/8/E3jq5svKHI8LiscFw5z+/3MdRmhYT9LJKM0lKlHYpHn7w/haAm3hgFP0p7i81YybEVlw9h2Ek5tNXU5yi0+d8sYP3n+My9+5vwkP3bLc6/F2HGotEwSJlbFW+d3KyInOoH5i14WviZgFTmzUjnmBncC2cCSsC68EUrP7P32wpbjpu/4y7e9+dD8++nMoVMX4eDDc6FiMXdx2/gF+pPqP138cfnMfYc/flX12H1nyj++CB7vmY/V/M4v8VfT32DbN5J20o9tv6cyux2wmZF8BFG65aIGYZYxFg7C45BiIc2EhTQjxqAqtrNCRFDEBUnAMSjLMOkkgAUlgzy2c8f41kIymSzit5P5gZq9Nf4geS0237qUwn0pftn+Kr9gq2Fc2pfir+83rzKN1+df15xIzpRObqOhFVwGmGrBZT5gqmudNP6+3/k1XG9McoGb5lY2zd001CPO9q/N1D16ZMfFCWnzwk54r2YYWvVNLhMMDdLOpvoXzuZn7MjPnOSXXv/dM3fTTXPrj4d9dv9scvEmmLg42dxoXktSWL+3YttOYNXVYvn9TjR/kxPPv4Z0kCJZS9aR9djUm8gWsp3sJDNkD9lH3kSOoiw7Ta4m15EbyNvIO8it5F3kLvJe8hD5OndVpfwSVKQXseL/8Anqkj8Mfev641TrFobXV9b19qztKhcLnR259jWZNie2X5HZjLKwNrj5aQ3B2yen2mkkKkQjh0iPwFd6DjGe5CF0fmvDlvqxus2BUf8m34h32ONxoqFNQ0LaoM+vB45AIwfz2Z2ZydYd6Ynk9sR4zN24pq0l1Rxv2iZHI43R+dwAFXZ1UCfmJr+BStOdVFQkcZ5USH9vpX9fYZAqM0UquxR5nvSSdX296xZKG6lrtkxVt0ud7xqi7m7NPUH65qBb6+teYBlubWr3Wqq5NTbjsQFf4fk3vILQgx3z/6B3qHzq0uOj/v4/7/lnZiq/eN+9d999xx233Xbhws03nz9/9uyZM8vLJ08eO3b48P798/Ozs1NTExNbt46ODg0NDEQioZBtmyabcPLZP37+kx/7yFMf+uAHHrz/3ofe99Dd7737vfe854677rjrznff9q7b3nX771249cKtF9958ztufsctbz//tvNvu+mtN77l7A1nbzh3/Znrzlx37TXLVy9ffdWVJ0+fPH3qzcdOHDtxfOnw0cNHj1yx/03737R46OCB+X3z+xb2zu6Z3TO3e2pmamZ618TOiZ2TO7Zu37p9fNvoltEtY5uHNg1tGhke2DiwcXBDpCnSFG2sTXyx6+y6YMD0m37L9/rkF8tv7GEToJq8whpgv1Bs8gf88eLvfBkcv+zL4hAu/wKe0/k/+ArOtvwfHA2wsDO/9O98mxn1CDCmkXKWsmBhoqm4xGAcZRbymENKWDRI2ZlRy+zf3Ex1W3Waa1oJwJvhzEpgjf/SX0LuUbxKt+zFrSl3y5lupWdDj9yNX2e78neVe9mn/97V7cp9/vWzl+Xc3FZ5rTB/9YGRRTg8vGlx8RE7lkhY0F/ygJksGpGoBZFsazSoBnytEvUi6ArKghENW9zEK795/vlmyq+88gj9/smTj1YqOyqVifXrdziJbb56U/aFfBL7miGfL2TWF0O+UIF9630h+rT1W3+fzlTemFHJWJUJp7Ad69fXEtbi7Ydh8V2L/5dli1TV6sPxoKiFDISffFAH7PdRnUMATjHzkl/2cf5qznRittrYPD4JaqYcti6WSBZqk8snL5tc3ukrFlnsleP6Z04WqxYPX0tcmsGW8l6yuDUVayn4wezZ6emzs/B9/MHkxxLBV6AuBongPwUT8AhucMfsn54+N8XP9/ZNT18/TecoWTGcc+jPnc3sLNswu4gzv+xJ3EyTvZW5XRUqsXA8BHQI65ZQsSuCqiysTpFfcCGgk2QiLRCRA3HyMnrB7MswRmHH9uGNfet61hY717Qlm4O2acgiTNNpjU0CCLDOKEqxLNPiARbYwBgt1Oa2srlELIK5jEy4fGltlVoQj5Nmy6gkkWcj32Wnl7jIu3Ysw7XT7VODle7uvqHxjqnjsDzTdSbnUgwe8XHXnXecG4X7T2+4anbr1qH97WtHR4pGt6IZoJ6ZifbGwoKs6U37i0duo1HqPnV8YtcyRPODI2MDhcjizunDrTFV1kCT9IZ878BVm0/fDbmtcwtjeRhcWxyxUd2rGdf0soXkVrU8yfTFI5Yhv2Eu4zrU3ouVAzuAKmz5szHgYQ6x8QaQBAGrWGGT91aXIGDUkTkcOcoje+MEpKxHiSiJJxEqUKIglGbLXjGzszRNJEEam5psjSUTifbm5jUsTBkKWY5FjKQKWDvMYVWzL4DjDEQpwHxiTCDEWFAJW94kwObXOItPMVKDcuEShGKWCLxEsunv2dF8a3iHbGsijAeTLr8a0kPRynwpOdKXACuTSWzv1MxsvCETsaJ6OHzLfMtoJfaVc9ObutvS42yxF2WNs9Oy7Y4jfSBnAMLZSFAXLSqrutKmqT5FT9Q15sJgxvpaYoWoLVma7MpEwAwFzViwMAJWurJt5twape/I7dtb2rpHLku/Pm/0DxBTTZApZmWd2rltY093TiLCeJLyZLK53muIIvDIWERBPIGDkggnZHjN3MfBpYBZIJuGByrlYmu6sSFou11kAiaU2syVgOWB1bgclJfSZUm2cehy6rJkrSKxFcqXJUtOrxWxoHJJKKckbhx7e2Ghkc9FQxmp8clGPhurb5Ubd3pdsWw0uKtnl+5uykbqpiN4AM+IPFlLyA27Xe6mXCw43bPbXZ14sudJ+INsU8nXtAf7ci5SN9ezGy/MRUK7I0ImHmpVGv4wImSbWAnT7EA0ONMz42Zn1M02cpmmurQS+XCUv6P76d5V38Ne7m+4HdjtfKSM2HNDpTK/s8Hi2fIDWwY3dK8RhEFJpFiNJ5lhDWSeiTa2VAkTbWSaiTsytnva211XRNFqKk5gE1uHhEWVCK+lAt7ahGHJ63hVS3bJz2KT7UCJLYXH4qtFyXFTIxvEirZXfcXMycr8sJdmrnjLJRv+dujgEIzsH4GAkzgwdC6RWbmzPQrB0BpfIZzX80kPRz0+vm/IZycj6Vjr8cGL7b2Jge62HIUQ0FymeyDRnb04qAf9HC8WkvRTzSXQ/EF4JjtAhzLtAwPt2QEYXIOJd8NyrhWSndVb3IohiSLlZc7Dg+7ppBzwKm9qxo61Dxzq95mhcOXj4vOVcMi0+g/dv3aHP2IwZvzWdDd0tVSvlz3h1XkvO5w1tpi/pzb38MqKz4WyAoaxp/lMttCNosLG2pSXGLe6dJvAAr+RswkHcBhQZ+Yx3cWM2ZvrK02/dRJb+u2N58xUPMFgsD5YH6rzer0Gi2EWmrxxhDPx5rIggfMFiQNJYfCGfm3l9hkuPrvySxOeMas3JeHO5uq318KutdeAOlz9dfVZeGEdaNX3waG6XXO7IDPxqe3w1o3V7w/CP1XvLcKhFZiZec239XdObHMYeU8vmavMdGGXyeNTdoIodwR0DmXgMApE5shaqk03OMrickDhmR7CvicuvDYrkZMkRwExqchJYz3dpbjlszIJn6nWAmeZZyQC4MzYCERYcAIqGUc81nQuC17G0ewYdHBEF50ZG2yGos2dHj85wY+eGalOTaz1eLrbEvHJNi3rMgfS3ePw9YO3HsT/yTuP/Eo8PjJ4WD//zUxR0h6AO//sburuGneurSa7J/iAd3IqYfKmEEuPwzeH2FWwf+TInR8ZOThV6fz5dD388PCdd9dk2ef5dvrPWDNr2MqD4XoWG59KNmON0GEWPMimYCyxSkTRxt6dKV8JwAkhhmkRUzAW9Pn9Pp/f58CKIptexybeMR9fp5+9LfPLRYAt+9C5uhJdoOwcKNPtsWzs4hcuPoub2z53EZa+++zFly5uWoqyZQA/PxCI0Uhd9fH9Fy4euOuOIO6EYHbvLXDLwlh09q4DFy8cuDsWfY9z0ur6AvQJ7NcRMsri6gVATTfM7HFshqJARYHNXWZGygVUepwzlYRF/PPc2MhQINWMg1RiHlWGFlIoBXy2WLOsoWCosX0mlpm5HduTBYowcJvldE6yWNCFY4JjIXv45H9eyTQ1xCIX6sBwcS6DSmowkbZjKblvtu/Pp++eTjRrCE60cLR0cChD06MLJxdG09AgiLYtJgpT167Hc6hvTR9YyczXqj93m6BrQ7ccWRyJ5Vt9wUylkscTQOasgIY6bujgsdViuirdLhvV2eD4wJnpPEzdcynW0VmPqGZjWV/piwIR6rwsWlZBCJXGcYu9H2kdYqslwhy6zvS/35o/ViwFksnaOmYsSm914YXOpnzp8v1A0+vu2NSqOxbeocrVX8mqKoMmq3D15XszlvHKzzwW2Drn9dgHaQ87sPJ5/P0uHGLp6vskFTT46Cs/1W08ycTfml36aWeNhBiLe3UzIIjvxOYMOTOtUJAJSFGZfckBMCwqWCBjzV5vi117hQALYELs4o0X+/gym7voR4bjtZgbk3oy2v589/7erAHz6UoypCFQord84hOilajPHLvJl2CYbaAJcmf0fL6SDXH8P16sfs8bjuoAq/LmaWedHQnrvI5cUVkMYjV6FVRhOgIxjmFd+aQOKlasys9rnItj9nbssPNuFkwiCRNsK0hTCot0HjUMWeaxXKPOqKutiyB7ZI9bc6m8xBY6dQIqPcxvhCStCb++MlsewV8GrxSX4sW4twy/2g7t27ffurL48Wvg+V98/JprvruOLvwC/6rTt8LzK89ecw29d+XLv7j2WnrzHzj1+xvuFvo57C9bKqPZTGsUH0esA16wTcrxLhZcXIM3tVUpas5kx+jtBGm/cR2xhG3HvbG0MwtYlGqmf7YYQJlFhjmbdYgVEZuUUUqsxmaXUBmXuFuai61TZx7b957rfcFz+3vmTB/qkP6JZKY5Uzf4mZPCkdFtxXUlf0+BHi+lAptuv/lghW6nW2CoxInu/QPUT+u2LrTuOCj4rc2HYa0WrSQurbf6CLcBMUeRDFcGW9jiU9hj6lDeYesEgLC1UBg8XsK+JPCcsMSsj2wNqt/uUolUczhSW3LDL8addc6yYqozwhaBdGLNmWnQA2xWC3O6JVMOEu7Mcxu6SomTc3Vrsp5Eb2mgkNfv1/MDQ23zA9tml79wJOqSEomo5o2GI4mrZuPwthPusbtnPXX1SqQyfvbOryxf+6V7jpfm35Z++PDRC3DV0ZkhCqJtdq/J5aErf/jMaizAb/geuofcTPKV9uUpHBrNtYl1POVPCG+YlEgW3/qWA/u2bulfl2lFzO6s+VYLrMMBYfsdeI8jRmJzFdiEeZ1zgCUKSJGFA7AJiIV+KHWWnaXgAuw3wuUZ0cJcx1HhRN05i75FKBLcBqgFubE1rmnZcWnQElvlIcBn3fvcgUbFoLrtp9vCLMjHtm/TEy6XNxNN6CDqKpuLo1qV9MRAztAFq7d7awxzlMB7JY3jFN4VkRUjErQNiaMqdQzDHK83yS7Z3XA426DpKotNwiGnygi37YTVVM9ixGSZe9AOczSXOG9G0lrEtMIGwKa8xNuGjiXJopZLhkVes5J1MmIGF3DBWFrTheDY/MUJRWM5bKUyUQt3e41YLmygFrWMbCQVSMiiT6CaijofRE41rEg0mA14VVuzsJvpwUKse4MoY4tQCpzMuqiD025Ffp9D4GGRBtJChrDPHa4cSnjwvHV5qnBjo72cS+GGN4NrkC0vy6amAGHTVGREYrImn2CzVxTKKUtEcVHFdZS4XMeJRqnjGaGovqlGkddt2zI4UOyM+xM+K4E4xpmGeGlqFiactdJYsCNXwy9vzEw5UxQDVqBGULLYTcqrU91RFaI2DdQmVrBYF5YzGG5PQDIbhvvDthGEkMcOvxWzEu1h2B/xezBHt8PvNu35++fAbZmekFknZYVb0+8/9vzS/qeugrmxgcYTk0k8PHf//Oz9C3R7IBxpC4eqK54QXotFBiHzO1k/5abunMq0UJReoA5dc+pBVvzITdWr11/VcajX2nrL/RfGYOuFmr58CvUli3VfR7aThcqebhw2m3t7UEhsAgl53ShIg5SpGAFYCADKDBaqywuEP6qwFcYBoYYMbAXtSdzwDCjy0lh/X6ZtZKhve//2Qmfbusy6xlgorbKJfGzyY23+qjNrrVysLQHf6QRysKnXlsNSsNo5RByFLHUgh1S2fUibHVlaq3BKk9I8B2ZfKDpaHm9tAZrSPbwmuGReCCeB8yUbi5KeOTp843xX1/yNt51fKMGGzNunD0/dd3KQVpbvmT629+/GegdO3YtYFfGSmY3E6yb6enNCPqlR0e0a47RWfOmWeKSeL1W/2TV308Wb5rppaeH8yJvnbmzr5rjB4w8++uCxEVrc/IMDV03du9xHiPRq9dWXuH+irzj8roG0kW3kILmG1FXsAXjDCnMbB2vLTTaXsiziIgJOZGxtAQ/U1w7oikA5S50VKGl51d+26hJlca5sjXNEaZLuTBWkXKQWccvWKUDR5QTL2mUnk+VhQaKzrKUN17jUVMblVpPZiiDqJqd4ZeNQ3blrM4Xlnr7SncL0HeNnH5aF2dsmrn//I+mJI3fcd8/yGN06PP/ZdKIOBZTg2nomX8e4mBQtJNIBHRvWjZLBlUu4g5QztNjA2Y6wLYQjOm9YQws5IySbxuAtN/uSXsPrS1rmTskQRMmUqVhcW/h/iHsT8DiqK1+87q21q6urq7urq1qtVqv3llpyS261WrIsy21ZlmRbFkYWimRsIYNtjDfAeGMxQ8A4bLEJAUIIw5IQkkcgQwLJkEAyDOMk85gkQxLGw4SEJGQZkjfDZCZO3oTYxTvnVmsxSSbzff/5vr+Xru1W1a27nHvW38nt2FE2jK3JzrEmxXd0zN2clxsdqTRJieGZ5dW7hqbXNGXOVyQgF8lVVVmRYFQneklP/UBC03h4ebqiwGt1C4bKisrx5X5DixrFreviXj4Yj1F/oRbr+wjwhXxNElxcLfo1GUjjKtUDax83wLN4N5EKMCe2KwrH6T6goV6X4WCLRCAbQH303PaIcxP+5x9xRPI7+J907u4Eoe5B5wNkqXOvs3qQXEl+4awiB4C+wbjYyf8C+CQR5tkqGBUz3JXcpdWtZZxtq1YkE41+pLoCwmaCUEJ5DuUQmRPkPR4Q3RQqKsxdjXH0KqwnkjwOGxmD6mVp5OIt56/fedmWKy++cmpy/cz5MwP9pfZia3PWDnkxKrncFSqSrIku4n6CYBS5tAyrMzpudzQSL3HPpNHsiRORRd2j1gAWLDHEaF2e2e3lECzrpBTndYq4RHzInaIpnQIvOZT9xp5j9GVYghRVbPnIYq+iea4qDEkqVaXWldMPuCd8HrHny3vH7u2RGptwVYIxYKedn95MB4f7lpJ/79x/8dGkc/TdhtvtW566YWTkhqdedDdk+sLxs3/f+fIHvd56I9iunCDfEGjQAFFcAjZb+Evnn8nL7ompHT1drY2yrImGpOZ6DzgfEvhIkF62Zc+Bkz3k2ulemyw91/R8pm3+PbjhKPTdZ/gwPwIzOsNlq6lG28OzuewCsrAJTTmm5Cp3L+kQkMxJsuQ6s5XQMx2Dvu2sJRMQs+B0nid4hqwTb/OHj2mq+H5CNgIjrB2z/LRBkpx/el7yasds/UukSbfep5HX1V/XBb1vkwc0xRP9mkc7+3+dT3qDdWQT9dUxu/I2fhE/xYW5JpD413BbuKZqdgujN8MEBjhj8c7lUtOpWJSRnzDzrANykUfVb1epC8X5PLI7GMaeZ36PyLuI6J7BzBnI2JSYvhOhcvkcI0c4Upg6Se7Eh3WVZkMWbPIXvBxuPB5SYDVKXECSSqxe30BiKz+shrzAh6iRkHLZ5T6dfF2YjoX98kX1MlVD9aT/fZZgODfzKxLfFv32FxO2qHnJfmIof5Hz+SKeQIA0j+uiP1w/Ju4b+pgcFKSK5fECbWjalvdKXuuGRsVaTEJ6rLA907JIjHwufliF2fyRFm9Mi6hWK7Q2WbskDJ1g+iNl4Iwef/gKyysVPALhVV/UXrIvRL2qdl0CcfRh7q6BuesBumHDSrmUew93EXeYO8rdzT1Gv1HNfPyRo9dfK1rh+0g9vJR4MIJ2oq83ERMlLlgpUJmTarD8V8ZINB69vBEKNlj1DSzgxiMKnj0hn5eHme65xK9AcU2Tt2XSST7Oha14eCZFrARpqLMaZrg6nYhCnYhguhwNEjrNBQMq5eQgN2MaVOPsiGZvwT0tMsVFtMi6WojREffFmTRNxsPxZHjPOVXwiYJvT4jA5PRd4iXn1oP7n6kExhtd6lbi9z/6Xd/a2MDX11n1f+JFfk0RZXiXbM8eyJFJLiJHMLxJ//+nsav7/tQ7ya7/6ZdOwZ/q4D333PPYPY89+tGHH/rIhz90710fuO3Wm248ct01V1+1D+20iIGzYWztmsFVK1csQX+FUntbc1Mm3dhQH0XYqkAwmE5l0WckjNbMTtTSgWxdLmU7OtPhjsBSGkiHmSvmMpIOA49WQhxVRCEDgbuj0w2h7UybqKZHLBx2CR1JmJ9RVwUKp9DrqwZZkPg9yALSIcP7kOTAioREib2qzDyVugLpztq7OzAoqauTxi2fpvmsL3WUzv6099NLux4plQJ+lZCSKJfjvxTVnkipVFcfV8XnO4gQjG71W2stv2GNmiolzpPt7eQDulJKbHcuvjRRkv1+uZS4lDy4PVmS9bPfWbKyW4mGjd78r40w3AW3ho3nOuKxOkXooKo/8MDBrPZJLVdXlxsvl50Xifkd20uDf/fdmC+c6tzbrDfGr3aO1zc2+tvkBtHMLV7SGo7Fwq0zreGGuN8v0roD+fyBvHP0pmqyCL3It6b6iAL7vNcrwD5d+YMPfaiwbknbB/NbimZDQ3jRlkX4gKLz88Z02NfwvR9pkX+Y9VfkY0CXkrgqBZFRAYofBXZmlQDCPXLtNWYzlg/y6Godgk4JFSnTQ1gMaRBlVughmcm3EvmBkm7LKPbxrR2JWF023bS5M7KsqZzojS9LJINqY1g+n/Q6B2SZ3J4/89g6Renrv38yf8mKsSU7FWVxfaCSVW8DWXwWQ1LjAlV9juMNhyhCyC/ANOSnFiY7mV4AGUjn8AuKsJpNVSemPBQV9nPWOiDKxItxGBzwoYhbKkr8OCfKCDUEfJMkyDMMckghiDk0vuH880ZHepcu6aqUC035HEy8YIuGLVJmQhyI8+V8OuWHFRskPWwKtOohx4Pyn43iCcLsma6LIuo18m6+mbKrBnVlmC5WFG4Km5arGOADiuRB32lRUa1k6oZUpCdYGsl2DkeJrul1FT1xfeO2nuGDA0OjxydWXdl4fcJX0Zu7Nd0sDLa3TuweSN2QVFvVRQVgfUHW9qjk5roRo06JxKLZsEr5GNHkUDzWfOPR1dZGy1eygjoJhusO379u0+dvSyDSNulr1tt99kZ72eF92zPJVGuMSKS7zVfywSd6PdSe5JgAzr9Je6BRw1wjyN5lkL4vrE62ESqVFxWaM+lEY9QKG14RuEdkUBVJQcO7hGBPHnTur+F0wY9nnPN4yKQqiyB6eshIpRPxNjoHK6sy6AkQj3jF+pYuIDFtzGQXbiRmqjPfVf7je20sYDwcslMItL3AzTudUiVB1wVJNSYiiH02GVPVmLYxoSgJdVOKSgg/rFR1LdM+eaMSiZZHRsqfFYTBYUEY3q0oux9TlMd2qsru11X19Z2quvOHqvrDHZq2g3C6/g63Xyd3qIK+f1xds30N00/cxd/HF7gAVw/zbRFX4ZZze6o7gRk0oX9hZAJdUwRZAeYcpGMP+gZ7MDTMgxAyGkEH8Bkv8zUe95K5iJPurrZiLBYKEq53adfy7uUdpWKlrdLa0pyPJWPJYH2oXlU4kDb8NYg/Bk3mGkJh6vJMqYjDLcSSFdh9pJYxJU5qYeZokmaDuJyjrfe98sIdqQemr//s7gnt5b0Hu3fca209OGnsXkP3f29y3707Nh43rvu0oxb6+iZ6e1sjCcyTwxdeuff4t9WJvc9cN3N/6o4Xznxzq3Xvju6D4wfJ3SM7jfX7Twbv2LTz7v2T9NMk2Av3TfQ+nCqm4N8cxhL9CdCoCJcCzqmDy1cziwvN9dFQEOPjvdyqDgbBzg0wxRzcEuEijDFFwbaNyPmQBCPAtuyQLbPATz4vm7JtgcQi4g8UCblbP6Gp9nLhrtHq7u5vDvQf/uI1/dFv9uyujrQW2nur19G+8kx31LHwt1S94XuwjZX6hOt+uXHjYKY182yCbFdzg2RgsKmXbE99MdN678AkKeRepUImHp25+AX42RrLve58E4/iGeHV2vfB3DlKb4MRooF8UMctq/ZICkWrEeXINKKh8XQMNpSf9IgUEZd8PsIhBL0v5Av6dYSgFwVOIpLq9jE6oqBJMJlKwi8Mc1LugCN+zIw7mnMFaXXONJE7yemYdebTTURwXqG3xc2/ffvsd//27bf/1orRXOltV6/zAMitCa6PW8dtQCvgGLSdAWPOi2GlQ5wb5aHKl3OqqNYASpnHhEfwzGV2QXBohnzEwLFrcCPnn7dmtZXNdi4KpbI5BjdixkGwxPUZnUdsJJGyZHfNqkJBPmREE8is3VHqRMsRuoKTRopLQMVF2YEuRJmCQBN0SfQtVVFjayr3N0UVOphKCVrUFITWiZxKE8HFjUYsExS0SOuXzVR3z/5RQpo2xoMWFV5S4+0zklHoTimCoueigZjXScXufEqg1wm33fvCvduj5t6mHB2k0ZwgCEcNk4eWV5pS++Nm6meDwnC5yRzTlYyha1LCeVYql4tFSaIKBlt2W0/cNocLyr/Ja1yMS1bjASZjuessj+OXcNCvXi5GYgL0pghic77IMx1/nNosZxFmDSCnda/zqF8tpKLHj6SG+4ohs7U6mD5y/Abn4+p5KlnvVyuV9dlrbyORQipsZpqi5I5f3+B8Rp2Lr8P3L+E6q6USvDtKmEM+wfUfVXT8XpHAwBTGYSMwjwGBG2kqNIbDYaa7LzM7HsJG8bogm7YHRLVaMoN315Z/JJKrlHqrvRlDTal6U/dAd6VUMOllZIAMXDaE9Y2rf/BTqFgcKEQ0IdKeCPp8/lwhTqV4Zk3L5sucvyXdl22+Fr/nD3+qa8dja9JBpg1uRS+JFEITDGHGSR44HYbLRUVhRnZpqjxPU60w4QpN2Uy0LtxgNXhVziQmyz1ZivMmhvTxZdRcVFz1bheMPBvttOhIohNyetPjV0w0NU1c8fizszubNt1447M33rhJ6SkI/Zuq1aKuGPRgac36vljv2JpSac1Yb6xv/ZqSE7z+s9fDv1OKpuqtfX0b+4rtc1jwb9K/AdlxGddXXVrG/JA5LyrAa5iyAoLLockZvwKldDqJtqURwi3tyaQa6oMGZxObKaFSLF9WI0xmDCms2WUJcTWqKH8zONJcJcfi5jG6iSHakAQsCaf3fXU/Wb+63e+LXrAqksil4JgefpHccOxnt+QLez9Yn+EVHfGbeU3wmbJpyP7JreTYz4jxs2P0utGjI337mmOdHcVMb5gXR4/ed3TUeWPLozPClpwiaB5CFYH3i7qlwIpWKN01DpdmHkXbzK+gzy6n45yPk55WeLKoJQRDzrZgyOVRObKc7CP7rWg06sCvsz8ajdAe5wGyNRqFw8OWRW6JWhF8zul3Pkpe52PsOR58Dqoc8BHu08hJeIblHI5EyC3scfeb8IQouS0C/9nD7mBz+J1fwXO+X3uOV4TnwBSAetiEVSnnI9ud+/FR5JZIBCoQjZpYQ3yWczAagf9Riz3nNHzXbvguDZ4jY32yHiKx2qBBic84dzjHo+0Rcgc86o5IJHojPtgqRskxeNI10YjFxsarvEZ/yWGmGrtqCoRbVRf2yYILpxsMEOx0TJAlE7kLeCbShZQ0ncc4Ocum30zEzzivv1UiqTMVZ2OElqyiplvBWDCi0U8mqoZxxvlh+ZckcUY72x1pLVlRGllvBCORmq38mzAu3+IUmGMl7uLqRZwocbAW74GLEsfv4oiiKkTdw6leRfXuAjIiiYLEsHJlns5oROYUIivTnNfj8Y5zXi/CrHk9I43xtkUthWw6mYiXGkupcCqQRjtLPZCeipurMS9hligG8mOZs0ifYkc4zYZxzhX7MOC2Qsanj07Dv316+eGDTd8++uhhwwiWgqOHt95H18OZl489ejAYNErBsf1b77M0Mj2wadOx6enrew9f98B+KGgYY9c9APsHgyUjGBy7frqXrdvvvP3O/fyv+CjXwnVxE9w011CNTk1WlwsLxaaGGAjHBo8aVJ2YGKYkoTYPhdYS6spwp6tkl1zcbdsCwQH6Bjrfz0Y2zMAs86tCaLM+knOxNqCsxUA9UBXfZbNHfkSRaMAvGNqg10cTglSIwwk9Zx0rXxPVzMOJ9a0pQVFHdKHQ85/k/qDZbhnOxYoyrNGSkSjt6G4dGxiI6FTSbtA0QUvpQq4nJzVRIXjmk87Ib8xg0SJvKzHL7wOOeETTaESQYu2SHjc2wvpWjnT3FGGZG1SE9kjJyVhGQQ+SVxWtT3lhR99kVGsdHR2M9Axb3d1SUNIG1FKsqU/rEVR6duA/J/7DNIrBGr9xFPgN9M8tcMurvQ1EIIMgKmAyRcQ8xximacRSBGo3g15shBvHuDsW5s+RkWApVMqgv64HWIqO2YGSnd0hkgVskJlOppYRPt1ZXkpKwCkFTPne3rGenrFectrdOl/OCAVaMs/uM3dfbD5g0heCTb14qeBuiKVGR0xzhJxeb5oTzluWsHBdL8J4aK7mciBtoX53Pskdc2Jkgczc9rQdWmYjZGbWRDnRTT2K6WiKIov4x6RALCWQJYc7ErbFvzlEVEFEGBDCA8/SNzHRdcRMeJwfe72kwRuL0CPk+Mb4jzY/JAQNQdVgseJzjd0bq+3xoHRCt7wkDqss/Jj+Ez9aO8cDdMLa2IMZSHMIHptkKbcMwq9iZm46lzG1u6u10BDLCGLYVfamZ6tnoVnatEUTjQJMvcJYtvw5hWwohZrebZYs+1W3xoHW73u9/EwwGlO8openOolsyBy8MKxIUOINKBE37PDPLpv+Td5W+dnKB0J2/nVvzPurxPjgoGGpRPD/YFNTq3zHwjIe1f6gf/fMfH+0wdoPM/MPaNoLDR0m07QzzgW1UildDJu2iQB2wNpQFjRcSSL0ugVTkn/TC7WPWUe6Jib6ulMmWkYDkqBI/FB8Izl+xIphX5B/ZZ9g6SekYLy9urG7MScEJVjPRd3kH9p8+dofQX9QDxRx47ku51/n17E4oxiM+iLzH1kEK3drBFFWonW2IPLoAlNzFBF5IiI0riDxyLmAVCmNwUZCzlriRhoaGgoNhXDWDma7EGmRWKafLPBTt5NIFz0kj5mJxACLhmQusckAQZfXr0YiX4hbZzdZcZIIk1e+EOmLOLeToSucZ8PCJAl/wpzIPmSZH3f+lr6wct9K+pBdtb/gtIShtEk/Hk6QL0QiZ4+S4SucL7ROCN8g3Q+bUfJQ85j5ibMv0lG4w+VlkvwB/iMw9lYhV9bR2pQEPqy3szECQs7ysE8SEEiyQMRVnEjFy3mGJSnMklQft3plf0/34rZsOhatk9CLxwqGTepme+3qzNHOcnA5wdB+pmlZTnL5uR0JxD5JTiGaAuygCgGk3gDmebXJV54//d0nEk0p8sR3f/O8p3zkQf5jitcwfCe9qSvZzrVbPvbozDU+w/DK+1Lek2znY8IDRxIFEELuTzvf/atnnJ8Uq+F4PFwtktgzf0VyaXJme8upmx9V4vrJdSv2KSnvtbekUrdcqyWIsm/FupN6XHn02CutdMaK05TJaOAXBIt+EdomA9x5vFpfDFAUEFzTIkuS2VluyttBAROFyPOEopH1NGYI5BmoBEFwA7S6AD8Bn4nuJq7PCWYZM8lkTNQl5wz6XYuGEJOk116TyMDLVJdSikS+RTU5LStkN5TQpZgovvaaKMZgF0qvgkMiirgvwSVD+N5rkk5Hz7bJCu/hNYW+DA9Qqe6ccH7n3vTa96A0vMI5IxruvHyGN3iFq6Cky1FREinD8xIRz4swn8kZoPYilcUZjkkhHAohKCqP5OxcNhQOp9B1MmvWiEwfLpgu0UxJOFNZLjo4Ao7AbGSX2kjNdx6msbGxurbbGV1+3VNVMiamDNF5snX/GCmQz6SLGWCMnOf0kGHpP5UyuvTTdHXR4jQZ6F63YrKLfLb61DVkufNp0UiJZEPL+IEW57xMe7oIBXQr5f+JBOd/mlpcrMIzKrM4nfQmHtHhGrlCNS8iknItaxLd+26E7nQoWwkxhO5QkrmF2uLCqdvBXCphQShZT5OG8YPjhLycsM7+HAThhBW4++v30iDsfnz30nG6ftkjzpfdOdxvJcju7XffvX13vIaZ8wjIflmuvbpImM0ID8waQWYN5L4F2DkcQueEsp3psJu9AFVHLhINVI1Vwz6HsqAPC4h7lp7RrbHDY6STVaxWP3LorpfvpIETzHfxBKvi7rh9TiUvvYveO+uXehPDny5yvdUlMqtlTcyRgavB9DozHpEySQe3IOswMKORRa2hjoCZ6giHGTA8YcBoGIpaqogIo8Oz4O88n2YhKx0BBgCRZCquQMkimmqo8I8csvR/ayCqRPy05UdQ4cmuhgIt1pNtDYVCQ9ckueJt9LTEny/pFnH+A2aKn/hN/6q9JF7oKZDW7lbivLG31v/8XfQrnMEt5orVlmIuGwn7dZ9CeA2bfkggc+sSm9yFpnQKWBJM38XIdhpanyWq9hCri4lmeRQQmA2VzfrOMoMDb8Cpzwct/dSJU1BjsgL+XpcSZZhDzvXO9bJPTAONJR8ItoduUZVdinqNRJqcX0PRU6cshKpQnP8kmWbMENLvfBmKNku6SEb9/it347f+eLtg1Pj9L/L38athrVrKbeIeq0Z7iEd8zxDlhJCXEpkfmmihnkGJynTQNRpWYMViyXCJDB23DZg7XlR4DEPmZA96FnMyEeQtHJUkhqOD3ghUGqmvduONPCamhTthDOz57946VdWnJm071mRHohGTJQgoQ3sx3/JG5q2MSiVGGNDETNhFf+1EVx6zNaASnoHdVQhzRkT62ZWfpaMusZVttuUXGfuNomFBf9KEpei6YIWMq/yLjDHDOeS/ymiFHWO/vxiweVWI2x5d9gIfHiSn28eK7yteVVy8uP19bfvb2sbajrXNHX3K9u83gkCpJD9UWlAFK1D07/f7zzfIQ5ZxleEf87fCQ+GZuu6BqSNAu3i8Aed4f9v5be1Xtb2vffFieMyx4lixbX/xFvfIzVVWi8XxcjasMMu4C7iLub3cNdxd1RM7id+zlWjK6iVUVItAmUIayGhBHwWBbojzexSPX9nD6ZpX070YDQXsDw+UAwYlJ6HiXtE8ygxmEdYxi7CXU0VMHgy8OmHY5zJFT3gOU5/NYJq8SfQ9Hjl8aN+Ve3Zfun3moo2TY+c32nYmE7bCQQN6rQvZYtbclmmzxT3PCGB+FgEVx7042z/5LmZQrEBvMrsUQRhpt1fl3IJ+E2fvZnF6cxnigZYteN2vT0i6VzoOP1OqAeKrrl2vKp/FiQA/9EXWdV/UtGP3+Yt+6N4Pq6b3+TbnEzff53Y3HGvPuV36RY3sUZWn8Vb4cV52KcyP4fmqeELUve8/IXp16bio6g2zhdQDCpZR17POfE4LqR/Gnm/133+zV3u+nYypH3YHwIePadpz7TdjJz+n9eNNUFXSNFtPdRN7Nv7M5xO8k+VvUTEjESLn17zJmH7vcpGgm/8Yqvz4CZRc1siyrMpqKBCARQn4ZBZ7QsRwspO/81+ch/+FPOBs5bvJv5MtzkPO1gMHDzKVG8tPgbqqOuBgVnPV6rL6IIEOD3GULPRNqiWvEuFIpNO/5z6/bFFdodl1n2c53mk+7eL2ADE0rS70m++EfpUwoQ7z+IsLbo4Pht24IAMwutTzjwTD90zFMr31NNqXapi8NxzUJL4iq6hcF6QzL8Hehl37hUQwEdGoNxo34+L+3fHyUDl75qUM0IgsX8mWveQJ07hqTSQap9G4teYqw3TGZQ2YnTFdF0XKa9L0ivFNfEw34aSlxemm8chY59lHsmVSydCLsuVyTU58CeZgFTgCkEuCflXgRRZ5gcIhM2E0mDaztcLYDqGjI0axsYz2ISaRZLtwJIvwUf6X2rWw9ru3NUsj7X+nN5LI9d6EdoREEuTnmv8rzs81r0Hko0flICL72F/xa2GxybFtp0lk48Gth4drRptKrM7UfcySwhPt3AplM7YVZFoM0oVWElvuskNu7ZCH/oO1o9c+/n92XvYvn2r+znccqKet/uF6ph5L/cM/pB77P5dfTj7rVjn2Ryo8G0tIXwL+JczF0WIN3AoKCG4kFRXmBeyQHQjYJTZ8ZhEo+nh0JCjFed5NmhAn9KXBxU5m8aAaKfQtWv3SmkJ/LqacuO6Za4Qbnzi6qndysrd9fKK3iQwP5/rGJ8gLk9df/9QN9LpZPOzDUA+F5RI4VN3fmqWqnGjE0KhSCAPOhhj0OrOP6IRTfSrn28N5fdTnpXtgeHA+r+qbkQgsyryCWVsUQWAg0MKkhwiKMEK4dWvXDK8aWLG80rEYHS1SsXobKKPqEQXE6mD2PBY6RSURQdfDSNnmeLRaSqmuDjevFHDFCMgRnm0L0Ub7ScnF1MFwU3Lr1PX0ms8flo6SvzmJg1o5qUnAJ3wFw0mkrwDPADvOtkLDidwSJ7JyTNCC8VxP0uttHd863ur1rm4/0lAg06yBnrlm9e/f6z7U+auGVnJzbHRlvLu/0p2KUjUFf9RKoWEeZ3xfrV1HMVp0NeHkTH2Qp0qJSGh1wr4GEiULl3sIQoypCMzsJg4CSVGC7pek7YQbHhxYiU0Hq0AybBp+t9G8CxvNtmqLh/wuCQljQd01XpRxAVnYaOiLAk2GKnR7vs2ocLsojoh+8fbb4WdExO05x85F28Lhotd3TtNNPDvh9foNv07Ccy33udtEY/4Bhnjb7fCz1j1eC7u3bzN7w0W6oAEHBlTBHzHjYfQRfeednUIb0PgAVwIObYCb4C7iLq/uPk+nmDw2QDxez+WcV/FebhBsMT+LasCQWwyn2aOplEgcYajRHENXFvbqbrIAnSUL8KGFaGR688apifGx9WvXrB5a2b+8r2dJXdis60qHkkYQ2W42BLvKHSXMEdglhc1adgzMDoihyy4acSku2MQ1m5QwtwNLaMLY9BzDW0O7BLFL+bkiazf2rF1UJauEQn8yl+XpTWMrncjAeiJoRgLaU8oUh9cP1jUbSqo7lzB0cvarmFUExKRba21LVvYV1y7ZuIjPZpMDTcKqodr1aX6gtfUrVpT4wsaoc2H/6Gg/tG53OWdFYlFqGVGVWrlyd3+MnnAzlTj/Ntvx32kpkgF+xagR9kUipHaZYwlz+Y/T+4BOAY33u37bNQ2Oqxg2bdOl8bUU4LWB5zIp/McNJwG8hPMLv38Eto+SvfA7YlDLggt+P7HYofFxcrlhjPjZmvJv9BV6DHi6eLU+VWfIAlJwmBCzJNyMmUzZlf1TYx6VCPQV97WPuq+BrTF/7Pc/+qj/Cgt3Pv5x/+8XBJ4ICtRkzSDLU9VczbkhT/D1V4jugBLZgKJsQKU7sumO9KyQmU/XqFhX50IqxrIeodTJBxPWmwlrFzC+bzLZ8s24vQt28OAv8ezPmVD589pZK4HFa30SJP+KuFnV8Lu9WTs7mGsRvj5Ze2nSfdXZjewl9LHZx7vPTeB6NOenFOZSKFEzU+IQMFPwrQtyPcGiMD6fLyls26bJ8iXVRI/8AvmDVOyFKVu/oXZ4Y96fXA8/Har6khr3kjb1joU+T88aasnr/fH1Xm9JbYQSKhRYu9APaq6OGZBBoY7xsMYLLKET5mehIgJfIATyOGwocl9UgCrCeKljyycy1JV3V1SeFZ9cprtrYZXfq27bpqodahy23jhWDrZQuThs4WSH+uqC6v9Qx6sN3tlSsHvu8fsXZoGd/5Y0146RmUCPQKYTeDqEOgJUYuxh0GY80C4ZOkAmICZKElOyoHgoSCPhcDqTTWfM2eBb1H9iFh5JxoSbIGjgMmlaLBdjJ/4s/LZPWPoJSx8CsfkESP6mf/7gswv7pGcYrtZUHaZ/4UHHOUlt57/HDxI101Jz/Dkjh24PhzszTEtdS9/Napj8/Xo5G1iNyJN/qC5uJc55u6ubWgJ8OmZz3PU5jhGptU/5QWjH2Up5YRtLaMl4dIQsnHn3nKmv5t2CdM+fKDlV9eTNlniOKZKy84okxpqEEA5TX6BeQg6eZZORZKajZZDysG6QW3XlmAdE3mMe7TNGJBcN23E4ULQ1hWSsnMpEzCZgt+QLFSpMPb5o43DxHihI2D1EI6vi5VQiqPrafapBLE+0OBYyEqUUMfSSRxiUDOXuVM8Eyi/zfdIFK+hwdVUz4mcTV3pB1FoBXSRc/A+Zo4JMWZgjYUHAksS+GwcbgcEWbwlZuVyaqSsXQKUxFOZykaCbSyNhvoFzvlnYwXgdtfLAsy7oZnKaqW7Yz4m+TYtvGfL41giSR4xnuwtWfbqXsEuRYEyNm9o/LhgFY7O3qeTPFo8XD/m8XYKcq48Hw1HN35814UIw5TWkaKxpbMEYmW+LOFeEUbK6OtiUAM5JRwzSCFANBLpWOFFSxBkQKzFp9gx6/NSCxjGgi5uL5wpDQ+QCuXQarXNuYwQWtkg4Pd82/LvaSjwnjbUqV2rieGcn08TJ6tB8y5BtCz98Ck7E8QrsPM1+VXJmqnZC/eG5OabZnCDba9+7vNoLgowUDQLlVjCNN/o8cSKPgfG1XK+Ci6shkPl1JJfOJa0OjN1l4zw5t4LNrWWoN8VlbMGAx7WNbDMN58eMTqTTbIOavLTfGgbCgcHcQEO2DrEL+HvK3cDE/yuLHtjFdnexaO/Z72ivxbC3VpvrAgbPXAz/aMxxZy7HyMzvTU5MQ4tV5928gyQ+X5ugQdgBSISW72nduv8Iq8URJDW0bwFBsrjZeTXFfHpj0LoD1RVNcSoKVlhn4AnoloMhgTM1jcDvAaMSrrWQTkYjQUOWOAT9cR1y5ryBQ7UxI9eodz5UzjOodCkcckcReXL/V/fNDo6/VmUcLJqMwokqicq1iiipqudSReW9tTEBP2eHd+Jg2YlFv0Y2yrwo8rLzmIThXa5fCvkB+SXzA5EIWdSC9k5YI1nIDrBz96AXyUkrejIajUQfJ6fQh+QFy3ohakUiD7j+H8Sq+bUwfxTMaNHGDP/4nDPoQ/JCJPICPuaBZ9B/5MVI9EV8yhNz7w/X7md+KMjQ4ZuZA0HO9+CDC57wzONPsCdEIy8u8D8h3yPoOyI9LWL9uyR8N9wPteiLtkdORq2Tkfbo4z+zitEvR+Ff0XqQyWlv0P+k32UR+xGuu9qJow4mBc4MUeIxnpPleVKQIE7IAiaTWBMwQBKLBCLBYCAYNDywFAQSXCBtcMlwiQuny7m07VrqyxXSQ7580LnF+c13SengW5/cVxwY2DQwQL/r9DtfJSo5eND55quPvfXZ/ul++OdiZNGv0IdZ5h7lc2hmoYtaPDS/iNCvOK3klUHnX0mIPux82fnyzV/6Um2OwKA03n1P1kNsHyG95BWndZCEnH+NkX7SP39PDRtC4XYiwu+2qZEVwOwtBbmJKzfVGwKPRAJD/FG7NscEzkPc0u2bLtxw/urhlkIqEQrKyHLOBg5nayHiiALFUKrRSlkLAuvMoxEzhdovFmPFXM7zzHDLspq4mFuNLMkJm6bMM7/C4HpYuASLSJ/L6UhiirxD9YaaJNG/3ifL6+qiHlkwrlM0o94+TzKkQUsQlSbVr2yXFaKKOxTdzrpllXWRqEfhA9eBOO+P2eeJfnnYFASPW1idzeV4GK8b8XB9SdKl8Hoi9vqUkZihypd6tF5RqsZhDdFK/li9H2YgK1sXTSySNdlcv6Cod6korozVikYNotV0BC5OPOVsrhWpG8XoNJb4gXLoKj/zbsNaXbTONpi7RVImLFqt1pSVWhvJZTxmDAcLHnYDTjaRxR8m2xe3n7/hxQ3nty1e3MZ22hcP5XMrVj6wckUuP7cz+D160xa8dk7pLaMLCuXhz4qVzA/8Jv5NfgnwsHnEoeM6uF7ulurNSSIjR+6ziQdDLBVhyCBcAFhtTp5G32BohekQ0Tm/T/fPBInPixYwH5lWMeuFR6GeaU7heWWMUxQUNBRMzNrenskQbkl3ubezt72jvaO0mCXQLTQ3ZfKZfC7bEKuvCwW8qkfm0iRtIkWdAyqZXY8RsgRtfsCBwl4ngkJh6GqyM5lPd3ZkO5Ph7Kx/OH/qzDLF61XIDbtlr1cmTyLp3Ef2w6b+zMX0Aedq8r6jN9989k3+Qafb4/MFfT5+iaqc3a2o+1UYPnDPdtj1yvRuRc04zeQfz9y1Irs/s3//iAZlg9j/4ju/eefr/M/pv3NVbgQWr6u467kD1X3XbhtebIiy1E9U+cD2Id6j7iOa5yri1cSha4BiDOLIQfwGReQxDhaoFBWRT5VAAEdzM7SBirYlzetB84UgMHc0lIe8wsgVezdfeMH4eaPhpkxjWzZjBljIvztgZNRYsB3k52AKd5PFzEWrhvG2HE+wPO95Nj3tjlpegrKIiepAqmJQRvPWB5mvIR0VCUuMiayxjY+Cg648egnlu+JE4n8s+cV4nWlpdaQhEIslc9nNnUuvaKGfWmKFE2Uzc1Gl54rWT/HdVjheaqyHJbuOxoz6aCIjOneNhczGSObq3KZN69+npm1tWEva3tW5i8vFDXFzUX1+8YNXq17NVhv8ybD36ujVGcs7VqhP0v8jinEfwjbgSDXS6Ww7vm/N6jvLoWyureUJ2r16+ES5QVcJEWES6kZaNI6Nea3M1clMo/MLzU6rw5qd8DkfyBWSjeaiIzfAm7zua+B1+KZIPBwaazl0DZOPMD/HaZjrTdw6ROVYVkkH0NSLwDUocOwBBmYvh47l40gaJlF+GlkzvLTHCifRXYm46fFQcnW7qpZmlDC/O5QzULrFOAgZk1JJbiGZoGevzKipbTH8Q/QylPiTmep7fnEVT1t6vHJvMuqR6CdEzSc/duGX1u9c2xSEmpnXimR1w01HJZHaicDQtpGpdUvJpOj1i87H+HDj8j5Zo227Xh9dXJdJ8MXM9Xt48b0e6lm7bWS8q/kTot8rfkIpN3eONIUFVewapMKB55x/Xsv75KWpwFBHvi4sw9OglPOxDesPbsAo7ju2XV2XfdTFv9gntPGrGS51PXcN93nu37kHqh9+65+ooO/cTEXl5eevgNX5y088fGBsZFW6wUO4px+sQiv2LKISvecG6uXloX9+jeqrbiTeAZUoHtGjiHvQZEcleQ+nc4JHx6AUhfOMcyLK3ijyANNPxxE8EaHIYP33ehnX5p3kvLx35Kc//tpXH//k7bft2b314o1T5VJLIWSaC9IZM8ohMmcH3GOIGaiYls9dDf/gYtg5vxYiu/on10KGLOMuhSw+ULZcR7U2VMFhihY3LXwtahAxIhCjBdj1LkzrwB6A9QksvDeXZ/f+N28lp2sqxyfRR6DQ00pq21cV4T2SFmoUBG3AEKthS5IF3w5J9YXsfsEnrRfEjOKTLxAVRZyQvW45VZKqoYgk81iQQMkVok88X4gEFJ90AbBd2zdIaowOEDHc4NW8citPBvgGVd6wQVYb+LJBhIISCMRsga6kMQ+crpUuKKy08F8Wnl3nf9zQSpsaGwoFOgU/SwuFb1wKddFDdn1W0oRAv1DySr31PgUqpJUEYa1fFJVWLWL5CHAg4lxJ0YCSqtIbZSW9i7GkIMXDvvqQRhXn70c9il9frlPaVJ8lxFsmTZTCsV/xjHo8hg+vxD1lGIRNNsnjJZ/hoR1wzb0rj5e0ct69yQM3KXM3ATHLz92kuDkvQU6hIP3WsP5cpPWV3BD3UPWBFuKVlhKfQIeigTAvG0TyytK0TVTOq6nemTq/yYs6EXyiMB0BfsVHNd9MiEHtj1ueIE8URA3jYCGfUwcODFSri9uTiVgsEjFNUeC4gaGBocFV1ZXVlf0rllTaly9e3pxLtCXbYo2xxniDCwlo2sCohH2qEBJDDM+qHsgdAhFnWeonNlHcSRFOdobgPG5510wk10RRm7zrGOGMQ1Du5ElyK5Px8OdNJ37kCD/lbDviB3nOOM5kPHLa1X+5ByuOHHHi1aGhBZIqOTU0ROLDw2dPDg3Rm2ZvOw6PcN6YvQ9FxyG32Kztpx1ovcKlgC9aX13H3P8EDwX646aTUWouqRLmNJZ4XhqHjYTtKPEjmbQKFK0pn27JtDTG6uyg35NSUwvsPrC06iTXR7IISjmfAWspYlegkRjEtVIfySEYCqafnz46QzeRbywdJ2O9Z96C4b70SMzbHSfxhm5vg3MavZVeuk+6g7w2fWwTnbnx4p+NL3U0LEZOLx0fqW9qqh85e+Tur98rHH8FgwY0kH+v4H/BjzKurx0I507uAHcTdxf3EPck9xz3Ehmuapes7OM9epDA6KhF+4/YxPQpPlPZEyJBQRSC4p4wSMo+k/PNAIkOEN2j6DOG5ec9wDYJQY8woyH2J0YLTrPsVGPz2alqgfxjc8/kgkJICIb2cCERBtKu/w9P/p+t6NRUdcmXnt+yReKef+lLLz37ucc+vu+KPbu27Nxy2fatG6fWn7du7fDgiurSHgxDn+VoLZPLS/kI9nT7EtK+OKVT1ARY6H88y8W2Ly6z5R7z+oSAe+U7+HTZhgkQ6mDRPLjEhNM5DCJH30FrKbHgMI/IZH20xBKr5MudbvBoC3UjfjCw0EI2D8F3YIGxssirMdYCU13aqCNn0YUwsqwQKvisDsaBFImYx3OuArCS42tnEUYM+D3yq6W7xhZVFntlFVjpBPDQsrfUuWhsV//bbz8yzPd/Lct38011mUxHyJbIWiIGzERdNluXh9PZlrb88OYdm1fn2o7JjSrQvOdyqt+vBlWZfpOqKq3ykq7z8Ov8gqoiL8gS38vrusQ7/3YPXBcl+W5Zl8QH7pFlXgRqd68M4h9fvgdOSvK9AtFEXvyYwN+jSJIuw0WeqPT6lrFdPf1XNStWovsY8vLv607YSvOV/T27xlrO2ltI3nHuNRsvITTXkTVCWV5XPI2mnSvnLnloS2Nq+5KOzUO53NDmjiWX3CiJzf6wYViG32uQVUQS75b98Oa7FV0WZUr9svtm5/tVImnsQ3Td+Xov1RUvYR+yYrn7hcQr+0nJPQef6FNEiXNtQbSX/CvwNHbV5M7FVeo03SjzWc8vN0feUvVtb8z7trdG+/63DvvwL4bKLbS7/jX/Jv0dF2FRvcMwr/+ae2/1+m2E556eAMaKDnE+v6b5tgFT5OG9CDAm8B5hFxA7v0/xz+iwVqicpm5BNtbL8TOw4tZi0OewOM/NNNfd9dwXPvbRR/78gY/cfuuuyzZtPG/dIObNYTHAy4rdiwNoM3AVYjio3RnQyeTcfC7ENAxJKee6uLM5sRSVaSwn6pw8Z9dMryZhEUMpl4MOx9kQ7nJ5aGR4XP7Yxhgjk0Ex4F/22M6yzOTttPtelCNx28bmg8yeqNMGwsLiGX5wZ1du/nFhunlxF1l/c1veDBayVMy2mFZzYyp3I7A/wtnfiZogBPy5ZLF+IE9yA51m0MgmnJ8NXDR960Vb1MRUdfmFy8lUcfXap2buOrS/u4MgKnx9JSh1dgMJopJ587rq8q64rhPq9/kj9alVKU2RSBflJV8ssMwPAky9bTY2NPga/G2yX82GMtlFa5uJIIU6iz4FLqdK37ntxRsqmXCEyuELzq+OjawYXL9+1fDI2IrFiaxzSUMkbFOgIZH4spXVga6sFYm02FZs+a2vXXTr9EXHtvwyAVVcfiH5fns01pBILOlYHswbeX+MyA0Rw/DVeSXJjKkeHTg6pV4LpFSvxyMoKc0OBbqXrGn0h2QvkUxRV+o8VsbnBXYdEY5x+RDFhkKDN+ALSgFR0NW6tNmcKnWXwzGjYHMC89FysazQl2YZ4iP44DYbllZ00RJwdO5BHR4i4yPGvMCrwrSXeGAwehgwLCaIneY4WWaYxajj5+SR3p6O9kUtoY7mUCgZCBgaSMl2shP/MpVykrDsv4hky9iOcM0voJMZe1HhXPPXQhadeRifIqcdjZyeshLOR4CNSASpFYsMatKRhHX2TStOjsgaqbZkEmFyyK74L/BHSHpRn3zi1KmENeUc8ps0Eo0IRuBNWSVTaAie0qQ3W6uEtFuJiH6BUbFO9M3qy5lfZDP3HtTrIc+A2MwYrAYCEEJDoGs6+qEy13RBFt2g5vH5oOYN569bm83GOpuzHR4MVAvPsxio83fnwWwuHdtVqrB4rpA8i4qCQc+WH4UdhInvk9HujaYvtMvzwemVTvvK6emVx1H11tIoCn3MsYy8nC2rhl+xj55S/bJsTX2u2l9HfbJH1KREJEgELZhpqo5sXzplybLuPeUlhTvxMeTl/mmiSX7eH6LlrNPOHnbIK8q6RyXqKaBTkV2r1z3nk4gc8PSWRhvq28vF1qZYVKG7IkDDTqnxeT3qm/QLXJrrQkt/fdDDg+w/RGoQ7qJw+WwcB92ezZsx02KW/j9pVS7niTxnE0J6Ak2Zz/GT7/X70/5m/3vfCz9pP25hU9Bnj89+7Ieb07GG1OYf2v5QyE+m3wsXM7p+4406bApY/pxj8vW/iKWeT8X+whCEJN2aFATGi34NvunXzH7SwWWqyUiAeaETDK70KCBKcbPRUYWmdBLhBogrq0qyjbqdfE5813H2D31M+4FVuaam3KoDE+2lUrvzz1c3R2OxaPPVS1LpdMo5dc6X0F9vXTJ6/ufPH12ydd2OXW/t2rFxRzCTm8ylQztalq04vmLZsdqH+HkxSS/BD5mPHYaxHYPR3Vddis6e0boIqruHYvWUIrCXwBFhhmnAKTeOWw79czk6Em/IpBua483NdQZm2sym832k813KUjSS22HSRVzQStckQ19aFGxt71g8/p6X3jO+uAQ7E9tWXdcWJA0TZ28fPLhq1cE7Dg6uOvT9YNt1q7ZNjC/uwBJYtKO9NbjIeWOCNKw6dEet3CwOxCfhOzBKBqWyDDdR3bDAVK54ZI8i7+Fk3iPzu0TCSx5e2qUSVzcKy6ggSGOcJAkTnCAJayQhnWqMgyAVCRp+3ecVbMkOGF5Y+EPJcFKsaUGXotTU4Wo9STKQzM46I72NdIk+deaeaDYbfY6cfj6ayTj/4txKDhGlPheN5up588jyTNT5WjTzu99l68iSaObsCbLkuyG8Vl/rl7f5n9O/gXmT4xqrsVw2w1Nujg+pBaktT4aZn1DOXUCZUZxlZncXWWh9y/V4rZRJQOR/yPuNunju85/734+l4tEk7/HwRiDakP7CX3710VRDfYpXoBbdtD6TyFp1xEd0oT4ynL7snsvS6VwkJmjEJ9XXDacue9D5Hbn0mfm4xq2wVnSih0JnazoaUKRzGKbm3FKKyrY4Y13byJz7juxGKixHTEnkbVm4gpsqBegeGpn8hF8a1fW0v6funkLDUEMruTvag7Oz/u67o4Y/4++uv7sQH2oo3BPtNtLwbXcTRe+JLoN7LvhUQ4G0xj51AZxdBjdNTPyxCzX6/jB8wyKunxutrl0Ka3iWiCDFc+iyI1PUcmEi8z1Ar6gg7uJYvk1G86VZAIsFtN60w/nOJZ0dzIlkIaFPolslxkLmGcT3AlLP9EG2FSILwwhqsQTztJ28nI57eLlekkWfVqPJSODFjCTzgve9zhJfRv+lri+DNvoguQwO+nxk7Wfm6LkuhKQYDP45gv5+RUzDpxHR6dH1X7LyPrzRB09Y4H9iINJotQmhwDngWf8AjEB9NGx6FM4ghuiCCPBx2seDHLUQjok8ufroTDft3XTL8WPTPT3Tx84xxtO/6Z45etfR6V6hvP26+6/b0e48dK79nV/go4Val1S1EdORo6Uat4SbdDN8j3Tinw4WKVXLjz1rWhdrx13vOp5Ni32q5r3F3Mca3I17qpEdwM+7/LysP7Jfs0X9lvvHOax4lrUYWCUW8MDN5Vc8x84+V/OuhZqXmj/Awi/hw64WJ1/zfTv1J+qD+/fvZq5vu/EskRZcJIr7bfAz53c0xfTqZfT9/uN+AR2lRa3ROpMp002G2ckycVoYR4mGiTgt9cGpXL4GN0tYJgP0u4cvmBrY9/ATH927ht94fqTXCCqRSm9xZOf+HesLpLdiq5le+/yNzkdQDVrobSLT73lw/8DA/gffs/2zfVDW7g00H17Zs3OkCPf0DBwsBHvaleCyZ8iwcz8GYpHt8It4uW/Dt/wC6KjCrYFKb+eu4m7gjnHXVg8fOljtEzzK4T27d1zav0gWPTddXeAJd+yGa/JBURVuDFOvKgIFkBRJxhzFXt6LyRskWEskBW1BIoe8LofAGuhIxqleQZ3hoBCzDaHeycuPbN960ebJiUK0qSnfEg0xnhd6SydFWrFFpHBSKp8FFs+SXeyvvBv+j3l80FiPYM8Myq6W3xSBeRtJtsIgM2WxwlQRLOC/o8T3EXbk6hBCNmqZ8wx4LQ20JC+G5UYKZFXsgvfJFJNZBxNBIfo0qTdEY1gOyc6f9Qm8QoVK25r1I+0dslAprjm/mBOVgQFFzBXPX1OsCLxV17Zu/ZpiN08VuY+8F24bhtvPXhaNLSp3FcKw6ehurlsUi1rN3R2wCRe6PlQJKq1+IngIOVwh9w85G6aAcxaon7wx5Lx+CcgR01aM1Sb1urdJyQjCqxk+Fm1Z39DW2raqAJugIjY1i3KgLT7akuy1WtsaRlvr6/nsq6KQ8eS1dZE1saQZGY4nnQOxNbaZxB9yKCmbXiGqU3jxjUGyIvPLaqfIyyLxfzb9k3WUzuFHMf5HAem8HnhUoP9BlQp8iVChnojoVC4TDCpkIWYChpgJHIXFARMiQBdA1wPfwMQcdOvipJHOdGfIzoSSBroyYVIWJsN0oSPhAg+9UEd+Ln6zczZPGGbEcfHhyZPkNHqqnjquys4h5h1PbpXVE5/4BInXwiadb7mupxfBRNaUnxjWeWR73H7zkQxzrM/gPc4HPvGWcysrNpUI07fY3l/Kyk/8ldlcLlNMzktyi7lV3PnV0ZZCOiWA8Drkg0WQKHSQU2UiKKqAKVt4CT9fQrsomRbRsOzhxnDLITAH5xmpLuvutHMdgdDSALJLrnwngtzGzDDyvEQXQJ9dlOXkWWcu17eyVBHfle8CG+MUedLZQE4Pa+KfizGlFhg6PAxy3bfg209hCAE2EP5ujdtng267iCDzPWBY8ikQE5Wo/ICk1dx9z1bYlsTdYCi8Vz37Np6ib6Hk9+fYOuiT9Fton/8F7XM+t4W7EuMNuolI1hNB9Ps0nkoM5YrKEjo4YgQbMgQg24jTcwiB72IM9u7evnV688QFa4dX9S/r6VRYeDoadNkoQNcaoJWdFdcAmZvddrk75RzC+qN3fB+1w7XGY7eCWIjqm65QJW+JEmMp4FFstKHGcfaYZWviP2hp96vV7NmzLeuBs8XUE0QI+iLA1wiyqlk8wWwAPjXKC4hM5RExT7hpGmGZ/K/mou/DZlPZqfdror6S8kZc/IRAwme/SCWFbFB0qlHJ4zwp67SHV2SyQdaBAioynuHpUGOzI2faSW9rNuX3yaIuSFI03BuWLK/HZ/aZYgTe79P7w4Lp0WRvQDXVoKIib1JtcqT+HAn480Gd5nwhJVAb4Pj79PxgV2rxZb8RDgG9N2BMV9jqhTlYiPiHMvh1dWebbLOGWVVDmYYFKwsHLSxHg4zoR12wskFbFnnYTZbilN6Ey5S78uCGPNE6umPpqytH6ZpVr+KKNASsDRC54RqzM0iexF0y3TN/Dy5aeFi694l7S3gwfGxTH9998Q333rC1TIERqskA/1c4DN9iclmMD8fvoxw/I7iQVMJCSKp4QzhrZbvKopsWnMKAQBRtrDcVWWodxpNhzdzqsJq5leQDWBVaWL/98Pb1BaE0vJdMI6dW48coVOs7535yLY4PdUQS5wPucEm1Irh6Uoy45kQyzUsUA/PHccthe3MYtRSrM9GhRIHvkIiETno2CE7AB2fht5btZjY0D6nhFBl37td4yfkIDDB1uJI5G2QBd/StbFmmN509IWsheuXZIyr99NmNbiTdY7jB+atCHX/L6jibD/k8jHfh/ow7wT3EXVM9dOt7L9uypHuxLEtXX7l6RV1A4unU+c1Jj0KA4sPkhuWaSnJImgn4qKwjvrRMZ/weyqvoIQ98MDrZBINkHLckOMkFSXDkwY/c+8H3337zTUeuPXDVnl3bLtl84QUb1q3N1f6kzTn3VtcXET0PXf+Z+WPxXf6tpPO/vv7Hyv+x67Pvmz3uqpHc2UYncVVx55UbdTq7SxpUefaM8+M/cgFvng0ydd74w+fnf87t0XlH5Nd3y6oq48/fzzsnf25u9+//u5dfnzv3RYy0hNdcxIbHvO+ywqIzeqtLMOKUsoxlOMlAxkOQbeZpKgiMiOMg5oUR1ZNojNYZfk9YDdec9NyQwZKVBxISRzPhuXLPnGfdnRvuWE/Hb3n82IQwepxceA44rWsx//XYHY/eMcZ+nJcXiD8is38equUXcHNPb69ewomqeLmfqLx6uUZ4hb9cJ6ib9DI8EA8sSTA9L/cRpt2Azax6A3P3ukmQFubGVXwKZkHyLEiDZOAKFUgH2P9wMtDB9rJ4tO0E2XacvvS7W4fo353Ao2nnDaCZ8bMnae/ZI8P8xjNvkdOwaj956uwRetOcfyT7BpHzYqYpeBdmFx+ad4FEWGHOhbPkJvCONRynyFBeDASQsoluHULJQIgIh+Dd/MbjZ2beJitk9kK61NFIP1nh/JW7fiOu/kkWz25wFiIsQB/zBvYz+uoz3KV558tabGjADITT6A3oQfrPurAjlMTUBMkAk2FJ+9IH33Pgq1cIh7989Q7yF/3LNjkboKfIFuflZf2EdZizYfLBpeQweXLfV9/13Y3c2upwxEsF0Q4aMKQCGGI8hFga7879JLlNIS1siob6sKn73OaQ55sD2Ko24sZt5V3FQd51x3ab6E1THXAeknTpxjd3kSERtoRf6VF8v5LVWrM9+x+a6sEy0o0/300GJSwxoFgq+gD/7p0n+Wne4FZw0aq9rLuj2JxprAt5RW8tob3BAORsFGVs5p08G5fhovnjb03Dk2e6nlylEU3qja6OB378KBjKPLcu4LMui0sBw95RL9qyEPCuHfFHbLF+h20E5IbLLF9gHSvTICexSNEYWWsU8XJSiuNVMg3HUv2lthGU45fZMvFBeVG2L4vLQcO+tF4qGmtrJVJyww7bF4Trmr2jQU65V2vywDf5VxhmnQESQQJxihMNMRDaTULFSFjjeWr40JMU3f1lQZJRHkCtEJo9ML/fjOJijykMewzVYLDuoTLRtkJBvw5CJXM6wNSk2VmH5nylZMu5lJyvJGCbmNuSXxR6esZ6eh6fPD052PNoz7fvIvffObjf+eLBb3+d9r00+GnH/HQNn+yKycnhnp5X7r578ODBV775zcGnnprz9edDtTXwv9LhUC5eb4VUmfNTv1hz9ZxVUKGC0w6co8iy6JULFFDl6+ZVVP0z9G/mFEx4cWruyjQKS6yNf8tP0X8GkSHARWEcbate3AMToRgD/pEOacQrEB7k7RnRj7IFHfepTNQY14kHrU4IeUxkmdUeTUtEHvGqK/v7V/T1doOUXGovNOfSiXidjbNFDXhhjhgIiARky3X+5zHwV4qTbDkHwxZO2HPh0claeLQbd8GgIEpu9tc4kfId8N3S06axyzDf2TPoLyZojNwXb/Ov2m0lvqUqnSCZPWIlWNjJrzvWrOnoTQ0PpXrLw3Sk9GtF3UzudK7QdWKQn2wMxIvxThBeAhsTV8PqWAtKZMvl8M5B2rJpU8ua7SNUrfk5fobF7fqBi+mslli0UYLMw3u68UXTC7rURbxBmM6cy98GXOlTrmUZdPksM47QpLXgW9K5EBLhTVU5cxNb3/kjsjYIHfqtoEFMv/OG3wSex3nZxT04Ar3cRL7FCjptsOCSVxmigVlMyejro6Raw7PoBmhX/K3QxmLKGrkCV+IuqI7VBSgLPcFcagRdPRQ3Psgza+FWiSSKriuPOAmLsjjS2pJMEK59UUupdXE+kygkCw2xcMgjcX6ioytPlztI8TPYoCU1RIjOWhtgHk2XyewUS2VghMyON+dZg8zZE5pEL2KZEx+RVfrOVDl75ib4Wjrg8Ux5PLeUs+RWLO4cguJvLJDNiXb2dIX1Y6USDLqyyG/pUcZjRLgmbrqqBQMqz2IROfTg0dZPVuNMRtyKNhaQdVhOTWbHR4mRYhBdAy7EV/yx61N/2VnJNQeZ9/qc9bSWQXJhX5/D3m2rWUpfUWXsM+g67MFh+KQ21qvkW5lKddY6uovarC1+Dr+08RwmanYukyeZfi3CtAj91eVBXNcRmAxD4mROEOWFcTtcjfycGwvXWV5czmXdZOpZFvSAGavelRuTZ70FK1vXAmLEkmLy0VyExlLxfarivIHMH4nL2m7srynPI60x5w2mE4w3FKpoYoGiu8gtLCHmYeQcf+QJBs+exCK0l6kNXR8Q7nvk6/BdiWrDOXCSNZLuknEG3jlLxvcWq9VN1Sr5enVjf//GKouheQf66Ur6IWyfangeNXHh/bBSG1ImF6yQJTd+/vPOmWfpM/RDzzoObIn0TM2GeoI+yanA9S2qFgQMi2bZ6BibgLKgxGRBERMejQQDoQD8N7ApgWkxpXxnqZJPk/ndIDnv5O2bjpIf0OLc3pPOZ+84SS6/cZqMzu7N2W9n391WbcW3MoQWqAS3F18IJEfE/H+Y/w5ozsK3Z5M45MLQgR1kfpc/4Xzmq7duvvEHZ7/tfObk7bBjkPNuf5FcfvRC5zOze6ztfvjOxfQFfgIoRbIaDzL5clFOkQSR5RtyzUt1EdtCA6stsZyIua44rRSRw+iCyWCX5rXRaD3vQjhN+OXlXskMUqG4tV1tbQ0aUszaX4wEVUO7M1W8Rdcisdava0asck33wzuosLM93l/YG7/N1JTo1uvv/2hi04Dy4KcHW7eaxZle+ksq9Ccie2OtGUmNtMfWDyhSpNfo7tYVwZ0fl/P9/DqW+yDBNSP/F5CoOCAT9J+AVkRSpxCMk8UsEyITNZDS8eJIKmlbPo1wuWyyOdUcq7cSdkIL+8Kcl3gZmnuKGcW7KkY+ly9ZQdlDckYllJLcrChlPGlierYKefiGzRde+P0fbNy4+cZP/we91vkn57Vrf/N4eTSf253Lj1bW7t597066l/5046Qz9dprk4R7z8Ydv3SeOOy8TlKHyfgvnTdGd+az2fzO0fLO+6Dk3Xtdewx9HvgHxItK48xHeD7ggugMxusxvbhCBFF0M/fhRwniSF0EP6kxFknXpUDCtn2WLMAHqbVc7e7Ehmndmao5V8GZwILz9DYrFjfPftKMxyz8TyfxeP4cuTPeFId/W92N84q7xfF0Fur7EH2BC3HhatBDuFXExVTnQiSIY6gDjW996HPnmitkIqV/m7KeMZTWnuBB0mRUohFNdz5qZmL/EunOKJH7yXfhBJw++3INQ4CcohdzDYiz0GDp0u/hLETNEIujdFEHmZ+6i7LQVQNZQIgFcjKYKQWPHmXowrfdxvCI8SgTvO3FYCll3HcfO/XAg6wAHKVKwQfx+/79nQfpv/FxWFulpyMyxuvBNLDsSldcsPtIPi7ALKjQPEyHSg5d5nWWKFZW1wt56W5JjU/09QogBvrLvWU1tn+6OnqVWmiVJY+qtUejSvR9m95qfqZ7ePWzpyVrYP0VfZmJrFaZ2X7s8LHO95LC+paT5eWjZmBwMNd3cffIA24sFv1r4FsauSXcVoyYndl84eQFa1b1V5dVSrCAhwM+WLARUfaPGZi2XnLeaCYVZ2j3iCCYy9ssGyx2DnxcHsY8TGZY2zB5JsI75SW5jEieZcyGC1O+jP4i9nIMkkGschRRaki0LO4jz36ksJnKxIVGM1St9vuX08aGKvEbKTIz2qCnRm/ZdutTy2+7Ys3u3pwh5S9dNm767Y2RaovS3FhqNoxQ2+I2O98Ts+qlcLPgEagu1Ss9M34pIvQYWku4LvG+kc/f+O0Duq9v5ODS6U3pzB2rzPBo5pDznwc6+gfj9PGrJo8RK15JJR76wqWrNn2yoefPlIkHe4584cRldx1oa+7evWZtZ/8qsxCviycOXaJSybf6ov42yehfNB62L+4YvxkEF+AT37mM/zm0dZbrAFltAtp7H3cN937uY9wn6TrXs7fpBmKHP0gsz3oSsXpVavovWkqD5if37JoWuGBbMZ9LR4G4ykO1bFpQ3lMrr/7X5f/7j56acusyzQVNjgtuA6poRcLWDFCQiGpH0K6mEo+KllFFJgr6U/k02TfDaZzh14wZ4B3NoN+cqQsFdK9EZTe//JZ35yCvfcH/K+5bAOOorrPvY967O/uafUharVa7q931WpalXWlXlmR5LduSkGVZFsLYjhEG5AcWwo4B8zQhgaZACCYOIQRoElNC0iSkBPIAmqZNAhRI/jzaxBDS9s+rKUka0r8laX/HWv5z7uxKK9kOpE3z29qZuXfu3HvnzH2cc+8539lWU4oBpYSoHqa/p/zTf4C3KF2IBVg+Mvs/VAJ69mr7yEMPfvj973v3u25+x3XXXnP14auuvOKtBy7dt2f3JRft3LHt/MmJjee0xL2dq7qXx+P1cuNysQNtO3IsFqKo1YxCVVCFkWseIAV6GMhUMHqvpsVOGLjnHxBWcEXsfwnhpgP7qO0RzL8oSSjfzyBbCKgYAPk4n4r7u/DBrk77sSA+F6pEVbMSkWl/vjPV1RabDH7xxj0fyx51hg3FdY/EJpvbqGe2NT73qeZWOutZc8TNJtxH3Kc+435HPHDv9OTt8YaWe6cOfKrZE6tzMo8heZvqXG5D0pqtQxsHLoP+d93Gre9sbfaNTY355HBwZ8/qqfaWxomGdMsdaU9jxKznvqZ6eFK/D3IwRQYQhBw+6GNXQpnXfvjy7YOKFg6ixNoWC3uvD0OVWuPh673hd6/0eFa+273mwht2jrgnpu96Mj2yulFx68vO6W+UPBor/8P6bcO95sDEvnOX51hhmSNfooPFpqZ+eoClN/ZFZY+xbHhNI2Put7H0cH8EHs2M9EWBP/MY5e8ySbByuI64mT8D4wRwc6RA1pFzkb89d3Tjuv7VhY6VBqNOsiERd3DbP0CYyoHl/qLfxp8P4YWtalQshKqo9KGg2Geuxq+hTbj5lEoX0du1mi60sXQxaG9dpwUAeCp9z+E/O2TUhVtSoYOfuHrq4J4LduTyTvOTy9cwunLFORvHzlu77MJsamXrskwoLEmp7CvXqbKzLpfu2NIpy+6NDi25KtE/unrNmKYGN/kUZU2uYzVvKJY/31030F9YRYvlz/Vm1/bd/LZj917xNjnQvOeCG6+97GChL2p9PuCPNvSuKq3PdwcCtybDuWCb52b3wAVd0PQS5wy0Ob4R7Mgf3TI2Glrdv/aKZWlf1dfNCR4A+SYLZCmVVq9bu2Z1X2/Pqu5iV14YzXp9dD2ntlrWvCa2JNjxRJySdCqeTWRJM2221WOEznVVRyuEM/T8/65OIBGvOleiLWpa9gP53HQNVUPFUDHdRFeCZBSir3Vf0tjkNCxnNO6N+IMOR9Af8cajTstwNjVe0t3c1jawciX9Uvnfv/P9cvn4hxrc794w01f3Mcv/cHjN7Ia7vHUP8kBxZXuxpbmh0ZfIhJdlu/r7u7LLwpmEr7GhuaXYvrJY/sXKAcxn7r6L4B+9tJSKdT+Quey64S1bRq+7MvPh7niyVJFxeunzxFzsjy2HmvItYkhooxWETdZructOEC6dJ42ocdL4BFoKRR0nDeOkoyp30b3sBuI6g+59yPbw5rUWtKSENKuLxyNhtq3sNIOOiio+mc9vLTsCdTM+L6C1qFBWQcULFB9xJTJI1xpCVx8eM+iUWdHjtytJYCS1fftOzPv2rVp+JWCuLZJesbN0Bflg6f61LazRd86KJPc3sqEYjdZTX2PUt6u5iTX69cbJBuqvC7m4rvn1C8NBJ9cCXpXLkiZPWR6FS24HR3QUqIEBElYkQibEBYlsIxESGT10cHb/3j2XAA+19dxNoxvWr+mvtEFoMx0rl6UT8eZYUxR9SqBMFLD8Pm/lnyeOW/H5rgT+0jVnuuTM59GO7M14WpO+WLlX3agvLrKSmkcaroJxCQXtoePHn3nssWeqR3r/44+feOwx+snjx088/vjT1T1cPN4vok4cP+4ztIRYUkloxoutkVOvolg+3NmSbOk8UUgmWgp0qDG7+fjx48nHHnsseXzu6eMn8ZB8jLYfF7kdF4oPKbh3/PhMTVTrXJeQ8L/amC3gIkbBPmaJXFlfwy9bV7G731/aG/SjQ9lGJqtsyKAE3VoRjgswksKkKY0qpu7iqqyoU04qYLHhVMXFzmSSyfp6j4eSzPLM8uwy256+PlEfb4p66jzhgGUvV1XdrtXuegaQ/IjwDVJPIS02R9fQrnwgDz9+AusslqM6W+DV+HFDg3c7daFTKRwdOsEdhWTtNuiwoR05ohlzBUOj55YfgZRDw8NoTlfBxOgR6xteXFMQfqlxjcN2UF11moFGc6ZL9xpee7lCqV3uaF667nFHW2lgR2X9AyPEsaK3d2+lrHrSUypqksoU2V4mty+hRKHMR0f9Piw0FPTV++tri9bPWPQZ67BtQJxr12Jqj5V18Sf5BEdt4XbEPcsmG0AIcSN+OO4NVXdhlsDyBVb1hAU2GzA6qcUweTb+jY2yLzTzUMcwWAXOo4/A4LLlSdkjlRTlyXEYX07CwPeRhUsramx5UjGVNQrtOYkuILY8JcsliIAUMDLRS1X5KXFlirvjT8Jd2da/3U9vh7EphmskuDV0QBKLTJzOY4Q1twSa/WIVGHUIvbiUPW+91EtRP6lQGZ3pbUFzaAgHvqMwOh81LPfwMBZ3FEbUow72Iajo3NNQ1aMOBySwWB8M3Xc64G9+rOWvMC/UJVNqQai1ip+QgwJyYwIhN7Yi5MaI3x/y++2FaXskXk3RFd3CqI5O6jpttMNXIHuQ7U8vFkfqo0A+rKLDrmE1YJB5LJBP8nHo1zH4ylbJS2lVc3p5tinIUZ9bmO0JAE/8VPJCkEEQqhKoSfAxY3xg1y27BsYNZrB9diBb6NSYUf5rZlRv8tGtt1/WMzA1NdBz2e1bJakaat8xcHi9VC4txMD9Slu8kbXzfugdCbQmqOICsgNLFYgyVjgk4N6ivLaavCCsJIRJYz7X1VmkcXPnzuGHf/zw8M6dJvNlmaR4pEwsloyHe7K8cPiFKx+YOPTQQ4cmHrjyhcNa+aBkKEpPW/ueXDi+fupesXf6y9f/hd/P/h5GxAI5jxRKecKFofIsYTJlqAON0N0CBJSIjkzm10YbVza2puuF/q2CGPr9LMoQ2sKWvXGVWi4EVeHRDwPCO3g/Rxaxn4YKYrXujPfO82Qikqe9/8o7H33nQHcqFktdd3D6uvV7JtvYZ1KlVCY3ldt1IwZbzawZG22dmrhpUARTMVPyzN9uzy6+zYKmFG01M5lMbFpJtUeTmdjlg6lIJHosNhaLp1LiOok5DMRaWSyDwb+PpcxW075ZH1tys/JNH+Cv8BjwCVnUjlEo9E1hjHBQoNBMVv3LLaCdw2SRakmEgw5dlUgDrbchrGBugNGky4urFpXuURTzbV4WCLUJmITTuNVBP25ZbdajHqfTvMYwrjGdmvWoxS42jMNByTTLf5uhW32Wh8esUw9ZFn1CYcaEYikTBpO+aH0Tr5zKTwRuFdb96/Q19iraP+LYqFC6XvCyB5HFZWQSXRFWTEA8bkosvzvkCRGTmnJljGZu2iZBB573gndy37EbSv1GfOtA4di+7vHxg2Nj7NVjf1t+deuks+2Wmx4e2HesfAPGHhwXMsoLMI68VuGxcD6GsQ2teGESTVbZnLBL99t70EHB0uEsqtqravhDvkRgVaHfNS+C0uBcap/5Sx6P5jFeesnnefklT9zzM5/npZc9nrlTH6PH4O/jcGTbDGvuCQv6xa23Ggb8LIsNW8YxcW3MfZKe3FdWlhwqtHuUT3ETeMQg0T4btHwGWyGUyVBR0E15S7II7VmlIT6uKYYRMQpPlQYK5VvoU2WrOxjxTZa/GeFE80TCheDB8kOHD9Mbun99HYzGmrKv/MrPcM/l9VOv38C/zEvAi1pAn1ZceV0eYcKlVAVxUUY3hhLwK4v2B4SuGK6+ZtJej9NyWaqMS8mioRVgyiWqAqIK8fdTlpIUXzDdL63BikM/9KPRJ8gnCn35WRqRWPlfnnu2/EMm0eC3H/h76YflZ1+Wvj8qeQa2PdjXB6fW7EN91wSzPVZn8lbeD6mffa78Y4nR4LPP0cipj7Hv0z54oPz0yw/Ujz+6rWQYcGrNlgyqWd2twc53JskiTDj6l/Q/2NXC5n1tH/lL8hfkCfIhcg+5lSiCvTiKphhw9TL5OzJLtpMtZID0A3Meg+HLQBhG+kF6L72H3kHfRa+jV9Hd9BLKyQ/I99G1HlHpuXQTzSD8D1Hoa/R79Fv0q/Sv6RdpN81DHGJIK2TIto9fu65S+q3C1xiB2uB2jPwHqINKhuCdcSChZLDh/x8hcA0P0Qe6UO2VMzSrUriKuNAaV7QZYNa4RmcQfAcYOUTf0bE1bpNh2CO8CjPQI1EuM5nvJkyVmToDech2HrKdh7yQhyzbechbkcEZafgvlrx9+9o6scD8Ej1Bn6Sfp+cDO/I35BnyWfIZ8mnyKXItOYxOKBCPAdKhzbVMFsMI4pSU66ddyCyEBNu0hsJQY6mdKaWrTcIBGgcfK0utuBJXYV5OFFLpfBuD2cw2YFTQx7BQy0XGFS7EsomKv1xK7acJzDQdFMN8LpgPdqZzIoESitvIgWnIFnK17SKjiB6jQlFKUMUVbxTQcHm7M5RWVKH2GyqGEN0oqOLKC9qHRZlVDKo2sFk6pQTzmE8TVKioNPEoCymYXxekCqK7NtaFBqZKlOWh3rmo1MSF9SVacMdRNRvNvQtdkAsc8O1ThVAOV3zgtSwlkCjgGIzG3HHV5MJFL74d1gvY5U54jyDM90WocLAYZUCdQtGe6lNd6S5kHQRuTzoHKeJQm36aD+KxGCyk+mmgWEhgHZHAuS4gCC8UUzD+FyoG5G4KbxYAeiEj4aapAip7KAUlYNJAGy2KBSlcwrKU4CLsR+pnGoIec2/AD9Ij0xQOn0ySDFmRqIZMEJfgn0IVBkIJSoOcaiD8RWDsZZDApEzVIQlFv90qzK+yi3PL9Eua2CGVdUb9ugKTv2JwkH5kxhUdcpN1SQZeANgqU3W4JQ+HXCXcIYYTZAyjuuSTudOJ3jKcdQ1ckWW/zB2Sy0HRNk2TdGlLTkI0AE7DBtRBlrCeOP5TZqiqT1J1CQpkJm7amkxizK1xnC9kKhkGuhWQnSrjGtfVoKLImuaRLMgHMucmerOTNa/B4B8FEZEajDs5A2poCLWlOlBlT7O4Bg/ge8sC8ZdTKcx1VLjmLmYiOSS4o0AdgE6SpGqy6pQgwODtRUWcEvOhArps6owZGpBKUVRZdxqXXjFOndQFzwdw2EBCy07o8/CPYs0R64qhtrgTX05yuCk6s6+F6iz/A9UYejTTuOyg6DCdOamhCrpSpjhlBegKXA4XEQg6qiFZES8avrXKNdVQ0eTbiU0DXs2pA1FkeAXuZdzUMJ7r8Fm5Qk3JgCxleC1DUlWV6rKmahxdmkKO0BwMzk28LYPoSw3NzTgOZibO3Ar8h0qs2CzhV5cUtwF1kCWgh+VgVKlnNAQtjssW5x6gsaTJmkQdYZfshLeWnJopmdRwWCoMn0By+BY+bkiSLiuMG4LAzKP5sP1CPQyY1/FTAr09shvHYuaAl4agFDZ1U9bRAgQ9A8A7weDM3NBGKHrs5pockpgGhDQRDQT3rh26jE0DvgG8swQdAkigUHg9eBC/OxzKrsB5+M7IBWE/AFIzgysQBdQ1FYZpsD1hPnJE8+qm7mSSRxX84K0gx3WSdWQUZJEpspccKh3oyzPZqHfDc8vjdR4dpgBE1zQcssOQZ93QbalONR0NthyG4tilAkUo1WS6y2O6uE6IPikudNtsUCejuy6cvuTCvbv2XrBz+7bJc8c3bxwJFIJFYMMKlhe1toMVkQsEe+DI04GFsCLcJjfSmhQ4vq0WbuUQuVkNoNZKMCBXMc38NoRGXPHPo5xVWWU+PTw4PTg8Ot0aFxfRtul4ShGXW7dNj4qLsemtW+d2ZLszme7st+EHV7fbIRqOYChzMD6WGxzMjcUPjTm/Vr3+mjMVcR6av1O6rPOO+CgGRuN3dF5W+mE0k+nJZNhLEXGeS9lhcejJEPb6ydcP8nq+FXiJFcRTcvmovUmwPCt0QIOI0eFmOMji8FtEq2ThkRahbwSCHrrYQgsLyhVr156B0uHBfSCIOS1olBZlYdN356H9j10W9U1OR7F1saC6zmOGTcvDpq981uc0vux8OCKBrGVeHK2n78gN7n/Qst7xhdb9/VarM6h7VEvucGoeZhKYxcnrk3yA7xNod22kCLzQxWSG3Fy6abI1HYEekQW+Vl/ncYAUpvIhB7Q+GH/1WRcMnNhuZ6E1eQw34pUjqB1Rma7u8jpNLjaoxQUl2xABAzep37KjfaXl37f3kpnpmQundlz8lou3bd08NrShf3VnfmWxvRhvDof8DVZDwIc4XKh1Z1J0MgcNBSY8JYA8hdBIFM600d+UhWuwKvq6KNoAsG3UD7MtPocmljiX28hD6PQPEqMzjSAV6HiQFa02pm+t6KE737GD9rSNdrQNdKEjyUxcqqe/qMT3rdjcmh+042MsUt/et/OmKdrd6jo8ctWj7vnQlSOHH507EYAUbREpSf8jEI1mY7E/8kzk1u5gU2tyE57ERRsyVnrdzzA+G2XXeSY61u7cuTY37vVdurHFWj7+3WhrFP7m3umeyIuHOsZ9Q1P0vivd452Ysh2Cu+gDTLPTnforO6fKOs4D7FWQpVvIMhgDdpcu9sJYToeaqUwHUb0MBtLZef4RBjt9BhW7DxrU3vWcgu8HUzXbtRQClZJ1a3u6bcEy1gTEdeoKaaFJ1CL0L6idrRaIM01A/RziMuAO1mqaSOMSrdwcaG7JB2xcm0ZEjxUKBSnbxCIXaGzy0y/7m+ocCHJ8j0fP6Z5crjFQPkinyg/SL+dEDMy1CrK9Tf4cjzUGTn3f39TkP4mx0xs3Ur834My5LO89Ochu+rncRq/lyjkD3pMiT5iMVMcRf9O8ffQE+1Pg0ptIF3mvzaXnDCqUB3dr0AtVZRpZYnSuJfSVYSq9CNq+qsqTcJLVrUSVVWCw7YeIhP0AuvXBN/HQ9lJzc0yHhCvblmeBnl3NnXqTHg1abqe9gOu0qVoBD4KWLPSXgGj55iryUIJWPTKKBcGgbauSmF7W2zvR2zub2bBso0vS6vgqSbXq21dtm3sZSJVqYrfDocnP/hRTTfROL9uQ4bI3Vzcd8UYC9aan/O0m/z1I1OlpPN4jyEVkkC/38wk+QWyPUd1kjNxUOuIRa4SW088dwPc4zFliAgOkzBjAPqgwE864XTp6IVVtQcMneblw4SEuGAgbqJc32rOqqSkUNF2UDA+tX1das2qsZ1NTd1N3V759ZevyTDoZb6gPRkNRn9cVMAM2ZnnA3hvEZmdrq8pVajVXL2SuIOyETZl89ZwrpHnzwoP5+QwS9HuG2x0wzfIPbRLSH9vnubfdIPkcI3BrGn4bHT7pCL060AjX98CvMcAnTMepEQQF459zmDmbrvbfyfJtuucHeOsH9tGj06sbA3NfwgBiYuOZrQk0VvXPD/HvA409tv95QwdWmmzwVKYOy49TRxdN9bOQ2gSMvcnSNG0F+xELSKHfqIseunfowRVXPFQXO3TPOeWOlZFUBP4C9Bvr7zsUrXvwqhUPDd53MBYudxy3IizcGlTiAuv0c/wVrpA0aSfbyE3kXSAhP1H67Aa3CYOETLaed+6W0ZFzvB5ZcnB5326Y9qcmYb4PWJSYjF+694KWsKyxt8/CR6qD1n/jkeuvvfKtiXoNuBkYo9h+tIsdWFvCPWDcfXPoG2645uorDsl0PVrBHkA/F0TmswRaDEgPs2glqqCEi3PLDCpOVraStMpO8VZcmBl533tvv/XA5W/ZMTSYz2EfaorWGzBdrEYgrbRACs3jFnwIMUoDiByjog4TYmep6WIqXQSqMSBaCyStpIeklfRqopo+3VVJz4v5+XSB35KuqAiBDCVL/8LllObuWz9S36hdZDTWj6zv86hTU6pHRBkXaSLKrb2tczTHCsPdtKQNas6WQocVMIdZ0LtqRYfB1mvrNTPdvTIYMActb++KDk1qUToUrb4l6fIY7R7nsqaEIq1UOiQjkklAVIfLxCi2QQpnIkq9T/FGfFKykJViEbU++auLtGjdyIbVdkVWbxipi4q6DQ9CRaawuoPD9Y29LQWWG2uXur9arYc0IOoBdQvN12NAqVa3vCXncS5vbtFYu9yhGA3LoCLOvNuO6lDyULdlUN26QFQKtoWVMH20IaulOltZXOhawJf+Gfs08ZMIWnCSPBksrVsOs02jBYKIMJbENeBZFRlric6ApMkFZDEuspL5NdZUqm1FKpvKhi3450Nk/K5ONDG21EQBJiEJdQkSKX9nIcoEe9CP8A7AL3QVQ4FqLPx/gGZY023LXy4/+/Ly25pOpnJJlmnLfjHZCef2jLujY7QS9YVv0BQr/+O3dk5OTN33j+zlB6YmJqmnLsXihbiUPbdepJdi5Rs6fv3rDjpdvbEYTwh3U3tKRVvjGZHHJH4Qfe6AVDC1FG6HELfpcsIjDrFdrct1ywP+vJpP5/3NPMH9eZ54/qR2SDv5fHnKuMtw3uE4fA9/5Sc/ORWmTeUf0Kvo5MJe/yOC3o2leuMMfrV8wRSvOM8FFnUeTgNXWsQO3VPHBPTosadwl+nOuQ/j3tdTtquNpwxrft/0ZlFGG9rkpkEQluaLEZ4Gxd6h8NRD9qwMQZFix/AMRfotYSqFX4y3SUV0LIsYGUsr8mJ7WtbNIHUGPR5JA3ZYsty6nG4/vYLlL2VH3NzyOD1OZzQW03yaxx2k3D0i9JC/xY+zn4t6bySXkZHSkKh7kcpkkqoyH9pH2QZi+8ijyukvg9sXwGodIKq6Z2J8aDAj3k24kX/T7xaajy1W3PgIjMEKtEXlZlrscSDWZTolmC3M9HeizNFdm1QV3jwQcyxra1vmiAUst6aOTd1152GIh8fr6gLrx9jIYKBO8vFg0FTVw3f+DuTMnncsxoNm0OHRozv27YjqHgeEePNdW296KQc3LJfTNPP3fvzevNvFFe6yID+eP2G30dc/zr3cL3xqgJyxYjl6bEYdCvRSzqW5BpfP52L/5KKbytMqCCAF06nBlVXrXwLtZ6KlhrBHQ7uQxf7fu7ryYodwCYzCUlgFvn3enwxtdAfLjkVB9s+nXkXzHe7DY811pZ/N1yNcCgjnN7UAmfmqks7S8k79UhTAvUsKmLcJe6XGVhvaZzuwnhkKb+Op+tiR0J4E+fxdb4ykk+pKpVJJYYZQ62oH6pJeEi7O41Kgo3L7ftXPm20MBTTYZdf9w27rO0FzriBC7AW3dRfc+6h9b7sZfNFyz9l+btjNZrDGIU/wuZrr54fx3YXTrb+Zd8AVJGekw4bSANLBQxfcDP0eSSCAj2pIIBz71JCgeFYSoKaVrSV1V20LAQKU77Nd++z5LxDg9/r+qbO/f/EN3r/429+fYhPAV8AWQLEFiPffbt8RLo7c7OZFHpn+q+//3+0Hb4IIZ+sHxd/eD+ibDv3u/UB7/fXX/5P/9AzYDYdLV1x7zVvPGV6raPqlF+1a1hxTJHn7ti3jdWGvR2N8VXcHGokijdxUN6km69ouF5WduPaMIKXcEHoMU6rtnUtF71xbxULOSAWzYRrdeWwCtiuUCsE/S/gbX4Iclq4JhyphtRIWmkBLfEXSwIJWUNW5eHrJmKPW0Dpd8y3w+aO1IDdnOfJthjbnExpv7FXVeerhs9+jvyV0uPoQRHyzpoivixh03WuUR2vSsCM2yAJelzed+YFvLCRBO5zX76R/DjxiEJENccW+wkDZ8xhOIslE0nZIGqxoKqGikk3ZgDefo5+Q1K8obvlZzXAcEfgOR+CsvyjLL+oB9oQwWByu1UkqooRfaqBVfVJCJxb6SGOi6t0z0Sxs6YWWBeog2Yawc8NBbSFrevdlqnHEaWhPy27lGU13HjGq5TzNuuGdoBznQjmiL27FFCOp0Dx0NCo82aMNLn6gRy3+tPyiFpwbxrqzJ7BAukur5K9WSvyKIt7p9fLr+4F+bTb90Msc+m4jFWUrYV5oJRPNgg1QxEwsHGOgoldVz+sTcpVuTk39CrzIsypb46gtHWpDanmOMMjSHaW2TFMdZ5LPybmtKCfcagtNJcoX+OweK1RfFGxvRSGuAmVn2/2LGsy7Ll/QoBP94iPyk+OG5T6J40PEMf6UbColmX7GiunjqB9XkuWntoj7QQrj35NbgA2E4eQk6qxBAtSf+958oAQPV1JU+BZbNllPJkqbiaEbBxxUV/UDLqpq6gEcA9CN42xll2OGcH65k2qUahNw0uhWGS7pyNoSyP2rOvNtrf6Q34u6dZaJsG5VTbYEar5aNRp2XYklum3C3V8F5FFoCwbyi7XdXrS12FDjDcbHFxdU315cpOv24mI9uDdIV5uz3Y4Q3yos8IWAjzP5Yj6uOy1aa1Cl3oofFGhC0BFhdOJu3Vv+RRB4aeOoUf6Fzx9mL4TYI0GILF8cMjiUijuufm/rYn5xA3rp6e/KxyXGO5tjDT6vh1Ed0TgkYcwqL1jKpXqKDT2rhIagGioWql4rBJiEihu3VfBDaFDpKkSyGCAQIzmEW8oVNWRR+TT72rPPjntbLc/JkG54t2BAN0LYylq94xBygAyAypUhQ8fwFq+hh7CNCVRkloQU8JYnzWAogA9v8QZCkDjs94lnuX76LZ2jUiSuRX2b/5T9s9B9RfuBHjJCLiztXN/Xyw1HZyvT9AY/k0D8AonAUBzGFM7sHGd2nWgM5q6FmV3G0URGtRNpamH0Gh4srekutPihWL/l9yHCYBH9ZUNnC3bNu8euTDdVfofW3kjMD0UVv5M14RP9O/rn/7gPBsMdYox4GOaXX5wpltYGSq0l1rezj5X+bYXIovzz2nmDVCPn4XpocGHKELTbDzzAJuAAVpNN5AIyS46wUKm4Y/t53HJffTkzrQPUZbZD7927MssN31CEcXlNo8kdkgKzigxNWR+6kBohPwxRg7bB/SXEbbkPBKjhgwawG5gnh3Bli+rdu4lluqzJoIeZfurSTNcUKt34NHUX8RGv7vPiN1FkXblQ+LFFhW/iYLJj6jTXtxsfbYGips9WlAN9U/3+yspCWbsXyvIZ3tn/qcJKe85UjmP2910Q2qW1jo3FYtdfe8WhmUsvuWjsgrELdr5lYsv45o3nrBuIrY7BGJxsCHp9YX8iHkLzBmi38XQR8aa7OlWhYlLsiivpQKIrH1Cj1I+eOzr7ebETlVHSwtYM5iCm5rvkms4h0ATwGdzFTShqupgPyG/QR77T39qXbIrEPOFeUzLDhqEn9d6nuiJx+oIUiWeC3Oeqs1a6CrFMd6otBeL6psXd6C/6KJVDmdFePnbWnlRYkaMtHXUeT0JqUnxNLtRDiZ7XsVbJ0oHtltHYFg2HXaaHxpojsbZMpK0+6o4/VulsmuGk/9rdvW5FSDWs7NAPXjpzf0Ocke+wPhirTNJIEqVYxfrmdD34QGdqkbv4VEWoFGSqMfVZ7BRjseHPv7sNdJEhJufnTGF7g8HKfAH1oKEz+t9IWbZV0aKSlxRVm3cVg6FXvNfp9kl0aaUXV5M+v6huqpjLXhF4F16he9lF+sk4mS5dtIIypaAzriYRRowPwRdSVEXoqHFF5TM65TCwE1z/R/FkBleAmEPZBUwFfAiBoWBsIwY1RjeNbhhY3bequzPfvhK30uxhPby8KNyfsYK/io8BE6PwKoN60giXUUjNQ2fQ+TTzFzgRNgtXZMJbzYlsTyvL9Kdm4Se1Fdp/vop76iO8u7mgOVq3jbj0ero125dhrd1t5XsraX5dOf/5ZsM69W+WsXn8li8894Vbxr8RzYqkNFi5+NfvmPWK0/Md3tq8fDTctry51FJN8vbKxebK+R/fc4PXe/2xPU/cOjZ26xPz/ALKwOchGitxOpzAoTkMxwG3rspcruC0aWjReLlJDcaMSTgZDKQ4ZrCRyYnNm0ZHgIS9Pd3Qj5u9LfjLoxTXEljwfRWCW8iphWqQlM8ShyJa1UMzMhUh2z9Fc8XKib8SCz6G8KFd5R91CezRx8RxaTAbpY2LImhjYyuFmPsex6fhQGdmoqGzBCDpTCxQCUfpTDY6E62st/v4uQK7HPjztniQADPlklBLf0ihyJYzauOL2bYhZE/B3xVoaCqiF2oUDtSKgJD2tlFhEYdMk731uuRank+ZsO2+UPKluzNNAoSdNmWCEeCY0JBOnKxokH7SvnVENfaNHHVbvK18f7zbUd4k8Fged3TH6W5EmnG9IpyJLb08dbON22Jo9Isj+6EzW5X3nTgjpuOfk78i3yD/m/ySvA7sZxNdQVcz99ox2gZtqoUso3U0TL3UQ3WU+clPyQ/Ik+QJ8mniBEkqRP4v+U/yf8i/ku+Sb5Fvkj8jx8m15BryVrhrQmnPk+fIl8gHyHvIpeQisop0kw6CPIpKbiO3krcLXdtlwOHVgaTkhTuohXsOWQvzHTpQQBOJFTQFsUmSpgWIy8CVRip+vC4haZJMpndDDi2hZS1TieZGHorHIjzoDgV3NTUEuDtab3FTdZtTdX4XV8MggSGXOOV1yJx7DImLNQ0dBRQogEylaDKTSU7AKZnZTjLJzKYG4EfSWHxy9n+ymO1A7z7aQztpjmZphrbQJE3QOG2mMdpIG2iAAmdAHdAiOZkjvyG/Iq+RX5Cfk38iPyL/QL5HvkO+Tf4X+Sp5hjwt9Js/Sx4nj5BPkI+Qh8ifkPvJ+8jd5N3kXeSPyC3kCLmeXEWuBL5whuwm08AhvgXGjEngFTfC90zBb+G/Bby3TBrngdWrCzFdSxZ2Qksg4WsXeqoLO2oNEHv6LOmrjtvP9Hz6LM/Xpq8NVxeOlj7/29JXw/IZ0tferx3qMMzz3mbvvBEnrUJUV7CjTtRYZ9ZcHq1G2JfVaPqIoc2jUd8lrg3VvvzDJMeR40xJ7qyNPjF35EUbBhrd19cs7R9eME913mZDDNdga2tL4o3y986SvibNHy9QD5O/QZI/rr5HbeIzJ3j/mSIXDqf+k+849fARDHKyaJ22gi/HboY5JE3yZG/JEaGS7JcQx6cyPMVrsSkJ4ZfU4mFtR4YKRpfmRYnsxajFabaX9EBDYyLfIsR67EcBAasn+C9cJ2mjxa7qnNNPxXpRMO0VunLQ/qKU3fzQdUfFxFC+X5yOXvswTjT07q/dw+B8dN89e+i+u/fT54du+JxrxJ6JRlyfu2FIpB7aeze761Jx/Xz5RyP72GXDtHFkP9tT8S8Josy5wJWtg9Hj7pK1ocnvAvFEseAtOnMJHPkq5FhJVEU9gFjvVRfujNFLCKolyxxXj2RuozPz7cg8A23aTn8CJ+SzPbC95B8ZXtNfLHSsbF2WSoYCPo+GylNqyp6HG6klwNRB4FFR4ElXqSYoCjwwSivos61L+MJFNrlYWWxK4zJqKBd8f3cYMfcPv7BvpCnaVejbe7cg5EPX3ukOMp+3fD+6B/AcHVx9p+yR2hSFfVo2lTbl5fJH9p+zaiddt6qnv0LUKF35wtDIPuooRI7tq8TVUF9N3akobZAJ+7Q4byg/jESnAxXsfduu3g+89BD545IzIDOVNboQannINhRpdegQxbm626AaEEnV2C6cPNBV6oVLsfcbSivs5Ezls28i/faSb3D92v7ennxLAbdJql7JvM3FJaDJLV1nBk3+rebv3HfqVRhbktjv4EA/udAlz27bzvpmjmOixYezmq9X/HX4eAn4iU3ku3YbdfdAE2sJMpk1Uy7zivESRkuLok9LWDXuSVebJ66C4loMCC27VBvvTaULGJOVjDNnSU4kRqVd9gMCZ7ThTee8fXvJYUVT6WKrDQs47xC6peqYuQ2XVqNUrdlrBqE9bvKKoekaCvL+vA52XhiToConjPM2k/qaKqmMnVS0o/0TMCKKHfDBoq+5PxOH0TSoqy5D1eRYsidmdo50qh/TlJOM4TP/jFJhMBh7XJcl2sUMZZXr4lJ5rdgS/aveKW9/fTxjSX5JrXebejaZ0UN1+Ln8XsUA2UySq3u9+/mHoP0bJA5S5BjtKLlD0Ew7W5mipSjVccDxA3FHvFToYIA4qai7gTqGwowZPzV03bgEcnI5iWvK8nlMyemmDs3pwGUXRdWUKQKsmj5JdJ1uBwFTh3F646MW5LjxrDkqhj7zO2ZZGq3NTayf/zeyg8+eWbMmkVgztmZs0+jGkXOGhwY3rF83sLaU6E/0r+71eussK5GMegK46J7HZekEeu6ed8m5eKsIGKDmLj98+a4ELrQnQMDjIDIHhBEtuj7OpxNqHs/+vJ994OKMAu0QRuLyy8pjMOQ9rmmuGbGGAn/0b8tPfV2VFU0x3rGOrv66pCma7HjXVcez9bfWZz+cvuktN7HLr6vXmcMwlLlBRX1Mlh/XA5yIDSlijLwjR9MOGSSz0k258kuSga1+gP6qr298vK+PvrV89PR2kSOb6LqSc7A/xE1eoC4vqzSKLcRt+kz3bov6vF7fJcThYi6HID5xMTLjgU9iurk5BdKIy+F1XYirFyCuTPmdhobLo8qEfaXQrbrMqEJHKm1joiZj0+ed+X3kXDrXztQ3+3vMFVtKPp9I5DflN42eY7eRrs5ELpHraBegPF7vQktpWWgp8llbyuLWwKstJ66k59sONp181xs0FCbVNAmH3WjQjMZuNk5Fuz9vNxNdfdtpreQ9vb3j47299FD5TnbzzXmaNmQZi8I28103XK6zcZzsvawQcG1FmDvPx12FLec4ucHWrmKa3rEM+mJzHQOuDPWDFKiAPOsAYhs6M8TmgqprYrOB2moERJ5EQ0sYfCEwik4LNqwLoc8CIKGFs2LLWcl2+vLoaculNRIKXyKB0PvPQMBNhlZuR4LQb0IEBO4Xgd0icBKvT4rLo3gJh7bTyLh5wTNAcOEysLDgWRNdQ0/3YnpGuCEt0FOnQvkC/QdShVOgpwT0lBbTU2zeLKxni03ZBXoCNUOpBNJTXkKHs9G3ZUk6/5LlZ/8SerOPLpCl/NoZRrGrF1FwEWUXaF43T5w1p5H2G29IT3sM66+MYSVgufaWpjePnTM8GFIcUhfV0B2QtgK4M2nISSWHdMB0MQfQEjfAdKCdTnYJPJgKuB3MupNEVQXIrMpG165dO7F2Yss49vk1q1vSGaBqMBF3YyvtTKWRTUBXQmcjqGVy3DBEWDLhnzJhovKi2BLAPm+v/QtTjmLey37ZHm+MZ1KRTPkTZyDmg2asdSCVqDOBXdACgZXdOnW0hXtH6fjqDTu95ZMXUMZlI7FiZv1VyR6a7W+Ntp9Gz6bEQH9rRJekNRJTB9pdnvErJvbT7lLpFJodqUasfW/5vUto2gk0vap0CPgFaZA6gdVxOPup4ehoX57NyFyThyBzDtLeLDRW1eDqjAvaKmKyYtt0OqhzF244ag5jl4kMM1Mn8DxP4URiy+aN56wf6OtJdCY6G8RAWqEwxR0UoHAxV/htc+5iKvqB5mlIWUNyhO1Ezc7gG1D4WC0RZyvkDp+B2uzTiT6kMI3O3X0aje8olX6jSEjN5vZ95feyn8SB5lGq60BzDWhu0vHu3nG6355/7xT+GjRhPbaBnF+abIQJhw7BhIWW5EzAH6NMMQM8CwwENdYhOlXVy4mTc+ckcTrR0MjJR9cPrOlbVexoX9Hq97f4gwmf32fabdU27io2o6IrmnAIJjeK8kUVkn4eHMf2hGwvXSOwq3COhQuwTuBNWfdgt48Vc9SUyufKJvtaYbjAcqO5txhaoX9H/9wzcKBdmjGS9/S4dhTpI4Wdzh5P5/C/A1s60tn54nMSdGNefqcd3HFCM4ZW9PevGLKPhnaic4T+rGuQDnf+bLi6DyKrwqcFWs/UkR6g03no1bzHJ3ECPC9w4WQ5ZU4+ZMgeLlFFV+hu3P7TyYw9tc8Q1amozhniZIqTzbgcEmeaxi6BMVihbhhENdPUJommmduJqZmbXK7JLTjPC9OL3u5CW2sm1diAYGeugCtQl/Z4UbcbDehDcjqFLneLwuodp/K8PyGnEkBgxdY0Fh4qREvsFM4J86hIkIirPF/MB0P5qh+iqrcDaWyT1uhUT/0ypiTfxz71/h2GOZDZePF7rJ09O+mh1Ir12+hEg0Xjgfa0y5XtH95GxxrqaaQuHdVPDiedt19kHeba1uFs9De3oRQnXd3YSrPW5kTTuoeatNbOX+XSA97yj+ie8gfoXt090NW9zBk0vD6/ssU/sKo3ZfrqfNSUz28qP1FwZlndXEE4MWUv4Al5Rsf897CxmHtgdJglt5A/IZ8gnyPP0iMlzx0DjOk7YES9Z5SphFek62kSUSIHQh6mcOWARQ2uc0Of9aNlLIO/GR+u9FKNzIaDXqeE8HeqYzZAHW7icM8QdwP8zZCGhsvrKa8TenW4n6URez9LMBP2HrWNxlpbFpRhyDrHUmZrSgl4nQ5FhSagumffdP5/mNcAfrPzmS//5VOfffzRT338ow8e/5P77j5257tvv/Xmt1979RUHL907tfP88yY2jwyvX1fqT3d2JlsSyWS8UagG2XrtBTH5ADMkdFMq7dDWfw/CWABMktteXUAfb2KVIVQU0SoMCgFLwJkrwpS4WEmdFmsS6MfBjrddyL2pjNRKTsKaGZOH8rliCwzLdu2CdEkXoB+OBLw+GgmAjPz5cJ0PBjrDaZpPR/0eK2J5rDk5m9hh0BZJyjqoQRXgcrX2wiMhCGvMPdadanbHDaamHL+R+HJF6q3jepZLwTBdoULwTvrtbGK7Ax9fobKlj5ub4XFPHERFeP56dZmC6ZIOemotDyNIg+IIWlJmUe/aZkV8nkDEty7soX0Kc15YCW9ujlLjx1xxrJYliRVufA/IFr5g37LmFDUdqqx/EMEIzj9Xl+T+UbpGUuWv02jlEXXtGR6RJa7/Eljon8IQ5/iA3wmFmdS5tIMKX7DS1expMaO0kLd9FuUeCp0wCR1jRcUPurCuUNQDOkwmhCiXCAy3gwvmQOejOdDGhlLrmdIrB86cfHvJG4lEWiItIO0mvV5/zBB+AXDlHwWaRGUbLyRXZx50FyZ8BQaO8qfhYx899dGjtsIuXTt5eJKNXzfO/uzGbeWrMQZ1nY4eZQ+7g9TynLCdWE0mt98InMGLuMyGuorSXwPPAoKI2CvfRt6K1vu5JJOViM6cRsjNYBAYungY6DFor5MaslM2nLNARyI7yYxGFbfOZEORd0FndFEHIw50gserq6bbcNV0VFFm9k9dsGV8/bpiQelSOn2+lJVKBXxe3PmlvBn+/NC8vc05oU22wDJ7xdxbCfTjnkg1CRrlC68aFNgXdG6L/clWYERrdnlxbCgq8adP0EdOXXiCfvI1LR5Cn3WoWit46nODcb38qrj0OQuDBScV8eXbKh4p2MHOscnhydFuZuWberq5kXU0NUZ6m7JznUtvGLynMJBi8AnobfB7LZhU51Yaqr3MqBrsW1C2WHBsymSaxIUORUixaLxct6yU8kjh6HCLkr64d3o/8/uL+c7ZVRPS6TekPfsOTVRtutAf8AqyCfXxs3HGpXq0YfQ7hKoDkRRN5pxIfEplwvHHBJ6reHCErF/XmYenW1PBVCqoC71QNFkP5Rd/il5qm7YnFoQZcZv283SzFWWhKDBZJg81dyKgDitw3zXbth+mwt/Oqa/iseua7TsqEVwcy8eXj5cydO6Z1MBYqwOhmbMT/VnGeqth7jj2/d7e7x9bIN/ScPkqz+D0OzeO3HrxsFuyLIt7q0EPhyCKK/N+VKv4sBmynLRBa7+l9PZIQ31A4kacOtGhuMd0ObjBPcZUQPdxrtm66Jbq5egOQqZkyk9lIjlRxc/pdgsm0r2NuJ3uUY/H6bS9tq3u6cq1rVieTSWjjXUhj9/j93mdkMR0aQ5tsQe3IEKjQUcvws8+N3e1wA8dAqkJNa0KuNeKhxzggGT4W+pcpemOO+5g+S9+ER3Yw+8rGvf93VWH/84rK1ST2GckpZzc+yN62fU/og+0x+dGE+3tCfaZeDvdOjx859BQ+UfDw0ftqxgk1ujRXbuOKvLcKFwq7CAMF47qM3D8f2Fm7oQAAHicY2BkYGAA4ulTT4bH89t8ZeBmfgEUYbhmzKMPpQ3+P/ivyMrOPBvI5WBgAokCAEQiCyB4nGNgZGBgDvqfxcDAyvr/wf93rOwMQBFkwMgPAIv7BbMAAAB4nGVTO04DMRD1epMiUpq9ATeAmlRwBLqVKBASB0hBDhDRcAMkmj0ABTWioE4FCKVCiNIFAqGsEOGT4Y1n7LVD8TSzs/N583HpjCkd/ZYsN4AaemWMnUGH7E1Ewk5ed2pj/1pgR2qrNY/a4v+Z+jeSp99P4iuREt/lDt8eLpEVkfcbJ3nd/xwxvsnje5saFzhGXvxPe/S+tJJYyAqoEz7cZ+BzhjxzyBPIVcIn4JAWxR21wKI8oLYchn/0xTGZ7xNwLBz9DqbCLcgIiafwzf2EnrkHmVMCz7eD7Eb04sgYhtfvwXUArgPIW2rtZz7fjit9cH3Ps1a+TvN6XsptfRYu6UHvzMzD3WAeoU5Dy95Ed9FoPvjEvWInem/f5UNyQ7w/wE6JigvkfsRsxsmcrui53IG8Bs7RL2rbF3q3lzlHO0J8mEsjee227JrrcG7vC2m3IE/pjb+LVu37wA39+L7Yd4jeduH7Cn2PAfs8r8k5456rtdvPwL3pO/NxepvyNpZpDPfBO2EZ46twW7BVoR7yZbfV1ec583tliN69hT/7Mhv9AAAAAAAAAKYCMgKQAtIDtgTkBWgGZgcYB2QIZAjSCmoKpArsCzgLeAwADSwNcg6EDr4PDg9oD+wRChGwEgISdhLgEygTchRMFOQVshZOFuoXgBfmHDQcch0gHVYeHB6aIH4hBiGwInAiriNeJkwmqCdSKAgosCloKeAqbirUK2AryiwYLHos6i1cLjwu+C+gMGwwrDGKMdoyijTWNSI1RDX6Now3KDeYN+Q4kDjQOUQ5qjoqOk46cjqWOrg69jt0PBw8fDzSPUQ9lj4QPp4/ED+GP85AIECGQO5BzkLMQwBDkEPURC5EckUeRb5Ggka6RwRHTEd2R8hILkiWSNRJYEnmSl5KwksMS3ZLlku2S9ZL8kw6TFRMbk0wTZBOME8mT7xRYFIcUoxUUlR6VdJWWlb4V2JXyFgsWJRY6FlKWdZaHlp2WtJbOFxIXMZdVl4wXpZe5F82YERgnGD+YTZhemHYYlBiuGMCY5pj/mR2ZOhlVGV4ZZpl2GYWZnhm5mc+Z25nrmf2aKxqwGtaa+psEGw4bFptSm3EbfpuRG6obu5vNm+Kb9RwdHDScRJxcHGichZ2GnbedzR4GniueUZ5+Hoye3Z78HwufGB8vH2AfZ594n4MfpB/EH+QgBSBAoE4gWyBooHYgj6CxoL6g3iEFoXOhhKGOoZghxKHqIggisqLTIwGjKqNho6Sj6SQTJD0kZ6SUpLkk6yVfJX4ltqXapgRAAEAAAEPAfgAJwAAAAAAAgC6AMoAcwAAAfoLcAAAAAB4nIWRzUrDQBSFT/qj2IKIguu7khYh/QERXAlF3QhCF10pJU3SJCXNlMlU7cK1T+FL6DP4BO59Fk/SQaQgzZDJd8+9d2bOBMAhvuFg/ZzxXbODA0ZrrmAXV5ar1G8t18j3lutoIrW8Q/3JcgOneLXcxBHeuYJT22M0w6dlB+J0LFew79xZrlJ/sFwjv1iu49h5s7xD/cNyAyPny3ITJ5X2QC1WOoliI61BW/rd3rlMVqIoJZmXirc0sdK5XMpUZSZMU+X6am7089gLApXl48TnPAyjZerpTXkzHoU6T1QmPbe7mboJs1B7JgyK3fPHqG/MVKZazeXa7isLrWahb9zYmMVFp/P3PBhAYYEVNBJEiGEgaFFt89tHFz2ckyasEFauqxJk8PhDhPOSHXGZyRlf8p0yyqiGrEjJLnzOcyoazxizJ+AoanJGSZkteMiOiOulrNBbq7flR1ytOFNSxkIfLt1s67phV1Z2eqWD4Nd7jkeerk/V0GHhUpeuBNcbfoX3WeRmVHzqbnmrhuoFOhz/3M8Psneg8gB4nG1WdZzjvBXccYzJ7t5dmZlbt73dXpmZmVm2FVsX2dJJ8mZzZWZmZmZmZmZmZmbuk529fn80v135yVL0YOaNshFsjJ/pxv/94BACTBAiQowEKTJMMcMmtrBNa4dxBKfD6XEGnBFnwplxFpwVZ8PZcQ6cE+fCuXEenBfnw/lxAVwQF8KFcRFcFBfDxXEJ5LgkLoVL4yh2sIvL4Bgui8vh8rgCrogr4cq4Cq6Kq+HquAauiWvh2rgOrovr4fq4AW6IG+HGuAluipvh5rgFbolb4da4DW6L2+H2uAPuiDvhzrgL7oq74e5gKFCiAsccNRoIHMcCEi06KGicgIGFQ489LLGPFU7iHrgn7oV74z64L+6H++MBeCAehAfjIXgoHoaH4xF4JB6FR+MxeCweh8fjCXginoQn4yl4Kp6Gp+MZeCaehWfjOXgunofn4wV4IV6EF+MleClehpfjFXglXoVX4zV4LV6H1+MNeCPehDfjLXgr3oa34x14J96Fd+M9eC/eh/fjA/ggPoQP4yP4KD6Gj+MT+CQ+hU/jM/gsPofP4wv4Ir6EL+Mr+Cq+hq/jG/gmvoVv4zv4Lr6H7+MH+CF+hB/jJ/gpfoaf4xf4JX6FX+M3+C1+h9/jD/gj/oQ/4y/4K/6Gv+Mf+Cf+hX/jP8FGgCAIJkEYREEcJEEaZME0mAWbwVawHRwKDm9EVotudxiPRbZhhk9Y1SWsq4wSVca6mksprIuY1pInBW9YV/KsEK7oywV306JfWdrCKhuUZVqqiivNu+1SdR0vXcX3uFQ6LK3dTStmm7IveFZxKUqhejuldcE6x4wLK1HXaWVEURTkiNzrQu3Hlek1k+mclbxQahHP6ZsLk86V6duC8+lc9cae6H3ctXAx/Td9EddK1ZJHtZa9Teolk5K7WcMoYJN3fGmjxrXyWCY661htWJsItd8o6+LjSrWSpcftXFSV5LFk1s3bRHLW6b5IpegWvBJdREa/H7dsv6y6tPWrzDWxz5yKphkVTXTcxpqtKPptLXiVa6HJO5Muo1o7brh1wYkTseFVRYEb3tFf7EtpV5u2EcZZ0RW9XMysaLVcFb2QLrWLFXMUVESG5pGVlNPUSlHxAbstyqdcqD1u5lItI+s4a2fWUakk77Xqthwn9DqXL7koVOwMuaOHXzexWwpXNol/UHjhHmWQ7S0UobNwPF7ysmEuXdJgiQvRcEKyFF2lljZbKlNpSsmG+6KrwxWXOlmp3hHa0Yo1SsWlMCVBInmruqlVfVeVUvXV9ghVPi7bRKpa5VUR2yWveJcSfUynHI8aThyZDWPOW+1WE77iSanaltIJKYYulHzuIiPqxgW9jgmKUshsKAuj9COnlLRxwSyxNjKcSpoNI0EiE+LTkpkqJHBdOucEJje7oWdzzBzVtAmlKheZH3KP8oQwDBvV8tBTIu47/0h9GFKxKmyZkCFhYaZ+GANOe7vGfzA8NaeD5UTL7cybNq+N6nVAPKcW4Y6HflfUEtnsVC3WRaq2x8WD6abfdDDZGjYfzMKGgNj0w6nNopurU8t+klGCVEOhuiOnrIMNmc8opyNF5qs7WNOhxIOZ9Hp4Toy1s4GFJvf7Ntf2sHNSqnpSa5sQ8MIpE7XU+DxZF5lqXNtk3G/jkrXcsFCyVg/FzCthMkfZ6kZ1PNKGOifm+1qRXrQ9sXJPyb7l1DbMlE08rO+ka+LtpNS83Ai7SMuGlwuSk9mYV+4aQdwiYdNW2K0DIyeyuYmaz1NbCmuVsZH2R5DoKK1XoRegqVO15yvtyg7MjnhIYXQ2cp5p07WTSrmMeoYIWxARRsuTcf2SRGH90mvFrCTfYi5KRv6sqDuSjYOoR/6EtZi7hBp94ZQmYdL+MTh0casKIfmEPJKQlNSLsxM9dc0IwHS0PTAH1N45TExmA9JUK+8/pD7qo8EjoUAiIcO5MKSvNFCA/pi5UtVoJgMc+c6kZTomDhBK6cAPD9dID/+qZJJ3FTOz0vi+ykvfYRTjjh92N0kuxEme25Ya8NB64hGgGsgj63mjjDjpJUhGS6qMGe4FynjChElYVXnJSQ9yiSicfCcj13TziAGWlgC0US0V3TpeEnOSPD5Z8NV0mJVGkWTNey5JeKqapCt2SviKLkmNiVGenfnRpGZ9zfOjoaHmno6c8wyYrU1P1Wxt95qalq2IOcRy0gClp4yK1o2NMZpegrmZjZOhXlujfby3RIJV6G/cKTOGQvRnr01/wmw0hy+lo93r2bpa817KsCX5j+d0WXBz6DTvvfLM/Lk5XSqU4dZgd/4WJXRCYrvL/DA4TAar19GQeGKF41Tb0DMg9RcRXYH1pBVl7JswP7p9gPTI1E2+72hDLyxRbXM4qmNDabb/N/FuZsOUAqOlrVO2X1lvHKKjxcOnnfr1CXEpKct8T1jqpzIfL9pJQQJYMOn5m1sfVNbQ74OaLkybLDWJfGs3Nv4L3DjB/nicY/DewXAiKGIjI2Nf5AbGnRwMHAzJBRsZWJ02MTAyaIEYm7mYGDkgLD4GMIvNaRfTAaA0J5DN7rSLwQHCZmZw2ajC2BEYscGhI2Ijc4rLRjUQbxdHAwMji0NHckgESEkkEGzmYWLk0drB+L91A0vvRiYGFwAMdiP0AAA=1

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.animation.css
200
text/css

1
ok

No Cache-Control - header
GZip: 5056/81317 Bytes




local SRI possible, possible hash-values:

sha256-/a6/OOnWB0Wi4s3L+VUL9QBY1JD0wKXu75NnHHZZR1s=
sha384-7pPVegt0/5djdpyrluCRLZIQKbxh+cl1UNhdANgN8dPFbXQx52iGL0BcqI4SE1DP
sha512-iDw2xihN0q2xYyNv1K9Lpd+/zYSLPLcb/HAFJ/i5cePDkEBfJwnQHNEmwx1i/zXO228sTVsuUzOi2vKfRBFRDQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.animation.css" crossorigin="anonymous" integrity="sha256-/a6/OOnWB0Wi4s3L+VUL9QBY1JD0wKXu75NnHHZZR1s=" />




link
stylesheet
https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.css
200
text/css

1
ok

No Cache-Control - header
GZip: 38663/329315 Bytes




local SRI possible, possible hash-values:

sha256-LgDVDwoGerhwepmEYLNGzSgp8cYsrn8pdNyEVhPZ9BU=
sha384-jkLHhg6N/rPiUy8Yr7jOTghcorvnZsi9uUxKaXwd9loRGwUGyPg8bePAuM8IVFXM
sha512-t82GfpTDxnBccbcNb/XKh4EiWwYgKYJq5pkZqOxKlX8FgiunER5nyKwHqmuYviEwMTxniC75Z4BfA9xYOxAK3A==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.css" crossorigin="anonymous" integrity="sha256-LgDVDwoGerhwepmEYLNGzSgp8cYsrn8pdNyEVhPZ9BU=" />



Content loaded via url("...")

../css/trx_addons.debug.css1
images/colorpicker_morecolors.png1
images/preloader.gif1

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.responsive.css
200
text/css

1
ok

No Cache-Control - header
GZip: 5162/38358 Bytes




local SRI possible, possible hash-values:

sha256-jjFe2sdZ+fusol5EUX1v7MhA4Bm/8nixkzv9E+QHGVA=
sha384-1DNa7fr0kn2qX4+qyPe0CvgDinQGeK/NH8pWA90uQm5NRrHIhU7466Ip+pUcKgz3
sha512-3S4mDt2hlF1S4L8SpvBLYs45NQofxDwA1VORAlHIwognH67TC8KmkjP5zqqlEBjrPERqlnNwhfjwu6pb8biQCQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.responsive.css" crossorigin="anonymous" integrity="sha256-jjFe2sdZ+fusol5EUX1v7MhA4Bm/8nixkzv9E+QHGVA=" />




link
stylesheet
https://blog.coroico.mx/wp-content/plugins/trx_addons/js/magnific/magnific-popup.min.css
200
text/css

1
ok

No Cache-Control - header
GZip: 1548/5156 Bytes




local SRI possible, possible hash-values:

sha256-W/UdEuht6Yx/WUUWtrXJYT2mD2TIY6gDw+hw+ocfPn8=
sha384-HLYJkL8O9h+MqjpZw1arnyfldrWiJuFrI9/qKs77vmCdno2aPl5/2gb6g5suHb9F
sha512-C9OM+e4rOmiVOrMIxE1VHkM6md47+MpxSNiUSHDoSmX2Kv29uzt+TUP3BRYg+t/tgI7ucoZTfpZTjTnMiBYfcQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/trx_addons/js/magnific/magnific-popup.min.css" crossorigin="anonymous" integrity="sha256-W/UdEuht6Yx/WUUWtrXJYT2mD2TIY6gDw+hw+ocfPn8=" />




link
stylesheet
https://blog.coroico.mx/wp-content/plugins/trx_addons/js/swiper/swiper.min.css
200
text/css

1
ok

No Cache-Control - header
GZip: 2868/17759 Bytes




local SRI possible, possible hash-values:

sha256-R7DnEprdmCwOOU8N+o2WIebJ5BJoWbJuGtJcGN7w2BI=
sha384-vo50hXtn++/P8/rFjBxcsOVc14cJi9ibeQ96ujWvPfEmiojAoHF+bt7cOFv4wkHe
sha512-dLc41mqdowYwgVPGg7/h/HhL3zQWZJLrTnbqAVwyvfHwHF+Xpsfu5UWcE7BOjcY/f/0gV55oCP7UZ+CJar5Lqg==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/trx_addons/js/swiper/swiper.min.css" crossorigin="anonymous" integrity="sha256-R7DnEprdmCwOOU8N+o2WIebJ5BJoWbJuGtJcGN7w2BI=" />



Content loaded via url("...")

data:image/svg+xml;charset=utf-8,%3Csvg%20viewBox%3D'0%200%20120%20120'%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20xmlns%3Axlink%3D'http%3A%2F%2Fwww.w3.org%2F1999%2Fxlink'%3E%3Cdefs%3E%3Cline%20id%3D'l'%20x1%3D'60'%20x2%3D'60'%20y1%3D'7'%20y2%3D'27'%20stroke%3D'%236c6c6c'%20stroke-width%3D'11'%20stroke-linecap%3D'round'%2F%3E%3C%2Fdefs%3E%3Cg%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(30%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(60%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(90%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(120%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(150%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.37'%20transform%3D'rotate(180%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.46'%20transform%3D'rotate(210%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.56'%20transform%3D'rotate(240%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.66'%20transform%3D'rotate(270%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.75'%20transform%3D'rotate(300%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.85'%20transform%3D'rotate(330%2060%2C60)'%2F%3E%3C%2Fg%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20viewBox%3D'0%200%20120%20120'%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20xmlns%3Axlink%3D'http%3A%2F%2Fwww.w3.org%2F1999%2Fxlink'%3E%3Cdefs%3E%3Cline%20id%3D'l'%20x1%3D'60'%20x2%3D'60'%20y1%3D'7'%20y2%3D'27'%20stroke%3D'%23fff'%20stroke-width%3D'11'%20stroke-linecap%3D'round'%2F%3E%3C%2Fdefs%3E%3Cg%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(30%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(60%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(90%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(120%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(150%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.37'%20transform%3D'rotate(180%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.46'%20transform%3D'rotate(210%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.56'%20transform%3D'rotate(240%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.66'%20transform%3D'rotate(270%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.75'%20transform%3D'rotate(300%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.85'%20transform%3D'rotate(330%2060%2C60)'%2F%3E%3C%2Fg%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20viewBox%3D'0%200%2027%2044'%3E%3Cpath%20d%3D'M0%2C22L22%2C0l2.1%2C2.1L4.2%2C22l19.9%2C19.9L22%2C44L0%2C22L0%2C22L0%2C22z'%20fill%3D'%23000000'%2F%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20viewBox%3D'0%200%2027%2044'%3E%3Cpath%20d%3D'M0%2C22L22%2C0l2.1%2C2.1L4.2%2C22l19.9%2C19.9L22%2C44L0%2C22L0%2C22L0%2C22z'%20fill%3D'%23007aff'%2F%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20viewBox%3D'0%200%2027%2044'%3E%3Cpath%20d%3D'M0%2C22L22%2C0l2.1%2C2.1L4.2%2C22l19.9%2C19.9L22%2C44L0%2C22L0%2C22L0%2C22z'%20fill%3D'%23ffffff'%2F%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20viewBox%3D'0%200%2027%2044'%3E%3Cpath%20d%3D'M27%2C22L27%2C22L5%2C44l-2.1-2.1L22.8%2C22L2.9%2C2.1L5%2C0L27%2C22L27%2C22z'%20fill%3D'%23000000'%2F%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20viewBox%3D'0%200%2027%2044'%3E%3Cpath%20d%3D'M27%2C22L27%2C22L5%2C44l-2.1-2.1L22.8%2C22L2.9%2C2.1L5%2C0L27%2C22L27%2C22z'%20fill%3D'%23007aff'%2F%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20viewBox%3D'0%200%2027%2044'%3E%3Cpath%20d%3D'M27%2C22L27%2C22L5%2C44l-2.1-2.1L22.8%2C22L2.9%2C2.1L5%2C0L27%2C22L27%2C22z'%20fill%3D'%23ffffff'%2F%3E%3C%2Fsvg%3E1

link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/css/768.css
200
text/css

1
ok

No Cache-Control - header
GZip: 2854/10371 Bytes




local SRI possible, possible hash-values:

sha256-6itzGltWgd/pHZXg6wBvt16Wb1XmeZJXz5IQvJ7WnUE=
sha384-Ypk4GktQ5OspFFLRktGwoUTeVzXt8JNIzZ/20RqTXVjoL1ei8QwQ7pPc3bVk5yCW
sha512-9Vye6wLIWb38lg/VKhL+/svGKpzoUt4zPRxbZArvUyd+uqlVo47AH0z6sj6571W8gdL9ERv2juncuLhC1doYrg==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/css/768.css" crossorigin="anonymous" integrity="sha256-6itzGltWgd/pHZXg6wBvt16Wb1XmeZJXz5IQvJ7WnUE=" />




link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/css/992.css
200
text/css

1
ok

No Cache-Control - header
GZip: 1828/6472 Bytes




local SRI possible, possible hash-values:

sha256-jDc579K3AnY8YeEFpc611sMoUJGA5usO+UdvxMdm5VI=
sha384-bzfpKdxXszuU722kdVIwRnqSsmC+iGOYFMzXvCztxauwYRbrVVUQfMQMHsE69ulX
sha512-YoomDfj0kLnVslLuzdhmBdBU3lcoWNjhdmQerYEyJZOfP3yznjqnVXPRwbXCQBiNYnT6e4/UvdaXLomIg60bpw==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/css/992.css" crossorigin="anonymous" integrity="sha256-jDc579K3AnY8YeEFpc611sMoUJGA5usO+UdvxMdm5VI=" />




link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/css/bootstrap.min.css
200
text/css

1
ok

No Cache-Control - header
GZip: 3097/12546 Bytes




local SRI possible, possible hash-values:

sha256-AxAOIdIETjKLB1vL0vT4kT/1jy7Ya8g81Z1wUVHhiaQ=
sha384-Pp+upQ75UvwGiB3C6BSzCH5balA3Y3pPQQ/Z2kllyMG/ontEbOfwQDgHE8vS0TIT
sha512-3guUQobnwbolcJEiw0KzPdIufRxY8G2qHVvJUSZxWPwbo8JFf9gsbiPzZGDGxHXbGqz7+Fgydk82Nj6HIOt1lQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/css/bootstrap.min.css" crossorigin="anonymous" integrity="sha256-AxAOIdIETjKLB1vL0vT4kT/1jy7Ya8g81Z1wUVHhiaQ=" />




link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/css/fonts/fontello/css/fontello.css
200
text/css

1
ok

No Cache-Control - header
GZip: 2561/10926 Bytes




local SRI possible, possible hash-values:

sha256-FelXOFjGXGXMF4XSaOqQE/QNsJR2nQ0d/PXodfRqv48=
sha384-nzssPM88N3jPNsndtDnhGjesu8P2qo+Bxc9cMzjNtDswTGwtrcJ/CQJ3niW4R6Qu
sha512-sTHJ+XsTBKTiJ/+LEJddeiyB1GJ5pNEUb260HKXqUUVQCqxpzCD7lP/G0TnQAkUwS8444Pgxbgyc6FwlCIew6w==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/css/fonts/fontello/css/fontello.css" crossorigin="anonymous" integrity="sha256-FelXOFjGXGXMF4XSaOqQE/QNsJR2nQ0d/PXodfRqv48=" />



Content loaded via url("...")

../font/fontello.eot?269172001
../font/fontello.eot?26917200#iefix1
../font/fontello.svg?26917200#fontello1
../font/fontello.ttf?269172001
../font/fontello.woff?269172001

link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/css/main.css
200
text/css

1
ok

No Cache-Control - header
GZip: 17319/82117 Bytes




local SRI possible, possible hash-values:

sha256-KpuDRs9rxWAj61z3veaRgU3tmd11eKT1gFK9LhmDmHk=
sha384-kV+xaGcFFQ2wykN02Thlw4ShlwtNsVOzH+DV8fLYx7IYzR/3kE7pK5z9jhxflVJa
sha512-XeP9sGKda0B9ZBz8atBbLQP1jAs6zdhAzqKE6LYXOmJ6xyx8yQ/KD3nb1LkQ1BZduYQDF867Nqk0vM/muEmXUA==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/css/main.css" crossorigin="anonymous" integrity="sha256-KpuDRs9rxWAj61z3veaRgU3tmd11eKT1gFK9LhmDmHk=" />



Content loaded via url("...")

../images/bckg/loading.gif1
../js/responsive-image-gallery/images/loading-dark.gif1
../js/responsive-image-gallery/images/nav.png1
../js/responsive-image-gallery/images/nav_thumbs.png1

link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/css/wp-fix.css
200
text/css

1
ok

No Cache-Control - header
GZip: 498/1172 Bytes




local SRI possible, possible hash-values:

sha256-vO1EyHO5av4V0n8u8h+o2gj31Ny4uh32topvNGPA7wk=
sha384-AnX3LdiWtVdvx/14r+dSEcl7+nobTIfgjq5YbeDYxJnVTU9C7YNHCSJM7K/fMcfO
sha512-iKFxOOn+AvElcbr+EhL+iZpAbb1whI2/HP9NjqqDUSS+7XD5067fBHAVXasW5LGUnySLibzlkPMyqfV4wt2uYg==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/css/wp-fix.css" crossorigin="anonymous" integrity="sha256-vO1EyHO5av4V0n8u8h+o2gj31Ny4uh32topvNGPA7wk=" />




link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fluidbox/fluidbox.css
200
text/css

1
ok

No Cache-Control - header
GZip: 300/832 Bytes




local SRI possible, possible hash-values:

sha256-su9nEcyEijPjNPnL9pFRGgN5Bz19POJeBBSBT4X4abw=
sha384-p6sdc38nQTA8vi4wzPYJa86Dh6zd83ok1t4mqkd4+qTWYiAe9Pn6dzhlqkRMHhYZ
sha512-pDfmf/l8qwGx1r65EpLvlmrcVl0PyOcslE/zs7mIj+MsoyDteH4NIDVRR2VYeV6linKXPRkS8tXCev66mzyxkA==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fluidbox/fluidbox.css" crossorigin="anonymous" integrity="sha256-su9nEcyEijPjNPnL9pFRGgN5Bz19POJeBBSBT4X4abw=" />




link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.uniform/uniform.default.css
200
text/css

1
ok

No Cache-Control - header
GZip: 1803/8281 Bytes




local SRI possible, possible hash-values:

sha256-ScOT86UD71gbD3LxzIX26QTL0UJo1ryFQ0ZygEuIiRY=
sha384-dF3cF3JRhlbRkqhrag9p5dPIJliIUxVy2U22dWamaTlrLxyfuKIbsASVisqixerK
sha512-E9lCvX8yW7hh3YLqAGXSGafiLQwqPdOODpSckWD7obnVnbHkyE3GjnHgE1MkYG/PezZyHvzpyLf/npJd1VQMrQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.uniform/uniform.default.css" crossorigin="anonymous" integrity="sha256-ScOT86UD71gbD3LxzIX26QTL0UJo1ryFQ0ZygEuIiRY=" />




link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/js/owl-carousel/owl.carousel.css
200
text/css

1
ok

No Cache-Control - header
GZip: 1103/4614 Bytes




local SRI possible, possible hash-values:

sha256-3XuXx62dez63m9xyi8vGp6uOPV2wQh+w3RbTTz3Ignc=
sha384-P9Liqp3g2hdXOYCMNPr2nDgmccEaIeQRyJIUZNgjiS+OwysJEJ4onP4c40zOJKmO
sha512-AVs1DVaNKVmIbtWYK3RZLSYI1l8nVspbPNJ8lawbaM/su49vS8pPPbuwnDvZmLFYlztgxpHvzi8cFqIkrKgPKw==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/js/owl-carousel/owl.carousel.css" crossorigin="anonymous" integrity="sha256-3XuXx62dez63m9xyi8vGp6uOPV2wQh+w3RbTTz3Ignc=" />



Content loaded via url("...")

owl.video.play.png1

link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/js/responsive-image-gallery/elastislide.css
200
text/css

1
ok

No Cache-Control - header
GZip: 643/1824 Bytes




local SRI possible, possible hash-values:

sha256-yVzQG4nyNzXSXlK8iVIfXyI2Uol8vg1QmhemQ7FjKL4=
sha384-T8/BDInt15yl1S7psUWxGMYDkVyUG1XGXssIxp+V+Y1C9+8kK+M4fWFBMcoRH04A
sha512-MYThYPzkNrF82CD5CNNSQLWd6DjbSVoAzvXQViNVlGt/qY+7IVFX14cIIrqE2P8XjGfSYrOoYOFUY21sxI/gPw==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/js/responsive-image-gallery/elastislide.css" crossorigin="anonymous" integrity="sha256-yVzQG4nyNzXSXlK8iVIfXyI2Uol8vg1QmhemQ7FjKL4=" />



Content loaded via url("...")

images/loading.gif1
images/nav.png1

link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/js/selection-sharer/selection-sharer.css
200
text/css

1
ok

No Cache-Control - header
GZip: 2115/5185 Bytes




local SRI possible, possible hash-values:

sha256-NsgMCi1tubgIYYiE+5j8/cuvwV1y+Wn4cWWKQCvmePI=
sha384-rZgWTmk0q/hhoEtI5BlMi9lxtMmadaB8V1Ph/7KmLR9cqji3yUbyWU5hUD8+uKYI
sha512-CIjOzgpZmdpgccxvgKibHM0Iz0w5wNWWeemsAaLMfMK6/+UjnTo4ERs7XlLk1r5BmeySVqmofnyMYx6aLHRuZQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/js/selection-sharer/selection-sharer.css" crossorigin="anonymous" integrity="sha256-NsgMCi1tubgIYYiE+5j8/cuvwV1y+Wn4cWWKQCvmePI=" />



Content loaded via url("...")

data:image/svg+xml;utf8,<svg xmlns="http://www.w3.org/2000/svg" width="171" height="139"><g transform="translate(-282.32053,-396.30734)"><path style="fill:white" d="m 453.82593,412.80619 c -6.3097,2.79897 -13.09189,4.68982 -20.20852,5.54049 7.26413,-4.35454 12.84406,-11.24992 15.47067,-19.46675 -6.79934,4.03295 -14.3293,6.96055 -22.34461,8.53841 -6.41775,-6.83879 -15.56243,-11.111 -25.68298,-11.111 -19.43159,0 -35.18696,15.75365 -35.18696,35.18525 0,2.75781 0.31128,5.44359 0.91155,8.01875 -29.24344,-1.46723 -55.16995,-15.47582 -72.52461,-36.76396 -3.02879,5.19662 -4.76443,11.24048 -4.76443,17.6891 0,12.20777 6.21194,22.97747 15.65332,29.28716 -5.76773,-0.18265 -11.19331,-1.76565 -15.93716,-4.40083 -0.004,0.14663 -0.004,0.29412 -0.004,0.44248 0,17.04767 12.12889,31.26806 28.22555,34.50266 -2.95247,0.80436 -6.06101,1.23398 -9.26989,1.23398 -2.2673,0 -4.47114,-0.22124 -6.62011,-0.63114 4.47801,13.97857 17.47214,24.15143 32.86992,24.43441 -12.04227,9.43796 -27.21366,15.06335 -43.69965,15.06335 -2.84014,0 -5.64082,-0.16722 -8.39349,-0.49223 15.57186,9.98421 34.06703,15.8094 53.93768,15.8094 64.72024,0 100.11301,-53.61524 100.11301,-100.11387 0,-1.52554 -0.0343,-3.04251 -0.10204,-4.55261 6.87394,-4.95995 12.83891,-11.15646 17.55618,-18.21305 z" /></g></svg>1
data:image/svg+xml;utf8,<svg xmlns="http://www.w3.org/2000/svg" width="94" height="64"><g transform="translate(-10, -10)" fill="transparent"><rect x="0" y="0" width="114" height="114"></rect><path d="M12,12 L102,12 L102,72 L12,72 L12,12 Z M16,12 L53,49 C55.6666667,51 58.3333333,51 61,49 L98,12 L16,12 Z M15,72 L45,42 L15,72 Z M69,42 L99,72 L69,42 Z" stroke="white" stroke-width="5"></path></g></svg>1

link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/style.css
200
text/css

1
ok

No Cache-Control - header
GZip: 700/1651 Bytes




local SRI possible, possible hash-values:

sha256-SOcfmsNejITWF7mrGTUTSW3TIF2jG5bo7yMiy4IuLoo=
sha384-NaYR6YtRHMCo+9ACT7WLvDdMQOiZ/10NAVuYDquf5B5HsmGeAeHNhaXPmhQANlbb
sha512-2k0qLvuIlUiZ4qt0+lzN6Yoyc7TfstVSkBgBWNX6MH6rCoayy5CyJWDVtHRqz8e1853QOVMvTHu9e/HODkCjUw==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/style.css" crossorigin="anonymous" integrity="sha256-SOcfmsNejITWF7mrGTUTSW3TIF2jG5bo7yMiy4IuLoo=" />




link
stylesheet
https://blog.coroico.mx/wp-includes/css/dashicons.min.css?ver=5.2.4
200
text/css

1
ok

No Cache-Control - header
GZip: 28481/47558 Bytes




local SRI possible, possible hash-values:

sha256-GKpmwZLL70OmGxOYwpKuXGwdQNZ5Qo7pmLHGv69h11o=
sha384-7C8ocYrcXKR1loNXUOAHzjPE8vNG8p3JYegoiFGi4iky0Z7lBk0PHtW4mBKFRMHq
sha512-pcovNCBqzLXyLsC0xKfgUL1XL3Cin185XCx4kP0IQbOy0hU4rO79fmagOWCcuIh4/krk85m5TupFb8PyfOVVgA==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-includes/css/dashicons.min.css?ver=5.2.4" crossorigin="anonymous" integrity="sha256-GKpmwZLL70OmGxOYwpKuXGwdQNZ5Qo7pmLHGv69h11o=" />



Content loaded via url("...")

../fonts/dashicons.eot?50db0456fde2a241f005968eede3f9871
../fonts/dashicons.eot?50db0456fde2a241f005968eede3f987#iefix1
../fonts/dashicons.ttf?50db0456fde2a241f005968eede3f9871
data:application/x-font-woff;charset=utf-8;base64,d09GRgABAAAAAGOkAAsAAAAArpgAAQAAAAAAAAAAAAAAAAAAAAAAAAAAAABHU1VCAAABCAAAADMAAABCsP6z7U9TLzIAAAE8AAAAQAAAAFZAuk8lY21hcAAAAXwAAAfLAAARhDPzNqdnbHlmAAAJSAAATqYAAIQUYJTKLWhlYWQAAFfwAAAALwAAADYSoxtRaGhlYQAAWCAAAAAfAAAAJAQxAwhobXR4AABYQAAAACMAAAQ4GgT/9mxvY2EAAFhkAAACHgAAAh6YX3d0bWF4cAAAWoQAAAAfAAAAIAIpAKBuYW1lAABapAAAATAAAAIiwytf8nBvc3QAAFvUAAAHzgAADrBt7+iZeJxjYGRgYOBikGPQYWB0cfMJYeBgYGGAAJAMY05meiJQDMoDyrGAaQ4gZoOIAgCKIwNPAHicY2Bk/Mc4gYGVgYOBhzGNgYHBHUp/ZZBkaGFgYGJgZWbACgLSXFMYHD4yfHVnAnH1mBgZGIE0CDMAAI/zCGl4nNXY939eZR3G8c9J0rQpraS7QQrpbrBAutOKkDaUtKgIFCh1lg5onW2hQHF1Aw5klOUWcW/FhQsVceIeuHGhuO+FKGq97lz8C/xg0nfPK8+rOc9z7nPu7/f6FhgGtMpcadOfu2ioL92pV5uh11sZOfR6W+s1+vl8+vU7k0NHGB3Gha5wXFgcloWBsDKsCuvCBWFr2BUOxCZ2xK7YE5fG/rgidaSu1JOWptV5dV6b1+X1eWvela/Ot5a20lG6Sk+ZV/rKQBk8fBgCYVToDBPClDA39IV+nXkwrAnrw8awPeyOxNbYGbtj79CZm9SZulNv6s+r8plDZ96Qt+Xd+dpCaS+dpbv0lgWlv6ysZ35MvhqtyHN5Pju4gkO8k/fyYX3fwV18gW/yC/7AH3moGdEc1cwd+j6pOaNZ3+xo9jcHm0ND37c1dzT3NPc19zcPNA+3jGwZ1TKx5eihM7fSznBGcASjGMfjGM3ziIzX+o/kkWa4zjqsaW86OJJOxjRH8GdexZV8n6u5hqt4Jac0o/TJ3soTOYlX8xTubdqYyCS6mMwMnswxTGUOszm5GU2LruM3/JZf8W2+qKt4D6/Q1ezmFl7PG3gdr+UffI9vsYL9nN608F/u40e6vsxRDLKS57CFXbxA6/AsnsmzuYidbNLKXMFWLmc727iYl7CRF3Ihm7mUF3MeB/k4b+fdvIs38WYONzQNP+U0TuXH/ISHKPyAfezVE3c9N9DDp7mH73Acr9GnW8d/GGAsl/AErfODzUg+T+Lp3M8nOF5P7c+5k5/pHtzMTSzjHRxLNzOZxTSmczRTuI1P0st8lrCYE5jHAvpYyCJ+x2e4ln/zDF7OS3kZv2Y1v9RdXMufWM8FvIgT+Yvu6eNZxaf4p+7z1/TIHuJj/JCP6r5/ha/qX31Ez8CH+CAf4P28j6/zXfawgYd5EtfxFpazlN8zgbM4mzU8lTM4h3M5k6fxd77MZ7mbf/E3buSN3Nq0chkHeIC3aXd28Fe+wef4Erfr8Wh/jJ7o/6evUUN/3e0fmiNr9bBau8Kjan0LLaYdRWg17S1Cm2mXEYaZ9huh3eo7hOGmPUgYYdqNhA7TvlTNMu1QwmjTXiV0mnYtYYzVmhvGWq2tYZzxiI4TrKnvOdGa+p6TrKm/O9nqExC6rKmfZYpR1+EYo77/sUZ9/25r6jVONdUNwjRTBSFMN9USwgxTVSHMNNUXwixTpSHMNtUcwhxT9SH0GKfoeJw1dZ3mmmoT4XhTlSKcYKpXhBNNlYvQa6phhHmmakaYb9yr4wJr6v1caNT1W2TU9Vts1DXrM+paLjXqtS4zVUdCv1HXcrlR12yFUa91wKhrsNI4WcdBa+qzsMqoz+AaU7UlnGOqu4RzTRWYcJ6pFhPWmqoy4XxTfSasM1VqwnpTVSRcYKrehI2mOk7YZKrohM2m2k640FTlCReZ6j1hi6nyE7aaegBhu6kbEHaY+gLhYlOHIFxi1HXaaeoahEuN03W8zJq6Jpebegphl6m7EHab+gxhj6njEPaaeg9hn6kLEfYbde0PmDpT3YZD1KOIjalbKUmY+haxzdTBiMNMvYzYbupqxOGm/kYcYep0xA5TzyN2mrofcYypDxLHmjoicZypNxLHm7okcYKpXxInmjoncZKphxInm7opscvUV4ndpg5LnGrqtcRppq5LnG7qv8QZpk5MnGnqycRZpu5MnG3q08Q5po5N7DH1bmKvqYsT55n6OXG+qbMTF5h6PHGhoTwWF1m9HXGxNfX+LDFlAWKfKRUQl5ryAbHflBSIK0yZgdSY0gOpxZQjSK2mREFqM2UL0jBTyiC1m/IGabgpeZBGmDIIqcOURkidplxCGmNKKKSxpqxCGmdKLaTxpvxCmmB1z6aJpkxDmmRKN6TJppxD6jLqubtN2Yc01ZSCSNNMeYg03XhQxxmmjESaaUpLpFmm3ESabUpQpDmmLEXqMaUqUq8pX5HmWZ0b0nxT5iItMKUv0kJTDiMtMiUy0mJTNiMtMaU0Up8pr5GWmpIbqd+U4UjLjboGK4x6TQNGvaZTjboeK426HqeZ8h9p0JQESatMmZC02pQOyatMOZG82pQYyWeasiP5LFOKJJ9typPkNaZkST7HlDHJ55rSJvk8U+4krzUlUPI6UxYlrzelUvIGUz4lbzQlVfImU2YlbzalV/KFphxLvsiUaMlbTNmWvNWo17fNlHfJ203Jl7zDqJ/xYlMaJl9i1M+405R9yZeasjL5MlNqJl9uys/kXaYkTd5tytTkPUZd+72mnE3eZ0rc5P2m7E0+YErh5INWA2C+0pTMyVeZMjr5alNaJ19ryu3k60wJnny9KcuTbzClevIhG7rGG01Jn3yTKfOTbzalf/ItpjmAfKtpIqjlaIhmA0pjmhIoLaZ5gdJqmhwobaYZQlOtaZqgDDfNFZQRpgmD0mGaNSidpqmDMsY0f1DGmiYRyjjTTEIZb5pOKI/SnEKZaJpYKJNMswtlsmmKoXSZ5hlKt2myoUw1zTiUaaZphzLdNPdQZpgmIMpM0yxEmWWaiiizTfMRZY5pUqL0mGYmSq9peqLMM81RlAWG7kFZaE1d40WmKYuy2DRvUZaYJi9Kn2kGo/Rb/b+Sstyo673CNKFRBkyzGmWlaWqjnGaa3yiDxu3/A94hA2UAeJycvQmcJMdZJ5qRV+R9VFZmVmXdVV2Vffd0Zx0z0zM9PSPNJXWNpBnJuq2RLaolWTYyPrGepbIxDzA+sQ3u2t3nNRiDl8umx2DMmrU5bLxMGQzsrjHHwq7dvWB23+8tLDx4uzX7RWRWdfWMBPh1V0VGRl4RkRHf9/+uKIZl4A/9f+g6ozMrDFMPO23PT/47OMRiuoS8NBZNJGL49zrtTvsUgmQNytc66HWfbijHfN32vGK6WN359DLGOUlS8ilbLqh6rZIvyLqa1rAr5SQXf/PTDZU3JcPRLQHjAZwN5djDcIYuF/LlGV0tyLZV0DDOY0yqFtfvy+jLjMaYkFsrorSBqsuouYGcFkZM55F2+5HXPNLuPPLUh9CXabb9yKsfbY9+/4uvIJfS6wdoyKQYxonWvAJKiwsIt2rVxknUbPf3vGLRi/qRWyyiYdG95hb7fboZP/tr6HeYMhNBrt1qh42wgat4lXYGTrpkA5Fe6bRRu5P8e34x7i/07xBCLJY0zKszizMrnqaqHOcHfqRmarmcP7rX07AkCrKRWrRkEWv5pVn04xwribIoIyT6+Vwto2cCL8iwrKdmjtQXZ0Y/aqRVPyUbis7ZcrWm5gQ+qesQ2hkyR+A91kTs41DEbq3VCHHYaYS1VtTuhB2/3WlFrud3fOz5EV5rNxtVMe2h4VFszLZnvaAb+LA1cKcjmrPt0Mt3Aw+2hnj06+Wlpc2lpWHOD+MT6BV+sJVccfSoaISk4HXktM0lUiWO1usL6POMzBjkHSCoFtTHb0XYdystv1Vz0SDMffzjuS/0moPB6PqwhxrJfjS7s7PzQr8/uc+30J8wHlNljkIeethEBoIBCy0wUQOG5QbyOLJLRmvaa+OOR09ZZukxHwazt4a+6JqmG7rH8k9b5WXraWyQnWP/7gck25e+X7J87WkJiryjxxbgvFn3aOFpu7KEfgnOgRMN/LS1XLaezpMd0xx9/Qck30KYphEt9Qxj4eDUCqk2T+u+j/YZh8kz80wb3k+r2VhAYQ3XqiKMSC+qrLXDNS8tVhvNth/ZcSZag+7B8LrGu6hrqgvVXnVBMU0FMao5yNXrrUZj2CdpIOJuL4pze9cUM4pMBTbmpxotclY4+mt6Nvv2t+cepDmolhxPMvR7jMCoMMNcJgejvc7MMfD6EH1TJgpbMFrgRflkvxSX1n0YWjQhRyrkNb761a92+v1g+zt6va0mpjv/laajfu866vWu95uo2UR3X73qPPvs+v0POA891FxY2H7ssdSzz6ZoGj340EMPwnczgr9kTP8R+i+03+gbx/DCTbYG47kN0847GL4/n7XtbOHSzJFuo5v9rZReyJw5ExrpdD6dRr+SPXM6W9Ct+6THot+o31OAU99CDuTT4zlO6ANH+qJjV2whcit2NEDMaG94g4n6qDvaDSLUTcbgF9GXGAy9VIM8dES7yGLoHZjrQFXIazqFWs1O2ycHTITuvnLkiphJ87/n75f0UiHzRFkte2oZy1+EYkfAV9D74AwspP1mYd/VZamsenDKK7OF6kNQ7GTEKwkN+2P0nxgYTgge1qDDmkwkSmQaMVEOOx4d50hd+bEVd9VO24K+vHEBp7MpT9GVlIkvbKykV1NOSkC7yz+6ovOQXXXJKWZK0WU/lXHx+Y2kfDLnhugajIsF5jyMWrvZqFWqomvHI7YekSG7gOj4PIlqZJCuQ/Pba57rT+8V0PSZLTQ01dEuHcNd1bzBZFXTVLOSIk0y/YAcDbCKA1JEMj3UJGWj65C+03TNhoih6ZB5N8k8eEvJeN4NWQS8I2LuZR4BDlA1ULqI1jZQcxn5BsLLKGx3GlUsAsMrIELdG9CNnXYIc6+I/LV2x+OgtNOG+dMI4WzYUBKfsEgPRiQH9F7E7c7extMbG0+/lSRvE3xLXiwJpuyIMs9KnlKv8JIRyEZBbq0ERZY3efyvHY4VeCRLqljAGrxsH+cKQcUuKylLyLgX32GWZMtDPMskd4Xk43YelyPdVkVJtWUd8XoGOZ6LVNXMBs6xiiXpoz9Pe3rWkU0VcyzP8XK+nRIFnuOMwjySZxbDM+gZUdZNXlUZmPUHfTQLnOME86qbesmBXLsDnQEtrZEOEkPaaYTrhaR/DNToQFd5PjnUWEHuMkwE0nkema5kgMKxuOfIv+iSLoTcBgsvYKrPNEGWWMHQeM7VBV1KF00txcumFCr2/XaOlVE6d45bU9MidgJIq7ovsCyrszwv8ClBEnWMS34N81DIYbuscixiOdW76xVHXH+6C0e/jmUkSaxUMPWUhpCAOc7SEOZ9QSpkbCXn8CXoLREOsbzgvk00ZQUeYQqSLrAyL8qen/PYoqe5hggVnvFUU65Dby+v21a6Bd1pT/VpiskwBaAVs8wyjMFjzCZzltliLjMPMI8yr2Seuqmvhcjza41OC0YWwCu/1grdGhlrJMXwjUQ/cmsNn3RhCCyUTP+TCDZwhByHQQp3COE1QUpKONiFM8mVeKqrR397Gkkd82sNRxI0mX20dl6UnMajrNw4zZsdKXj0svwwOfbUOQHKH0FQzllHJRbJR02usaz5R8r/w9eWyuUlzV8t/bWvL5WPTHfx/1urVn72brOuG7Vq7ex33W3q9VeerVXPzlSq585Wb7vLqOvmXZeg1PiupLg6U61WZrZnCt7C6cLMwug/14re4plibd6b0CHan8eZC7eMT9wej60QBiVpO83EA4+OVhiZRZbOVzJU8fjsqR4JngTMZcgpTZB4LuOcXGbNkuP0TgMS5fmUbkh5UZEMPbrLdbBQVdqBagFN0jVe4g6Nra9sLVY9R8MK5gn4kpU5R9NyG3dx6Ww+U7BZkXcQj41SztAUS7u7ttx4aME2ZEMVFeUA7/4u+iqThnHDEICTcJUGzBfsA6QRvITroZ/Kniu/02k3nJ/Q9bXTpTsu3KEYo49gzzQ9QEBZw/gJp9FyfrB8ds1Q77h4R2nzc9gk6GfynM8C30sDr2dQlXTICszk9prvJWAfdwBtF+gMrpKDLcDcEWLSpi6LPCfa6a5jCxxMCM1Mnyu0y7la9ciVI9VqrtgqIcdQHcPWG/lyOd/QbcNRjTMr1XZ+E8uCJAky3iy0gJ2JtNEY/T5Fh0VAr+vMXQzTqrQAV7PhMotbFd+u2YJBCEgLUBy8P28DLUPPeEA/4O1uIJgrHUKQioTwvEgZYjZONM+m06mtV67dYPauowf0TqBJ1pIbOFd4BbNAgdFlP8qIAqsI/GzFUTlFZjmDz50uiSIri0J7KUjRMifClufc+0xz9baMjoPRAPV+N3B0Ub5qS4reETgkKyKS1MdNWUSKIiCorm4LrKjwfscxBCTDs5BYtHMCK6h8ecJnrwGf5QBZAFF2Kq0KalVcDNsu6sEzIgAiNNOH3GDQi8glwk3XmYCT6LUOoLF6BAl8hfE99vZQtgt/o/2pG21Hg2gn+gfqUECTOjA3mMNVeMnn0+fC42sRhYbx9V1I9/rdbnKPnWgwSJ4tTWQXch8LMGgWxn4FUCggjopNaoDdKMHGLcAWHZBl3PGX1HM46qHt0XXU3O8S0eO4Wxxs0z9SFqEBHO4G3S6VX6Ko6GaD7eZ2sB2M272PBuN2IyKUVOxKnSDavVEzS68OBmjQbHZvMLtBkOCxa1BficiUNiAyAMR7zV60uxv1oDLDXrC7G/SYifx5DW2T3nKI1BX2+304EfX6/ezu7sE5fdQksxIwJepv91C0s3NwjGAwidaNPgofPAMFyWMn527DuQK5Dzk1eQqKnzk5pwv1Yam0j7rwGra/4/BzOq1KSBsVoSh+zLhxh59BMKePB/QRyRPGx+n9AdAMd3ZQb3L/pM/qNZs2I5zUfvKgW/qsTqWNpAGDW/qsS55zCvm7273dweCmcoQjFGwPoY0JvbuGPgfjCiQbx4uhs+/FAjuhKqTAIBCQQhvfowCnQRDMH2IWSRrLpTTfKASK7xcLgpAtrKx95yOuo8on6o1NXJ+TVUmYmVVV9PMcSPspxVIlSw4yoiaIp9vHo+PFEtdanY9WrqS9T1ooSHlpQyzYzngefwr9DsygDNQvpDX0cQmwPuniFRgT2Cejn4DocJyB/vM7Ud3v4LD2XYbRLK2vl5qGEZXX18sPz584ce+J9YVYYj9TaZ2e2Rz9Zbm9ObOJ/o/4PHJ+OYLzf/XEfetwcjYW2vPHtB8+9v3H9A8dS/rsd6BeJZBaQf5iDZZwU4r2Nthl1qCDzN9gcaPVWSWSYaeBHl07jqNHXr06s6bPy7PF+r3nQmHpznvPOUdeUJazj7x6Q0LZbPd1iEe/AHuvPI6D1PGZXGnNcuhpcHIjc9eHMmvHxT/DqvDcc5fbiGUm+o19QFfAFzsVtwKChA1CMcxVIgF2bMITiWSy1qYiGzS9TLYgP2wAq4ZPN1oqoWZpaTQALvggCggfGu0JVNGEJveHF4IiO7n7OrJr5O5RBQ2i+J57e0QiQQHaHW1P3Y+ZruMx5gy8QSCDUD8XPoflJLE2FpiSbTUcF7SoyOSPxdphtFL084FbLLoBPEPXIYnGmWCpHA1AGAKOjvZ2o+KK53WL80VSpBzlqbDUjFP+KNlsZ8tLu7sUAJgx36U0V2Z8ZoZpQY3fAHUW3TSIrq12w283oOWABLxordM+hLi4aiwJARyI1XGdg3M34CgAh3ZnLY1XiQIDJhMcbBKd4ZqLoYRITDUCN0QMt6Y3fF3JyvEIPyoarpnjsWgbnqkvdR7rdB57DUk6s+ezvM2Xmg88+UCz+cCSaKStgFd420wXH26czdg+FoKiVXQAoJNXnc9gIesFlYIkHq1lLJPPLy6trVxaWbmEHp/v1Gtv9URF/Fiu7NqLqXTKQgvJcyAZva6QE1yhRR8EyVvpWY7HziC5nGN5pLwx5W94DjZYjkPCc6mFanlRVYwSX1i59PJLK6RbE8UlDAcNOFkDcP8JwPyP3aS99Ke7FB8+goswVvAGIK4GJuOAjAeir6NyQdQkWM1kQ0rBXL8yhr+IOfeGs2ff8C6SnDvz7OnTz76DJGfWn1hff+KNJHnKdUqhEVQWHyktLm4sLl7S0yYInixbds2sJrfb7bpvSwKLcryEDc1SdZZJbgiJntwQkmxyQ0gWNbxaDjxxNldaDMhNNxb7pmjpKd3U2vk03MxttZBr5dK+MxP49HkJ7gN6vA/8gMzoOUB9RPJshtAr0N7OOINbZCoU4sKpvN9shDdNI7hgrLpeo2R9A/p1rJ114+49iSbq7b2sYllpczugc2g7nhjJprc665e9wCv7s6uOOy85nuZUidZVmp/dtdLavFxxdPPI5VdcPmKYTllOe1oa7WZySsG1TCXZvvdB1bSUw4mVXzFOWb5vbW2R9JSxctTzdQ6DXCnyMub0pe8UOZsF5uF38yu53Eq+64Ogz0oyJx7oEgkf9UGqXCFambHepUGJB8CjNKb0RqiQtFahsGk6n1AjOBFSoHPNDr0Deuia5XnWHOtZgeWxc7Az+p9TSpcZonA01Rsk3aBUJp+cmocd1IXOwgJplIBJ38Ud2Y03WyCRjA9Cdoz5+tAOA97+EnOSOQ2S8UWmS8cACBt0bCcjYXqXo5rTeBRAa+mYmN4POy4+hVwTxVv8p5qka6ohaf6SN9AkQ9V0SfOW/A+aSkSaEynmgKZ0fy8CSJp80DNWNuXatpvKWlnHyR7aG/39kFwyJLeY5D4WRPQ/m42CJnwnfOUXoZ0rVINJFJi4FoqxGslPEz2JiP3WMkuJKXBUt0OlV6DB6F1VOTAj7/bcbV7bDOSa7bDCXA6bUbCkphc3lhxlOWhZcn5OYB10NXVHzQvYfp/LebU7bRlZZuWU5SmPv09av329VoNE+sArpKy1WTEtxEzxqyGjU/0qSH4+4O0YETlhJ8TwAeQBUqePmCNX5sujnpsLZkqN4WOPqcfFP9Ui6bEHlB/9CTTcLJdHeyhIZ9J5Kz36vjvPK5XX6K/PSOcvqk8+PaGJ6Gvo15lLzP3MVeY1zHPM9zEfAHxHlN4rKE1esJkoiVqJyNvukMEJPQT9QYdoNNYmJtt4IMcnkHHv+eGYdXbGdJNo/cnAgGEE48SPR0tcBPOkPd73p/LoC97SKV/S5JTsyATJyZrkn1ryrHSqxgqVwGjIPOHJwGua8CVZXg71oMqz1VywL1tk0N8fs+azAvAm+HJ8wN8u81swycUtET+4RXSUJClRHEKSv/M3l3yQmF1LUgUR5FM3V9f9pU1f0ZWV45pRPe4C2wEWr5Nr9TiFXdYU3eNVQzu+YtlPxPMtijcf4DUAPgK3KWJJkaR1rEqSiqMYDiW0ZA/9GeVTZA4yiJhSSMdRg8nBTrtJzIDkRY1fDXQ9FqanJnQoUtWy+n6iwH6/ik5qJe19mk/y1qtI2auWier7/SQZfUOVNBUkYTltSlX071X1/VrJJ8dOqvEZkHz0VWrZ1+Aqeg+/pL0nlXNc28k4geHnJzLru9FXQWIsUC2GH6sqwg5BqZ5PBrLfMBGBMMAtgViEFHtgD2Vfn1po3NtYSL3OONY4FWV1LRWsrL4xA6BtNqhlGpvpwNlseL4Vosu/O+M5jjfz1UwO3Tmz6qqmdIf2/CKfXXbfFXhLXiAUXJBaKV1mmSlZ2GdygJxrgOcXYPZHTIdZZ04xDEGsPkiu4y/+NvJE4qUSdC+KtpsgPEXDl870iJQOfyzTJZuo3yR//ThP070dkjugBdfQb4HUvUztU/FUrGHfxWGrE1ZjXa6BCkTVS0FhB6AeBTANtKvbGTVIOXNWEKQWXCebUbAsCW6+srJ2bqNk7c6EWr1Z18K7Nste0ZB4brHSzee7lUWONzXZ0jP2JpYEycAYPXf80pEjdx890En8FhNQzRCRjfEY9UAd1hG1e9CaElkonFTn8tEgOLoC/I3zC8WFsBguFAs+J6bdt83B37guiOnOzHQ1P133N8jDEXzFDb+e9sXU3Ny/HVdjUo8h1OM8cyf0DumaGhGQq1iM+6Pjkaq0mnUYZESETEAGIWtQp/a4O0Niaoj/Ycr4UGk0sLJGCWUfeSR7vJANytXlubnlajkY/Y1Z5x1B0gRJNZ1MXsI6Xy+l9QzPI1a0nrZEFvF8Rk9vr6+v7xkix7Vf/sjRwDt2QZJEjOBdSdKF9llNzNhBRRBFLGDOtjRL1LDIGYGu+gUrDK2Cr+qBwYl4MfjgB6GZesITvg7jt3Ro3N5G234XcyWWj+zDtNitUe58EhHq60/lHcJRYNiuI6IOilx8U348wlG/O+p1/ZLfg+9eTKF24w0d7r1mcxuGdrIZ0AGOBqM+6mcJrMjSdJOQ0k1CFye50VuI4mqfDv0sHfQBTaMxT7q1rd9e+1oVtxOr2ug3bgdgoR6AoBdpx6A5IPXeQdv/SL0/uLeXvUb/DubnPozB2BYKGA5kXYroYjm1E3ETY2j/Ts201NHTqmVqd3Z7EVUGnICRpo1+V02lVLSsWSDNnrjvBHym7XzEBkr8JEg77BquuZ2xTXrQRf39qL9fWlo6tbSEgHzcYFDQ3Bsmpv4Y5/wn9H8T7W0n0arAeE/sZBso1i/T4gZl9Q2qW0kQO6aGJUz8Jqii91BWjFKXzt3ZdXRdzRu2krZk3dNEnNFLmu/mEZqp6ZLC866ec2AKGynowlKx4qb8hRkeCTI/s5iyZks8Kyh8MazbqVmrWopaZa9SKCgSbxs8BrZlYZ5DogHyYJn39IJ6LKWyngEsSrNk08rIsqaVlzKcLLFcZilXnPVYBbOsG15YP80wB3rEIXDSKowlphONEXfLTgA6GU0VXMPjPo0mnbs3BtYUh3ZVE2319nQA4GXf/xsYIGXPo4K7ihi6iXa3PSgbf6b0FwNixXYqZPz6MCCJJqS327wWoC68r25z70CGIHUtgHS6Qrwp6jYVNquUKmHY4rB9sI/GFRUmLgrjDBpqBIJY+tN6ORDbHEEn2hbaUSn4Gf0HldgizI/GWChC62LGIHDJzIqfUFJGKMvE/Ub38fejfgxZdg/JDZOxORzrZ+t2Lf4nY3S4HfWi7VjBG4z2hsMpTFtmViGXFrFdITCyTQUjn6okyC7ZukXE2dhLxMdQJNAADXV19PwzAnQrqgO5xI+YngVcSdVX7xPhRcypMPQuo4+raX70yZ+RFTJ9ecHS2I9pKcvnOE5wRv8MFX4EjoAwxaYw+/Zp/kr0pjbkWgD23dCNJkI/YlYvHxleW738+JUjR64gZvfI5dXBtSNk5/HLq7G8xDJoBJhiiWkzx5kN5gxzjrmDoB6PKjBhFokEpQFmA5wWgzSC3al7QGsZ1WCG1UQ/eXFrJgKOiQ9/0WrNLOW1dBYhjmdnMP6W5EpfwvgvsesZz5vAclgWabrsaVruikRf0Y+nfiz1pcn3R53fTP2Yg/5mhiVsKuNqubIxI7lwA/wluNW3pDPGC6aT0zRP1nXEsZwt0fdsw1XPwx1emPpOvXuCT2du9v6KNSexFgXAHvYBiq7iNGKOvrzTefmzJDk6f25+/ty9JMlwHHpdNwstGyYHIRntJEch+X4Oofbl554TVObQfMrBtkkmQw1mBUnctG8gN/aAaDbQW7kT88VVQ9GDBldbbIGUXG8toYCzhfmTgO3rOYUV16oz7fb5aDL3fgf9PrTnInOZeTOhtk0i8RFvtHXUog8glMMlU4ziauKrJhDw0KZqNwLCfEIeO9RIHCe+12416mPVcIdWeAG5scMbMZQVkCfSAnKESFLVxj+XFE0GPGCmTFbVNJU1U0BIJaSkl/Oqz7HLM+GVUiGLpUL5icW8bmiiqrKWYplpnxv97QJhHidUDi7CiiTLqkx0b3rK5Mi9kJ6XZZZV1AIWdNXAjiKZkuJgUzGFp9xiAdcXZm9PpfRc9s76bHHG9PNWypJ0GRmiwrJ+Ong85k7PCQ42VF3ABbgdr8h5SYBbxLc7mFe/ib4E/dmm8x0ILg7jDaXAPp36HUpwQ7oxUeKY4MdeDKcQ+lIuzC2nVFNNSYoi9WlGVSVr2cnnvvA9jiwqgmQ7blpbVNPO96AvObmcs0RPIRf1sapikrGWc43cm97upNVFzU07liwooux8z6HxJMIbr7sdGyY/YgYD+D766Oj6o4/edA4SWtj2W2h4Y3wSasJJbKI3ie1VTMeObCeya/1ur9vtoSaxd42uT9lHqOXD0SFHzHcDYiKZ0MhrVPfGOC5uVVo+bvmtjltxw47bj1B2ezuIRvvb26jbbXw86m5Fg2R7UM8dai8jLQndmh25HWK0AuljiE4+Mho+8shzz6Houeem2wXnd0ir/BbUuYWHgwE5/ddo0557bnSdnD0+P4htTE4ED6hF2/0+VIUgqGm8IgD/Ojs+p06nQTpG10TD3O5EhPIR6E3UKxSM1+iRWCc4ORARgYY+4axiZCzXtTKGwnIyx/ICcuyyrac1jeeVEOAHUEBSLksaefuaJPO8LCDbyMe1+wNeSQW1l9eClMIDGFFYOVVrh8DwZF5R+PfM5gwJyYLMiZJmz9uaJHKyIrCSAVRmYge9BijcA0RK/HGIJeFOYu8g/JlSOyAJzpj73golcCd2Fpw4E1YmR2JwuNa+ijbdDCV/mU/H7PnhmD3/h5hpv/AyYOLbcR5txIfeYFKngl7uTI1S16O1MygblzVjTh1/3vOGAbD3hc50WTe+FTNFz4l1d4bglBjFjglVpZWQQIppBYKsIwziLkFH/Yh4igH0gclpogdG14O9PeJHdoNRoApKENANUVHuX7s26B3Wb2lM5mbuEU7rtg44xme63Wj8OcQp9qYOMNN+g5gxiGU2omZv341wGLXQdjS63tzp9vtdmHPD4aC5MxjsHODEP0R/TOevA2/W76yw2Hd8TzRZ6jv8scqnqmblUzPfuFdFyv/61Mx/s7TKj1Q+CWWfnEEL96pFZTTzqf+uytzB/X4e7TLK2L+W3Ah4v0cYPNHgoSfOyggP31sc4tzJ9+bfs/3e/HvRJ87KWekrhfd8RUJ3vy//vl+Esolu+cCeDzil5pL3ICRb1LuOsqMBysYbEAOIIoKmzD90vT++PtpLfBF6t1z+Utf7yfPJFu3u7RGXC5redHnSF28DOmMyPswfxrFjdkf8RggDx60YlONojeq+B69vnQyKXrB+W6mWDzJBOHc0yEPxaDdaqjQwy4eFxbl33GGHqaPzvjdFx4gtPoppZUQMg3v9/j4a7He3e92pcTegPrWMQy3xDvG9xnu9XnYw6NIU9XrE4/kGQzdTPOIaxRxA0joggPmVDnSeD1QTR8DYKpjwjQ8cP17ula+OeldhE+fRAPLoytURbLfLx45BchX1xvmJTf3jMY4iWFjERGClFJICfaCeRISNNbCA7JnVKGXM77y8bjv3feBex6o/uuNqlmRH6I2d1motlwNRuhqu3H7X3bethBXYM1TTqqy2OuRRwiGZMvYrBjrt1uChYQcLpC0+52NoXIW0MtwdDPrbpaOPo/R26fGjper646XRELLrxDOgV3r82Ple6djj6HzlsWOlHmQfm/ZZ0WKt1QEeBGwYEmMq8HcC3ECaIQJzmvB9FycgqYp2qQGHJh+d1WxTNXWvYFXqpbrpGlIDG1nDyFJgnpyoqoYLaMZRzIpTzNq+qaryXWKg6RljQr/3k/FLZqNHNVdVgvGAPRKNR0QYba1Ossk3SrbdvaDXi+Bzg9nbhWEe9IZdMsSDbLYbPfQgUVl0m82tKCL7L+3/g5LZNtZHxLOGuN/s9YCGwbSB0bdN1SHNnd6Uv8UPxvwZwezAtU7UgS96S/tC2/wZi6Yw6aJorzmZp8PpeepU3EP/sUg2/d2F+jep2iXRle5PZLp/QFdKvHEoH3CnXX7ir/8Sx4hWqZLkiQcPtL7XjfpRvwnfqDddMOxnhygLWQRQpN/rdZuTv/7+/nB3dydK/rbi0ik9DOVgqBaPt3VEVUKEbVGWRvPUouADLOp+vtwqFltl3XKs+BPIlmX10bDUOtUq7SiWpaCIpKMhzXfhlO3r5OWIk3dcY64wjzBXmSeYJ6GEuOnBHAZhj7zlToJzQOzDVVwVSfRH22/Qyb0K5TADiOTbJnQPx+zWpyZmgoaqoUuq2+TWOuRe2Beig/GD+pzJipwwd2GxxIqswAqciiUBSYi4w66CBMEJimY4hkL0p8gSBU0CVMQjQRFUAQtK6EU8n05VlNFf7dM/VGLhJgLHCnOpVJGD6wSF50kBx0qK8BMSLwqqwWMQFFhdENgUoC1eEuCSlGBYKqpJd/WyehgM4H+6fyTqwbwIMtXLqAYL+6eIMY2QnFatRa3BMXnA/gYlgMAm48OUQkBhwhVibw0AIdAvB/yDON4OoBmahC7u7ZUXdZMTeWzaioZBLtJEjjOzwJYqjpU2FKwIpqpjbGggGBggFKU9XVf0CvC9bi/QZaycjYIPp5AG7dRMDbOiaAiiKEI7zcBcC+7UdNUUOICHtmhhjndE21R0hFjDDsZ05tqL05ka5ZUYpgGA7DolAPG3lmx3ezCTA0Jo0BShGWSzVC/6YoTmIIaq8k8Z8aj/b8qtUqlVVgH2WWliDAtgVJPBvtkqfZh6z0TEHj6i1lNEVD0TmjIEqmbAzFokSAYmeGfiC9O5ReWJ4TgJPiE0FJ287QZz+4kYz/5ISG48GpA0NFCzeX2riYbdIOgmaqUAjg7HFbFPnPgxmO/9W+qweksdHJtI1bSsdhAGQQy68In8DnwOVeRr5Pmj6watD8Gx0KFB0FoFot7MBoeqNBrGdTlpJXX72rV+Hz5Qr5jm/CrQZ4dYQTqxwQPEG6IbhXkcxUbym8v+ylLTKVNcqtXWa3OSsFavLHzlUJG42igv/Gw+bcD0K51LreWb67etdMLKLSVTePcXmTSlez7RKySappMo1jWR2KuVxIJIogPRa/KW9a/MJfOYaZLN2z8mSR3s4R/HuCO56J150weU+q8s66jltX04xRx968exC+fgj0ke7mCG+fbpbQm1/v/R22GPyM1jm8BvUwS5AnzoJEiYdybW8U4jFsCitU7LiP0ucBQCxwR+6b4E1iTEuTSOf6F6thD9sCyLipxeqtozFT8lpWU/k/167ljueM5Yb3eCgmnrZqGc9mzTsF6zaAic9ETWtm0zBzgzGPbQL7Ec7yrOTKYxhz2Ozx8t/p+DwcJ3DnzXsnnEpvS0s7mgeGowa6vBjJbRP9QfBoPuBDN8AV1iTjPnmbuAWj7EMMRo5VLBOKzFXiGAOGskOo142sKoBoxCmg/HTBQRSrrm42VoP2BIIItwoI6jFSRCH1C8hVdrUaxraqIPKbaa8ispk8sIhWxnJpMzj5u5TKaayfnLSylVxiZmK6wol5fTMnZkV5fZO+9kZW30V0JOEvlni4ph2a9avIZWA8v6Is+5OG0XJC2d2dxcWNgMNjc3Obg6DZdZWspRXE40VTtIK+Z9RtqzrHkk+crtC1qWmfi8XTuEOw58jG+ytR54FcczMf4kvtDEAtUcxHgmHqPvgPmJQQpj6hFX46DXwloHXTnyVLN3JP8q9XKjTzTU3fCtBzxrQHmWSy0GDRLVMNbeEab0kjvvju0BR/b2Nl8kR91wIB8FO7dkDmTibdSnXIOJfafC2ImKuk21XKJY70Uz7VQ6yhS/u5TZQ/0fqoeOW/vADy+Vw7C09AvQ6pgHfQt9CyTrHPCeCtNijgJm22CSyEwRh8RtAKgBG8ahmYIPJBJE7pB4QSdRmX7sYNARQhhvMDf8JDxTtdsLIYnPTJ+0JY0EaI7eDlJ0LwJh+nOWU0vCM2dO2KFdWbKQMD4I15PoS02y50MSqemc6lgqCdU8DQeH273o/faJGdhdOHbUqznWrLVUsd3kEGmSPeF1/xAujW2hpPeAq9oEwUcoQZ14CoG+2PaljqFBFzD6oHuDCRATZAdZsrk+SW4pQMMgGPWzWdTLkr9+PyB/0SQJoIQciGhCCia0lMjHS3EMKonmm8SfkmhZYkSoUodjMixOkViKTrsEX7TnWaMdYtNA25ZXETn+ySewwMncs+3Os5zMCuITT/IsILd/+S+Nd+8RqwhJ/k5U+atPYpFjH1tdfYzlRPzkVV4VFe1tb9MmcvJfQn2KRONJtNTA6OtUGd4g3kBAakosifRMgxBxnViOUBNScfBTRGvG8x99O6eo6BvPScv+f/Rc6S1k67t3/rfXqVhgETr+UzyLZWaKjxAZJ0s1T/AoaD08iLioLiPyNBJS8kqYs0dGP3Pk6z8t8Kotvf+HcErhBDRY/toyfP74PbxlssIrXymwpsVP6CmJ7SW+23kaOXtLnOTEflYhiGV6B+2ZyqhHIyEHijnqJ1q3+0f7zYNshKi3HT0PvTOGCzs7w3FmyrYkxVHubgjSdafmEH2uDfTM3RtG7535Z09G0Wh/2ARZbBjc9d6Zf36D6Ua7IP4cxAV8J4x7l9gugerXSBjrOmo1aIgyoKw/uHNDuSDKbiNTno9OnYp++eJySlJOc9FS++JEdzE8rNeL73PoNm6i3rsDPaMAKH6yJZ3UU2W7WF9otX5dNgw01JXRBxX9IxuhaR5lF8KljY/oCjmZmchDBA9Mz87JE8fgEFG5kE7MlpBsD3fjaJDtBsPRdUhoOOpgDNFGOyD5AfQFoB5QVd9Ed/J1Gt9CRAkifZWQi12YHiuo1c1WKsv3Llcq2b7jVSwNvTvCWKCf6NouJ1iG8QIzbQPkaC/bNbvTGgeSumLsH9KPutmat7waLNSChWxr1W9EqD/qD4YSQsSvQx5qLMKY+MQfjD2echIrjr+xccUhonGCjv1OLUDXd0bDrdg8MBgM+32Qi4c7CGjGNpCOIOj1D9q5j/bIbHTqbdqj4zh07CaAh+w027uIKFzvaLXqjrMnRNV6s1l30gb6VMRa6uhX663WHU35o9E3y4twkvz79OWxk/o6hN8hOiImKzHE9vHJCg1umJSjwHVrXbI+g7vjFXfIFrrIKxZRb8ZZ6XaLbp+U9WDrFbe2il6frN1w0DdZauWmWvRprwkarhwHEEAhIj5ZYwW5n6ziQBQIa7HPNd2lL92uxUIiGqxRIePTqkUz6E7VGsFsGu33CSsu+xFQO0nVrdR+SlMEnkWcqOhOzpDY3aylfhMNLHIxXLlmkYvJvb6Csgknf6WiUFfK4UBTbM3QdBD/sroO9/+mamWZ6TUFTOoRsvEicwBwjTNpUzNp06T5pGWrSSHJH0fvMlIpY/R6SNH3jQa7xfkifLoI0JWRysX+CeVAFwVR0jQrVQ40jPaSCwxy8WibYiPybhaKxVdpWiFTdTLUX1jdBZEH2gHicqAfjAWCs2n84WH5BYsvItQkhX/o6Jm0I7bm5hdqjZSrry+Ea/9PSs+4Kdyam1usNpy0fhzKPlvJWIIg1C+7x9PVxtLaM6eXwluLJvRknyKxIl0941iM9tOUBZJY/rH4F92SwbdYYhDz1mNHjhz7e5IosQfH91jUT+N74lf75bjw5Dhy48jcYO4ITa5P+3TEn3cnYyk2tUzkE1JfmdEBrcSxcuXx2wfO0/aJOEJkkuRLPbCgkHKYpvnaZhB1ASP042+2Oxr0d3ZiRoTQjmLSKEESKLhHPae2qY7QmNB3jqJcA56dntDfBrzDReLhTDS8hO4KnZoPRLceuh0AfFAHEggImFqAKQXHcCcEOQ1kiWh3d3939PlGd9iHtB+GmyHhSYPd3RtMHzXCbhCGDzU2G1003IW/zQbIw3BKN2zo4Q0GSgD4hOF22IBTNxtTNOZ5qFlI6kPkmVps84FhTg34aRoeUKu7FL61CHf46R9kL52avS0Mb5s9NhdmavV2e8tPcVfQ8fm5+fk5xOjq5t2zt91922zY8DtbbT/lrc3Tv5swwJgn3TIb/WSVjPFqGdPc6FcGqLcTkeQwHri+A39DkiTj9MvoM4BfPBrDtk58PxyRBDsQ/FKlEyTJ+gdZEMphpJYQ8UIMYQuDFGR06v6y5pFlJKph7Kj1FV7VjGqgSoVq4TWc7BU8BWcL2T/lFcjKOFPIpsrG6tNrZlkoheUP5+y8Xs3xOW1+SVG+sjSvQb5qFOw8xyvoPfa8YRXna5nMnDGTzc4U0mlznBldf83K0aMrr9FTqa822o9Lhvbo7ApCK7OPaoZ0tdPgeTThRX+BPkfQGlnqotMIx44tnXriV1ZC6DdmHpzxjOwbvw+7UgnYYnb9ZU+dygVmIKKXz9w/41aCT7wZ4xL28KiOyhk1a1bxAa/7PfSLRAqqx8EiZGkfEceOMsSdBjEnVxeDrODVj2dXHWc1e7zuCdHi6h3Bwtzqyn35Zda1LJddzr/ssbmFqXFwDcZAmZmnPjpEU5LGE48c4uhBur69hsW034FXQTzdqJu7geod4qgBYjhROEF7cSctos/wkjT6DLSOx3juZLH03NbS/Ens/awsLQuirv12rll2cnDX05lZDw562bxz6qlcqvT+3gn00wJcN/qMJPGSi+fCjVOXrA38GiUjLxFw/OhKqRJU54rKkp+tLJ+6JOTQxpGS9+7e/IlkXZhkvsdz/ASzydzOXGC2oL+AW+INdIprEyWAwbpkfHFrnUTDiMNq4iZMehHm2imW2K5r/kQbWYmNgUTAHtwQMMdzwGVsXTIkASEB+kTRvgoz/f6alTNFUVIc2wgMXXcd2L9GaRP1c4A59B4OC4okq74JQgUWZBv2+NtABspmVzwrZ5QRy7LAfGHDC2UjZ+ey2WYQbNF0St8zSNp5NGknbaMw1Uacdn1oo/BPbF/cttG+ILE8x7JiSpd0aJzAiljWEN9/Z83MG8BJ1RQ0zdTipu0Tdd9o0EPN14Nwo8iS5tFm8Qo0CxrX63m+HRhlFsAE3JRFrEDaZLWozBcFB/HMQAZTwBsy0I6EysV0LgJGAMjK9SMQPXrdYa/X3e0G3d42UQL36Hcr293tb2cnfhb/BX2V+okExL6WoAmQ1IqI0Bd/HIqPesTF9N4To/9a9xbuucObv/zb9XsWvDsuz3vo6XnqKnS3e/kOd/7yRe+LrkvKL14+wDFQXyJvkzozBGKNxWoOMDKHfeAjaO968/r1ph5s9nqI6cUmLdSjFi2COvSH4O9afD8W7gj3M5L7uZTitoiFvh6FPshduOazTDe+w+ivrj20S27y4LWHUECecf161Ps4PIcZ14/G8qlA2wmvZZwaYIKoBeJdza9DXYmrsE+10CHcenct5YQnzi7fhj4Cr3JvCM/o3wByg/o1J90+f+z+zwG/RcxeBP0+eNH7w0Dq1ECAdAGD1CtuZEPlHdIbLaLwRh9eu3zb0rn10LFHb4f7wN2i7laWPOD++4+db6ed2/YI74xAutvdm7IrE1xfpsimSLwiqYGjQyAVtYsQ5zbiArQBUsZma+3YsbXW5okny2e80/W58/Pz5+fqp93lnSOVV6K9cvGpF54qljsrYaE2f/6e8/PVYqN5bW6BLBk0mU9Ef0I0THl45hxZPQ2Ig10hnQTNcaDvomaDsMJORMYUydXHmMpvVamfW80lYeHNaDQEYL9d/HJ22AM82g8Q4xJgWrwwX01vpisL/S5iul1oLoqKrlsE6aYLJ/xsv58lMHSh2Is0HGKtP8F61+hYy1CtVUglppobv8aI2hMnAdYtwqg7QiXO9FEPBOhBFKHuaLgX10EY7QVdApN2R/skIni/GaEgGu7vb8foeRBc39vb6WeHe1P8YVq3xBB0Vkli2MhqWlAZm/rFwxfkthFID2/S7T2yXgCApV30c6N3oG1XS9kvoy7YDInzaDYP+Uq6lGceiigdT1yq3Jtyd7mc+PBMu7okrj9/RMeOMLlvTAPO0zjW8e06iS+pN8mE1Vq1BtRSJIERaaCYJExjbbwuHshz4TJL40r82BJJXjWR8oiqgdok0dnZ47PwmTn5wEn45A3fgM/3CmrdqeZdnjAuVnbzNaderDs1I6clJYZRS9f/TaXa/smobqZS5vwyzSCmQO42W1gkdzt5BtrmG9Yqq3m6UXXqZXpXmdxC0HJmzZkhd4XnYBZ94t6oXqmklrI/mV1K0cyU3HWNvkHvAHkfID0BqEAYu7vE6h8gMpphaKMBpOhBwrq6Q6A7TUtDH9QstGuAaEVOQIxqRMPd3m6WrIM13ffT62tEdo2ibNhyRDdMrO39/qDf39ne3oEMUTMD99lDAfASIJX97PaU7oGsy0BXbnCBE3R3mjs7N7avX9/+jgMd2fuBdpaZtXgEuXTpR6qXo7GiRC+3gqiDyAbi6Mp0C8khIscjJjwT6oppiLKp9lRTFg1TNsIzjYGkYkOLNB2rEtprnAndkpdJSzk1XvFLzUnpjFdy4czR056nW5qua9RNQH4R/doa06Y6WKZToSagia7NeUk920vvTOPwky+qfnvxbBBD9PhKtJOE3UW9cWb7lpLJHP0CnaMgI9Q7U173k1ALvwMIA7c6gG67RdNptOopqxgLjSfufeu/6Pdfs/jJD0vFVNBoBKmi9PJYUnxLdb/ZjPaa9c9O+aYRywITOw2O/YTH63e2aNT5RGidPzeftgpCHuAxrpp5oWCloWim2bzQBOJAstVilvfTi9nsYtrns8XqDBSeiS42mxcP1o8Z0LjkOl07sJYEa0+tcEhGD651lpMl4oALUe0g0b/0AwAPATXGMZA+21QV3S/6qjZDiD4KthZOnFjYspRdcgok147xjmL6vqmlOEC9xaJ32N/vZgp4yFv8kIt4bb1aXT9HkkP+frtJISTktsqkfTyVf3WqbfPgObHnEQmc9aMQk2nlh1MpBrErCZL0Jq8YRduj68Nut7dcWl7uTpLQzrCsGokiYjMWUbKoKhpujwCdbnf1KNCDrN4M9GygR1lIe1lbLudzRc3MnVRtFT6H3gOpZ3hQM4caJeFVJDGua4Qad1wSi0P1GeMqBSL/almQOCOdLklWV3NExbXN9KQeo79/By+mWfV+Nl1IY8O4z1rnBFEppN1Dz1aIlw99NvW09COSYPqQfhQR7Wq3mwVWGt92tBc1s92trW62GU37VpI2TFowruGkKje/F+kWm01yLXHMJO8GNq1KgY3oqqNhvEsRO711MIBq7Q56N5geUNPegOgXkmcRH6wu4OtuEGSJVribzWYnIkSCK8b1TY110gc9D+AQA/KOVtDEkJdw+HGboutwu4A8JqYwb+x2Bwddvr+zQ5yPthJm3Wx26YOtQ20n+t80pZFlZoZ6whxhmok8k9QlkU/G7j3428jTil4jFqrmAN7di6WT+nZjA1Qw3lADVTbZNKkpKrEfvth7e7F3lvigvujLoo7tDPWSv+VlRfTp8En49vgdUeQ1fj83ryhAdN3j95K1lC4NyVKsrWjqhWwRtkUSsx/bVeOx/3X0F9DzdAUz5LkEBgH1W0B+zCE7IQ38X6YhBxssXTq0NvFQj0mE78WqDeqfKVKLADAJ9FUJWaU0L7I8/7PHsNgVMQpKSHZl15Rw+s85XpLSi43ScWRqHtYrZsUs6VqhVK5gyVYUTjJEC5uCiFkNPVks5dcqIoveDRfx70ZIkp1j+Yz8LpbjWdGoRb/IG0HTz0VlU+Pl+dnXFIqfYznsuBlVScMZ2Mi4vqwzB/6Xk7WzOmTtL/jakMR2cvrda15rIqbZPOinPupPX9Mi5grY9sfvknz7JJB50BxfAzLdJAYMTY0Ilhkx4y/qEwtqd6fbndTtRZ8zVTciPo2fM6Y7RHYkqzVMrzySJt6ysQ9Hsq7phItR5znIgfhBMf/2xU6kGoZK0UHUvgOmLPA2siRfsJNYMUrusfuUVgwMWsp9x8iZhMEp5vQ6QoPYt9yJqDAMiI/6jvYm/uSo1xx7mU98tALScuKNGQeDBM0xhof+I5i1AaOTxB0xMPZrBzFNuNIxEFXibHAAD6jKA/lUq5FoO2IN4imWsjAaHBhuIJx40jZYxlmtZmdVRXEK4uh//nsA1DwSsKzKWOAIuLZ0rOFnzYxRrhgZQ8tIRbco2d9RmJs7lpZ1Taq9OagH8AEZalhdzXm8a38Da6LFyZIgiLLMSwpZbvOjBT1rkvgMvcCJiOMQz84dn3NM2wiw4z+YyuXqMU0ey7z7xMMDUSpGHPNr1GUb+pK6OqO9Xm+LfpItiFMHO2Q7kWdj/BkjzwvM3fHoOLTuyJi3O3Hk1RgvTy/wTJaWm4hO4wwGVgwopYEiU4mXa1LMKHEfK7rdbOr2VLY7tnwHo8FOsphVvPlw4/kGf/zScRj6Seio+UDiULY7hC5OZbMp6GvIFn9uMEjwqxJv3HTaIb2FbtxI5td9xHtlbIEbm+VI3/2TysbBGwfWvLE7pYuGFOjTSI6gf5DP9oODfNE9dMQt7sY0liRR9BJ5rzi9VzyIhX0BvUBpBY4XHA87fge98PDDMw8/VH/44fpDD6OHyQ7kyH5yzfvR++k1B5f4qP1w56GH2w/TD2Ie6jyc7HSSefoV9GvAY0kUUuwiNbanNapktasiK449pUS3FhvhiLspPYssVEp2pgT0P9IkX1UMP+8V/Lw6v10xnfxaijVNrlVJWfNeul/KryyuZPzLtxu10mxm0VDLQa2QsbfeF5uK0K/xSiGYcVJuKrOa8fhUaaGhzJ1Wsuc2H7rtZHuubvFrrXwmZYaOKWdqfx4LFkn7/wT92YEHj4EAty6jeO10EllF9O80rJQuuG4gqv5s0/1QnFoYGV0ji3Ffy5zazPIk97x9xNMlz3teAm71PDY8/HwKK6Kte0fsa/5ikeNkUQL2J/PiKvrl7JkzmU9nbNPjM2fOZF+wJVWU/FP+C9h08Qv0DqkjnpYSFcn+tLe5iBCxi3tk0SqWndbnqnQF1Xm6+tZZQv/bkwCqzphsTegXNfmu0pVOG81JaeeWzFW0uUTlg90Yi/XjzeuNS416PTSspfJbE7eM+MAgCYE6egEkDRA6LvxZPPXmyAQ3jC19Nm1vXdKt8lI2LlEPbQ50sN8CpLtE170PG7EAV0K4QyLnxfHCHKT2ZO0T30tEvE47FMjS1afocqioJcpI6eoCkNXt13qaYwBp9fDxq0og6U5xpVh6tiQSJftpSxdFafQ5QWVZvatqioB6oqIrl3TEasILry0Wl0tpXQqUMw9KviBJakpzXzsHhF73Tqd0zRS/IaiSoHUVVhYmPnf7CR8m68qvHnBwgufqdFGRxDDX7rRAKEnyVF5MQCswhj5xhBgO0bsGgihZbqEwm2f7qpIpFOYL8t8OtrdJkEG8MEpUQKL4Bq4wV8ikXsg/KECm4H4SSzvjYCF8U71y1H+6cbhmnZtoHHHevKk629tx8D5JHrjvPtifqkXzYG2oa82oO4lzuvH3hOiiG/BkIqG3KZXqtJfZFlkEgRq9ydLFdDYRzyTINepUo4bj5XjI6iunUIgeuWv5LpF3XPW7Tx7P5JycILVzhbOXVk5/r+KL9NjotzQZl1S/qJUez+aKevE/o7eSA77DvwFfPbJmmJImiBsluCo69y2FF+9aucz7Nb2cz7wCrvG1Epb09DcSWvcH6A+SWLoiMthldoP1uFZErAsuUYCjD87l8/c888w9ND23vb0FvfHB2XEBpKNfIGVbB/FI1+I1Vw8ssWiXKKWagFx2SOaAl1+jetObzu3TELsuSenPRCQ4fwT3deCddoiWyKkR+ye18K0jugiUiP1arHDkxBowZpgtUBwzdKLvihczrNOwinXqKNG7LKloNhuIrCG/Iy2Y90oq+/oelnAHKz+ipdEHFINdQAq+rODHAVWzqdeKCrvIo5PP8oC68XEN8yzqa8qNJ57KK9IJW8Y1XddHv+eoytdkpc4rmOdnsPiv/T8VJYEs0XKgj9uGdsfWF4JBiViwOsaeOJ0sBY16C5VA1ysLADQTVRTq1TrS/2U5Mv6q1KkBuLRjTDGFL/cBXdaJnoSGO4SYLBqxgRJvBzdNf9TAT8djzUNvqa6uVmU5N9r7a265mqlUjlTEy7LpCKyUdfEVDe0dObvK5kZ/hfr18F3VlWoVcN4V2c/xyDakKwfr8cNziYw8Q1bJGK+0Qq2ihF0il4RRNjurVVEgGotVmIChSFdhQbvBqBdU12u5TCZXW6+OhlFQXkLMUhlEvSaKRvsoG0G5osA5UTRfW7oSlZdq89EzfjWKqtNxw0Q7kY1xIaYezi0hAp5fE6AACCggw+F2r9+N+v3RsFvI5yKQ+vqFQtBDvS0QF0BgOLocXdsi6SQeep+upU3QOkHp8RJjbuJ5MOzv7PTnT56c7/fpigSA1rZ73RP3nYjmzl85P3cIr7YAg8EIrTXDztrY0YS8jEatNaUtdBM/9HYnom4xrXYDDbKh9Iz2ad7i6K97iNfcmp9fPL2Y9/38ifnCsvZmaTZTWmaXdvN+1v1ljvwsSE4xfyn1jBRmy4uLZbj+zcZKsHAi77vFpXJx8aDPvsTodG1awIfUK4dap4D7REREcAHmHPwUx/N3He08cvU7H+reubj0g3ddfOvF8Gyn8ANeubxULkevfvkjrU53cfHi1oMXnjvfzbfP1kuL5fJiiZm2HR2OC4ujy5IIOuJWItBln+PQORppRpcBucH0bjDb12G+bO/0yMJXQBL6A2ALxIvvRWJLnZs8MvZAoAKSQ7wwggPHi8l8+WX069SWRVfxi7WpZEFcYqkiGnEq2AM9xEk3rKFOTcnJsmZbkp5SkZ0NcpqsBqI4+3Al5zjtCxfloHVHs3kH+tDMK+ckLGmapAf5jMWqjiabdUlw9Uru4oW24/xKcGezeeeU/LyPfgPmzxKR4xD5/YVwmQOeYfDYFel43uDIiiDcJOQbNzZIdTmABht8p9WmTuUGR37KgUMfkcWgJIsp21V9X3VTtsbz7Btv55SgXE2FYapaDu5rNBvw+Y/jMx3dy+hOytInZ1acMHQq5QA9Y5RSooFTmswKAgvNTylIUrZEM3BNTpI40w2eC8jNGpfHZ0qcIHCSZqXl8ZkGUU0YbjC9VoFCbbm4RVzBNlCnxVVi91ZoMcyv4zNH6sLDV/ZREI36//3cwiUU9baQnlo8e0m4NNqP5t6HAi0cz7MvwBirkrgHCuqA3ISx+cpPVoohIi72yHIx6HV0CWXuWf/M0tLpzLMcWe/otP9ajnutR9c+KsvyegCZYF2W6amQSUHRIb5F4qaSVUejeIGCyS8WxOG2xEKGGIztdL4wU1uutIO0pCimYVspw9ZA8N3cLDtoyPMKgcPPP3LbgifzgqRoluNli5X63HKUnfKri5959J/yVDeKTXMtWkaDOahjzT9WmT4vwD9fCwuzal/27CCVtv7RCg5FeM1+vibJiq7u1mYK+XRKn2DE7cNxGR1iryezHuY5IaVhAr36iBntRs3rTZjhA/i7fj07oH/bScDaWMc0TGx09He/Yn/k2ELnEM/bCA+uE+RGkl8ZBL3eTW7AQ6KE2utP5tzvoefgfiUSmebQ+Gkquq3Gawkd3ufilQarjRAX0a5bxJplZR1c/DnI6qYVpHChc/4NftV5xZtf4VT9N6Dniq6hcayg0cWRJtnRR6/crh49d+6oevsV5sC3rRvb8FDFjyohCm4w/S3E9FGXrIx+sK6zBm0PmBpIQARvT0dG130YCRtIwNQBYBJcQsQJkFX9sN3xjcPL5PxlI6teNVaRelXNNkqrPxIbvz8b7/1JcnDKqPLH8ZG74yM7sV4sHe+dio8x0/7AMo1cBqCLOz5Z7xxkG5+sPgpzorvzVGEwKDy10z3xpnu8N7/Zu+dNaG/HedMntrY+8Sbn6pvNh99x4sQ7HjYP8VAZti92j6krb3q+eevzb3n2Lc+dPHMb7ZE5Thzu4xgGH+hrOvnhDBpd04pjGvp7mVIpcz8CiocNDGTvAdhHHzuNzghhVs82hDNn5FzRzWbdYk4+c0ZoQGE44UHUT6RMvJMcGqqTROwc2pxEYQVgoh/7vMfzPI3pYLwpgwNz2QxuSrqj3V633+uDHMdjzBdWilObnI4YVXXKZefmlKzdX/67fn+XlRVRNg1FdN3JVjFg67BT6yiO5+WLeSxHh37pCc3cYIAb3+yiHys3+9M2P56sXYhAKAgnniQo2L3B7KKt2CEZDcleL3YKIZcpyfu/xrxYHDqNPT+I0KlQe810xM443pzMQHR9t79DvDWy19H1vR6QqO3daLeHdokWsU881uhKnN0g+ZuKoR9H79LeuOnXCYkrQeyv5EY9GvniBn2ywgpaIQb+gPoS7O+j3aK7G/9wIWyiIMo2s8zB+gD7h/wHoI+5Go3LiFrJt4t6AFCj6/SPhsxfH13LxmsZMy8ZN4eSIIPpPiGhsdT1ja42tL0zQINhD0hpLBLTxTpiKfiAr9O45U41XF1GVJWULEm9SmUvt2aQJZPrUMnPcliVOc73ta5qRLwo4b9oS5dE3kAqWeOUT6vKOdcyVOtjMpb3pNerkrKzlzznq+grdM0Z4v20WkQ06IxoKNP0l25ImAogCqCI8DrRuennZIOpB43+BzFYTp7kvuze6Scd6Nn3QbqoMk3mHuorg1s0rgjXO94GILUOWS0fACNdLr9ElqZthz6pkoGIto3oaqI1x4v8SosMYxKP6Mc0hWiZTyLfE6ii1U80zCwTpBtmyg1GzwdOaKTSAeJqgqZ9QcsINV7VviAKiv3zn5cwV+NM/HlJZGusInK7uo1GPTKgcviiojv6UHdcYbSnYe/fqtIQa+jRiwgDqMMXfuCClJoN8cXRN6/CPc/Bva/qGf4cqw7PcQZ+HGMOttJVAY9+U+luAaG/lM5xltrTHUdfkux0T1IvrEqqymixnpllqPR1gjnD3AF99BTz3cwLzPcy7yarQSNgoId6y28T98Iiaofkl7EM5K96RELv+F57hW2IJfLje2vtFeg1DGxrmahKThFIHLo+Ib3EanGoK+NFxFuhL6ajEvn9vrUGyPtt3CQXd6iSk9h6TpFAuI4PYvGt/fs3Zv2ubgG+UdVCoirwLM/qaVbhWC7j8RwvoZDuFFLLV7GOUtpr25rA8XZ9HlmmrtzXEnIHff/qHEiBP1FnOcVIV1Ue8RlRSEuLmfyrFjlRWc66eV5Hb8wVTFNDb7yAU7MNfPGd58lWuvins938zN3w/ahWYkXdslRs55/ikISwjESWn197isNINvCplNF3oqu3GabsL5cvXWZFXnrQsd2tO4ESXnLDQkiMT5s6EtHsiSfgeiQdd1JvVpdOWZKZrhwN5rV7NIF/9J67xGl9zDXqrQjzPnaf7rgEYgIBiH9IBbfIT6LujgZLC6Ul6JCl6pEm6i3NFxY4nY8KR9CFV/2C7OgBh7luYKbVeA8efkdeTzMCGSuJL3UAGOZOKusQS1Ucbu1O2RlcXOv4N6vqxkqpIvmZv5pPfiqSeDs2ThEGCJUF8BPBQEJBqHnYv3hywblA44h2veLrmsHrdmkekt++XLinzNm6VZOQgKwV1z1iQ0au2brNnkqLbewg1FWks7tRL77C7d25luQIUc53Onm7ZmKZz8i2ptlKFuafOWOtpkqlFDqQ6QaUL1K/IDS1GhZZqwJH1L+/wsXtC1HU1YzRrql0+fpy/RVd3s94r0KBbymfkU0WDQwtCFSTVEA1jAdG/0s2dGXy3v4FPCdPfoOnehIla56PDZ0+XQW9tYzQE++UfsitVNwfqiwVi8Xj7/TKbOUjSre0VGr7pZL/rXa5wlZcv5Tc85vos+RXZ1GioCLaJBIjD7JxvCG/urCM6FLuCV722x0Rt9E3nXypfHzz8qUzunI6Kh6RZUnTK/Npz/H12ncc5zphekYv59RiDr2nkNY2T2zW5+fRLJrJI05sVpGK9Lk1b7HJqkrYsQxsVVPcVCximowZuhJG8gMsibcriv4xhcxYzo7jgk7chKAnxj6gGySKOV53zqQZqoRfjZXxxKhAEBja23jq+ac2aLIXRwPtLJbWFhfXSotFt1pQNAFjpe5YqbTpYsWW1WLVLSLmVHLNxlP/Mw7i/m4sUGd2XjBljIXORniU42+v1mZmszWOf7rVhPtMxbt+Av0KI1Fb9rdbYeafXsvPfTtVO/DtKVD9X6zQqk1+JJTM4Tg+DYaJH06vSkvt6xFxE5v8DIU6UBQN6qkpCgqoFxh1EzPVXRpzpprXOoKjkqBl1RE6B/1C6IpN40YJt/X8TmzwxjWyZkxEAx2J6EZGSyf6IWljNr9sLfjnZhe31nDrwYc+/9C6cuJQGQoaUcaL8qXZcwvb29F2uJbxVgtl2Js88y/Rz8TPJH5pPrFGx17X0EanCjOF2KTjsDcifQlLW2ti+6GHTsgbs7kj1kL2XGGxe1MJ+unZ8wu9XriWddcK5dFPTu8dtJX0tUj8CDqx2Xus7hoSpfkO+UXeAXEmaBK3gmmfU4LyFgDFnL41njkksREUrdJ4Xpe4gU7inMY6p5CuMETVK+3OYfxOfzXvf9d1PbFtU2Hcz4kdO7HjxJmd2M2SNH/saO3SNEmblbKtdARVLGmZpq2CAwgJGpVDNWlruXAwGjuQHTgh0Uj8uew+USQuoO02DlRICKniz2WXVewCEhx2cnjfe/njZEWKXpQ4tqwvn9/7ft/7vt/PfYQkQYJgWBLcfwVJ+p0yfrZPhVW8LKnhPvHf4DRDEjLNWjMDeTI4s0tZrd9P8UYEprqIwTOjfGWX1ENlQE3EI/gQr0ftwMTGPb4zB+CGE1L2221jtGWDHJox34W0YhUYjUP7pC534EMOjagLk4ok8Sj46nAFwPDlAGJ2DYZrNxFzc8wPoevheWXdhTh6ktJccg3U0lLu8b5DCt+1HoxzQA7Vx4Toc4x8gBsFFgkFdmVhR4Ojy1y4T5RSs2yyEqJn1p3uHUsQ6FuPWd6eNppnVW1xbVFTzzaN6W2krF6+vKrQcXupbNWCUlEvLCwU9KIUrFnlJY+dD4mdn6s3r+fSaJgI9SQGrolN8Zyo5mOxnDfB8Pe9e9fFtKqm1ZHf0v0ewBl0KY9OY7BSH9v9qbaeIMMEqZWqgaDmy3WOCb+76eHl+IZov5+Mr+IeFsi+eauke+CvFWAWoS+QhT+k6Aq//Tb42lhZYby1SQHqb8iO5WJ2gSsM9UfqepyU2JAyAEjzPZCqEp5hASNRDwt9kuTl4PyVROLKfFDmk4hpuscor7TbJlXs6C5ZJbZs22W2ZHn51xSS4Zk54QmtQCsZcYFRWzNJmgOvifdZPJzZyGQ2rsPwJs3TVKEx5scuYuA5ILd4VMwXisVCvtjUCJL+1jQBX8p9H/b24tO6wyWi5/Mqs34CFwKGs4POfNKdP1iZAOxBXGePfTH5C9Ig6ZCbd4AwgYhzt4yW2XJ/5QNgrdmtrX3HeTj8cOA9sgWC033xaXShTXUxqg61smk6LZBJCQomcGEJUGAjDHPQf6A/sa8DdzdBCRqeA6GNr27jIPJ+XhB28F8WLQlap5PvqOhxPqAJO8+QUxIef1zoLMIlcEzb62H8Azq2LzEt5irz+kRcwdlELg0HUDZdmKwA3y/dpjt/NhFmwZAFQqx5i9erabYMgbZNCM0QbAzW0+QoyzT2OnuNxu7dvYb7aDPF+3leM8JK+t3l2dfSihzm/CIXVkVxXQxwvJ/j9YSiWzzn5+PTP0BKfup87eiFV2K/rGZzaeySDXytvbu7eHj5KYvCMmLR3LlMkg1KWkgSIoGEHa9PxY9YFqMcHAb4UCTCbkpIi6btyvLF91JC8salypkPDyQSn/DDfBbUareYTaKHPG6NScLWyiKYZgb9v2noL7JzeCIEy5AqCBt7TyEGhhnaZaho1vNEWNL6FIetENPl8Ok3Fuy1KTkk8z7RJ0UEoRGAXJ0fHzT1GO/3cfrpG5f8HIsRX929/3b14k/LqYw55RVgQ7OjkM/98mdWlhA6U0kaSAzGgpKg+PScNp849ZBlw2EIm/C4/v3XclQ1jNmdt566/5jvvFja+CokjNe1Q550TIsvR6uUPHPsWvZqdvWj7FgC97tbmQufJYYY4At0m3BMxwNwOvog+ymcg24njm5lzv8H6FYYzAAAeJxjYGRgYADiiMOTzOP5bb4ycDMxgMCNg7laMPr/r///mdiZQCo5GMDSAEd5DAAAeJxjYGRgYGIAAj0mhv+//v9kYmdgZEABjHwAXxgEPgB4nGNgYGBgGsWjeETj//+JUPNr4N1JyP3E+IM6YQQAtxYMDAAAAAAAAFAAcACOAOQBMAFUAbICAAJOAoAClgLSAw4DbgQABKoFUgXIBfwGQAbCBt4HBAceB0IHgAeaB7AHwgfQB+YH+AgECBgIKAg0CEoIXAhoCHQIwgkOCVQJhAmmCfwKqgs8C9gMPAywDP4NNA3+Dl4OpA8ED04PkhAIEH4Q1BECESQRpBHkEfoSUBJoErQS1BNOE4wTuBRgFLQUxhTYFOwU+hUaFTIVShVaFcYWNhZuFpwWuBbgFwYXJhdGF2YXlheqF8YX9BgsGF4YphjeGQIZGhk6GZgZ0BpgGtobEhtEG4Yb0hwUHFAciBz4HXYdoh26HfgeHB6IHvYfPh90H6Af4iAEICQgWCCSILYg3iEGITYhbCHcIjwigCLYIxQjaCOiI9QkTCR8JKYlDCWAJegmDiZAJmgmkCbAJvInKCd2J7Yn5CgQKJgozij0KQYpUCm2KeoqJCpmKpQq6CsmK0orYCuiK94sPCx0LKQtHi04LVItbC2GLcot5C3yLmwukC8CL2ovhC+eMAQwaDDQMTAxfDG6MhQyPDJSMmgyzjL6MzYzdjOiM8Q0EDRGNHQ0kjTYNVA1eDWuNeg2QjZqNpI21jboNz43Zjd+N6A31Dg2OGA4fji8OO45Ejk8OXA5pjo2Oxo7TDvCO/Y8IDxqPIw87D04PXg9sj3uPgg+aD6aPrw+3j8cP0o/bj+gP9pAHkCSQLZBPEHSQfhCCgAAeJxjYGRgYORjmMIgyAACTEDMBYQMDP/BfAYAGdsBywB4nG2QTU7DMBCFX/qHaCVUgYTEzmLBBpH+LLroAdp9F9mnqdOkSuLIcSv1ApyAM3AGTsCSM3AUXsIoC6hHsr9588YjG8AYn/BQLw/XzV6vDq6Y/XKXNBbukR+E+xjhUXhA/UV4iGcshEe4Q8gbvF592y2ccAc3eBXuUn8T7pHfhfu4x4fwgPqX8BABvoVHePIWu7BK0sgU1Ubvj1lo27yFQNsqNYWa+dNWW+tC29DpndqeVXXaz52LVWxNrlamcDrLjCqtOejI+Ylz5XIyiUX3I5Njx3dVSJAigkFB3kBjjyMyVuyF+n8lYIflmTa5wgw+phd8a/qKxhvyBzUdClucuVc4ceacqkPMPKbHICetmt7anTEMlbKpHahE1H1OqLtKLDFhxH/8fjM9/wHeV2HqeJxtVgWUI7kRne+x2+wZz+7e5UIXZge8YWZm5kTulm2d1a0+ST0ebzgXZmZmZmZmZmZmZiqpwZ59mffG/lUql0rFW7Wt/K+x9X//MEAN26ijgQBNtNBGB1300KeTHexiiD0cwVEcwyk4FWfDaTg7zoFz4lw4N07HeXBenA/nxwVwQVwIF8ZFcFFcDBfHJTDCJXEpXBqXwRjHcVlcDpfHFXBFXAlXxlVwVVwNV8c1cE1cC9fGdXBdXA/Xxw1wQ9wIN8ZNcFPcDDfHLXBL3Aq3xm1wW9wOt8cdcEfcCXfGXXBX3A13xz1wTzBMECICxxQzzCFwBhaQiJFAIcWZ0DCwyLCPJQ6wwgncC/fGfXBf3A/3xwPwQJyFB+HBeAgeiofh4XgEHolH4dF4DB6Lx+HxeAKeiCfhyXgKnoqn4el4Bp6JZ+HZeA6ei+fh+XgBXogX4cV4CV6Kl+HleAVeiVfh1XgNXovX4fV4A96IN+HNeAveirfh7XgH3ol34d14D96L9+H9+AA+iA/hw/gIPoqP4eP4BD6JT+HT+Aw+i8/h8/gCvogv4cv4Cr6Kr+Hr+Aa+iW/h2/gOvovv4fv4AX6IH+HH+Al+ip/h5/gFfolf4df4DX6L3+H3+AP+iD/hz/gL/oq/4e/4B/6Jf+Hf+A/+W9uqoVarbdfqtUYtqDVrrVq71ql1a71avzao7WztsigWyYilKWeaJSEf5IxQSclSsybjmCfWFOJhZqyKxQmu+zljxhOuRdjJqbmKeTeHUiQLU+CYR4LtFDiTVhhheaEg4Xap9KJQkLJZeZDKbCYSUx4oYwuTDLdWJDNTkqRrxKTdOUyOT6KPd9Z0YZZVSpYmZoZr02ByksU9JsWMnkrP5rqTE5JPbQETlZACD7WYzW2bJUyurAhNk+lwLvbJdVqr5ShSyyQ37BA57qzpQtJp35AsyVLS0cWRv9Gd7Z5Ej7sbjF6Os9Sd9DeJ8V5FRVkqRcgsb5WsbaZtwJZMRyaYsHCRpa2JUgv3u7oDe5MsikSoEjNioRX7wq5OWbMmk1RzY0ZSzdRpG2xCq/XJkfWJS60sISW7a95U6Sw2ww2GFjyJzIbITKssNb01I4035DWnV/FNeatSis2G7VbT2yiBWpNMyIhAd5IZkZCFMUsGJU4pH1TSL8mlosNeyCRZw7RzSaskOiGLuWaOF+SQvsiltk5fTszymdKrTjgncsQ0Z+0cTtxvPaJi4QUzFYSkSCeK4tAIpQoX7jOLBqGK+MhY5u6MTI8KVWkSDxdUjPQwqymbRy5uuxVF7nThHFSMlFGir6VTyVY7FUW+48wOK9osyAzSd/QQp9C5VzH3lcxirqbT4cmspB0xM/cvaUbcLCgUzUiYWBjTcukvFYs61BvIAUzPeN3BPfehnIepwvIa3N1kuWIYbjJ8xncLzkTJqFdi8vTiWEF451Upv1NxE5cNlcK8vblA9AsOP0jJ4aX6OZdpeSKSiKwbVhQ1EBsrzatzS+aFg4I6gzSL6ap83ULYcM4Tyq1Fp2BJW12q5Ehb2a6oUonKrLuz9EdKjXumWTofVgxDzc7yA3uYQw228sqZmbL81ILQPFb7nCIaM99TS1vo9lIDFYKUZCulQcmxWiy4nVMdzualWssmkpeGOQt8epZPyGR5lJHXtEv3fsVwk6JUsy8irto8ZkK6eupUaNzwsMcPQq5TS4J82aJruKbu25uykJetqlUSrSnnkcvfYCokCdanks16+WNHzNBNFZFFQnULgqJvBwWeMSm5XpVyIqbxVBLekf2CoLK0mSmP/CsajjCdmVIzSU0pM+2ZFpE3PMh7WDBnNFx1Y85d452LiIIbkAg9oiaijr9tFGqV9nKYP+NYQVCPoHmrxQnKYSaPbHD3KRMpzeUw51EnopT3U2TvECefFZus/E7jLOiu4bjjcv1gRO0sqotkqtqU7dalXhzQrkBVTV8rSs62uyMfitJ9TjI5IWTycPWolzErlJ+CrZIYuA63rswgZto1NL8yjIqB2i0oF6ZOjl09F0IRnzJaKgYFpcLMbSzDnBSugfhpxQuOoWHEIjPn3Ba6XLoWV+T5F/MZVRXN+RZpypy57RKMK3S87lAnFi5CTrgZC3KJ5Q3aJzLTiIm1qrv6aiY0FchfnWLXoUILEuXDnKhWymRsNeftlNHMca2/S98+k6j/NbzqgWvU3pHeB2vS27tTrEojX6Y8arls81aXYFz3CZgqbadKUq67dapI2rYfznYuTCvVKspCa9q0EEZ+zatrHqkWCdDNqdjW1LgN3RJlkvdNSFYnKnVRNIHhLlhtQ73T71udCo0bHhJDcOmzO8hhYCSZbzo0d7X17wxoNkjymiFDt42iI0vDlsepXXU9pBKQPGp7PGdyGlBXDRerBrVtzQPfhOw2ubpF/35qdi3ZLigWgsm2C7RfMes+5HaexRPjF7F2gbO06xRy693WLHDdkp1dmhSJkT5pG4TNvGuXwlJ65aI5rlODU0dpraEiNIxaVxi61cdtbCczA2p9lPudLI1YvqMGOaQvNxkb+y6t2z7E3qMVGq/hcYJGTISkPapJczmh5NpdcknLFamMIv/cilFu83slQ1LUaCcn5w1LlitVvyUfKzlLEc2cR1y+r3+61G6zntBS13fzJV/xXNJVVHOV949t+t7a+h8qJiExAAA=1

link
stylesheet
https://blog.coroico.mx/wp-includes/css/dist/block-library/style.min.css?ver=5.2.4
200
text/css

1
ok

No Cache-Control - header
GZip: 4767/29295 Bytes




local SRI possible, possible hash-values:

sha256-S4/lw9Dl73plghhcv1xTW102nI3x2pjAPtaYM+VfR00=
sha384-oBuKSJ7gIx8iF7rcdUjzv0wVT3ytAqOVsSQeU+kUnaNxSXidSyM/t65dzyROItR1
sha512-k4ARx0f08DbXZikHs4jFmF0cMgAUUwPmRkN7FDqdr8rZ9fdDFJK77Mt1WRbgqIQ8Ci9Jo1mb6P9RvF6yxkhCag==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-includes/css/dist/block-library/style.min.css?ver=5.2.4" crossorigin="anonymous" integrity="sha256-S4/lw9Dl73plghhcv1xTW102nI3x2pjAPtaYM+VfR00=" />




link
wlwmanifest
https://blog.coroico.mx/wp-includes/wlwmanifest.xml
200
application/xml

1
ok

460 Bytes






meta

UTF-8


1
ok








meta
og:description
Blog del Laboratorio Clínico


2
ok








meta
og:locale
es_MX


1
ok








meta
og:site_name
COROICO


2
ok








meta
og:title
COROICO - Blog del Laboratorio Clínico


1
ok








meta
og:type
website


2
ok








meta
og:url
https://blog.coroico.mx/
200
text/html; charset=UTF-8

1
ok

11234 Bytes






meta
description
Blog del Laboratorio Clínico


1
ok








meta
generator
WordPress 5.2.4


1
ok








meta
msapplication-TileImage
https://blog.coroico.mx/wp-content/uploads/2019/05/cropped-COROICO_LOGO-04-small-1-1-270x270.png
200
image/png

1
ok

No Cache-Control header
No GZip - 38026 Bytes






meta
twitter:card
summary_large_image


1
ok








meta
twitter:description
Blog del Laboratorio Clínico


1
ok








meta
twitter:title
COROICO - Blog del Laboratorio Clínico


1
ok








meta
viewport
width=device-width, initial-scale=1


1
ok








script
src
https://ajax.googleapis.com/ajax/libs/jqueryui/1.11.4/i18n/datepicker-es.min.js?ver=1.11.4
200
text/javascript; charset=UTF-8

1
ok

Cache-Control: public, max-age=31536000, stale-while-revalidate=2592000 - with long duration found.
GZip: 544/888 Bytes




Server-Header Access-Control-Allow-Origin: *
Cross-Origin Resource Sharing (CORS) supported

missing crossorigin=anonymous|use-credentials and integrity - attribute, possible hash-values:

sha256-zSPceStwQmBlpR27udDyrfq0GplUtQIQ4SHIqSk/qi8=
sha384-S6fcDqqNFTWtPaiLo3KC7qIs13WQjZP6/X6klnU36GhdHzf//yIYG3cxjFH8DnRL
sha512-blwzxJ/aAeMToCncUfhUTL8e/K+dQGQmH4vkYWCf1BeBX+4UwPBI5MR2ctO4VzMee0ODJjQnNzVPDPbjelLpuw==

<script src="https://ajax.googleapis.com/ajax/libs/jqueryui/1.11.4/i18n/datepicker-es.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-zSPceStwQmBlpR27udDyrfq0GplUtQIQ4SHIqSk/qi8=" />




script
src
https://blog.coroico.mx/wp-content/plugins/contact-form-7/includes/js/scripts.js?ver=5.1.3
200
application/javascript

1
ok

No Cache-Control - header
GZip: 3993/14440 Bytes




local SRI possible, possible hash-values:

sha256-t+F5JrMDQu3s7os6kwKaxRRi4rR5J32OB3ulcXPrGQA=
sha384-T6rgaNpfFeTL0NpWgcafGckCommecxQeEegXB8W+PvXBhZEhRsC4XIF9V//eOSPq
sha512-Srz/5pqiXStjZUsP3SwZeDNahRyTHQXq8qkr1uD0OieEND49eF/0XCYsKcIQcd1MdmG1DaUwXsdPRwLzxrQTyw==

<script src="https://blog.coroico.mx/wp-content/plugins/contact-form-7/includes/js/scripts.js?ver=5.1.3" crossorigin="anonymous" integrity="sha256-t+F5JrMDQu3s7os6kwKaxRRi4rR5J32OB3ulcXPrGQA=" />




script
src
https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-sliderAccess.js?ver=5.2.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 1160/3052 Bytes




local SRI possible, possible hash-values:

sha256-hFyH6QhCxwFJVGfWdhU6laC8aeRgE6dtJkFouikSeIE=
sha384-lMnyhpVQ3ulACZ7kcxR1+fzVZT7Y8HFd+QSAKpM7jJQyDTGfiQp6KKsF3en7I6my
sha512-f3j1bRPjN96hT0xRuhL1Uw1t1+NMffXBvvyblHlMlz8GDL3UZtRzuk/dcE0dP32A02orGIvPRX0p7yXCIuAxQg==

<script src="https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-sliderAccess.js?ver=5.2.4" crossorigin="anonymous" integrity="sha256-hFyH6QhCxwFJVGfWdhU6laC8aeRgE6dtJkFouikSeIE=" />




script
src
https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/i18n/jquery-ui-timepicker-es.js?ver=5.2.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 339/583 Bytes




local SRI possible, possible hash-values:

sha256-A8pQbwjU26hLDjDtf8Rfzw6NrVsfjgAyF3JqjDMwJbc=
sha384-HdHNV1OgrVOvM9+HVyVvt/Hgh1MLq0cGgpMLR7FcrpI8yMBAAhVWS3IFFHh2oF6q
sha512-C4EHi6kpsiBAlHRz2qgqTva8LCG3Wj8dBexSUpzSNkvxLmmAiet9L71YQpupLyvQCAGC+AAfW9koOVJ4QA8NnA==

<script src="https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/i18n/jquery-ui-timepicker-es.js?ver=5.2.4" crossorigin="anonymous" integrity="sha256-A8pQbwjU26hLDjDtf8Rfzw6NrVsfjgAyF3JqjDMwJbc=" />




script
src
https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/jquery-ui-timepicker-addon.min.js?ver=5.2.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 10101/37820 Bytes




local SRI possible, possible hash-values:

sha256-9mjjxCzfN6wV2SunlDIItLDRn4AQcFyABZ+0cKOSDN0=
sha384-1w+NGz2r5t690MHGyaQmQ6vpURNVRjQIiNRTLPlzGcFWGu6dKMk1C/+kVehwUVcp
sha512-e7dpjeHAdxz3A2pjFI5uRh7ayQBWMNi2QCkKL8+2ZSGVhz6jIKNI9LMDmEWaeLi/jOZLHYpXPWhOlyJS06BfOg==

<script src="https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/jquery-ui-timepicker-addon.min.js?ver=5.2.4" crossorigin="anonymous" integrity="sha256-9mjjxCzfN6wV2SunlDIItLDRn4AQcFyABZ+0cKOSDN0=" />




script
src
https://blog.coroico.mx/wp-content/plugins/google-analytics-for-wordpress/assets/js/frontend.min.js?ver=7.10.0
200
application/javascript

1
ok

No Cache-Control - header
GZip: 2766/9298 Bytes




local SRI possible, possible hash-values:

sha256-Y6bZJtJ3o9ZNMONJ+g6isGMOmAHRc+GUf/O9YGAUfvQ=
sha384-nGGf6PqT4D0Ul0Ppy0nqLgLNwuxkh80/Jv62cgP8eNydmCDsknAq9i3qsJVagmsa
sha512-JbsJvcsUr6Os10yxNfbtEgqwZyEIesmFdNEID/wDlYPH0VBCxXfnCGopB0RrIeDEUTVnnF6mJNnOiP6P85YKNw==

<script src="https://blog.coroico.mx/wp-content/plugins/google-analytics-for-wordpress/assets/js/frontend.min.js?ver=7.10.0" crossorigin="anonymous" integrity="sha256-Y6bZJtJ3o9ZNMONJ+g6isGMOmAHRc+GUf/O9YGAUfvQ=" />




script
src
https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/js/social-icons-widget-frontend.js?ver=20170209
200
application/javascript

1
ok

No Cache-Control - header
GZip: 290/860 Bytes




local SRI possible, possible hash-values:

sha256-aFPXKaZ1k3OYYNOZ3HPiE0DeT1e9p5zJMPU25CiWe08=
sha384-1/RlpVhAlyDwUsWyoiHB58zll6BetJXxRpMQJzbxWFC4gtF0WVUo1narl5W+fAoz
sha512-pvF/Dc1hg9XI+uqWb3qxZmA60GYARGN5GeRLPdmh3frjs25TXfvZq29h55JocG6iH1pEeSDHndKE0BvwPbmHRg==

<script src="https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/js/social-icons-widget-frontend.js?ver=20170209" crossorigin="anonymous" integrity="sha256-aFPXKaZ1k3OYYNOZ3HPiE0DeT1e9p5zJMPU25CiWe08=" />




script
src
https://blog.coroico.mx/wp-content/plugins/trx_addons/js/magnific/jquery.magnific-popup.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 7346/20216 Bytes




local SRI possible, possible hash-values:

sha256-P93G0oq6PBPWTP1IR8Mz/0jHHUpaWL0aBJTKauisG7Q=
sha384-fexNtx3nPE3sjIQuGk8G2X8X/aSEBVMC58R839hkgsY/Xjhvkm7m2otGhwrdESWj
sha512-IsNh5E3eYy3tr/JiX2Yx4vsCujtkhwl7SLqgnwLNgf04Hrt9BT9SXlLlZlWx+OK4ndzAoALhsMNcCmkggjZB1w==

<script src="https://blog.coroico.mx/wp-content/plugins/trx_addons/js/magnific/jquery.magnific-popup.min.js" crossorigin="anonymous" integrity="sha256-P93G0oq6PBPWTP1IR8Mz/0jHHUpaWL0aBJTKauisG7Q=" />




script
src
https://blog.coroico.mx/wp-content/plugins/trx_addons/js/swiper/swiper.jquery.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 21474/86923 Bytes




local SRI possible, possible hash-values:

sha256-Pl63iFzVinaVFc3QqrQvq3DimF1feP6Wqekm5jTabXo=
sha384-jlHgPeYuWu/jSv/itQ4w4p8/ho7cPFxC8a/QOWtBE/TRMomnkqjvfedCkb/foc60
sha512-kZuRlVjyG3pnsZyFvfSlIeXQDOWRvZQo4+81+g+dybUUUHTgI9vtr1259r44u3X5cmlOP3+x5oSeAaMVfE1fyg==

<script src="https://blog.coroico.mx/wp-content/plugins/trx_addons/js/swiper/swiper.jquery.min.js" crossorigin="anonymous" integrity="sha256-Pl63iFzVinaVFc3QqrQvq3DimF1feP6Wqekm5jTabXo=" />




script
src
https://blog.coroico.mx/wp-content/plugins/trx_addons/js/trx_addons.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 19522/80844 Bytes




local SRI possible, possible hash-values:

sha256-8sOmbAjXhBHtMGKT6Q5m2V2t8gGIniSDjz+M1Ld2Rss=
sha384-ByxGONwxXk8kx2iACT/6ROIkxbiiNrdZJHaU8sCWtJGwOQvGQvUtirfGwx0dzzzt
sha512-9Wnu8Qr5n79pCs4DvPVlH4OgLIkdvyP7R5vGqOFzS7S4xsHWzmynlGGl6NS7/2/SgKAVp4Q5wO700ver7Cr7VA==

<script src="https://blog.coroico.mx/wp-content/plugins/trx_addons/js/trx_addons.js" crossorigin="anonymous" integrity="sha256-8sOmbAjXhBHtMGKT6Q5m2V2t8gGIniSDjz+M1Ld2Rss=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/fastclick.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 2617/8756 Bytes




local SRI possible, possible hash-values:

sha256-oATEZS168zttj41DEh6tMucnbn9bF5GrmhQXuFabz2I=
sha384-Ag78mqJL1bkVJ0/oeSsQv8BBk/DSwk3rZfvF70IkjdyDOk3O3/p8smhNX8B5jDFb
sha512-HMKo4Z5/xJ3s45fdbmUQPbHOiwY3OdAoq29Jtb/iJ9IpYZ/XH90t4+xwAI8/CALBCtOBFueNCYwxrrk3RgdZoQ==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/fastclick.js" crossorigin="anonymous" integrity="sha256-oATEZS168zttj41DEh6tMucnbn9bF5GrmhQXuFabz2I=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fitvids.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 1015/2118 Bytes




local SRI possible, possible hash-values:

sha256-SAEwLh10f5vhChz2fCPPsZEKg73pFg3HHHAPXOQto3k=
sha384-vfKVW9+U0s23mktm+jr0jIwGilzo40EVOZMXWV9YCYztWeDeHc1VqfqfjnHfZzg7
sha512-dq9uU2ctgfZzFpE7zoi6fAILSyFwtboV4lIHWd8r5OrriJhaHYpmLAhVPAv96gzlft3IXl8PvxWolzzQxhRu8w==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fitvids.js" crossorigin="anonymous" integrity="sha256-SAEwLh10f5vhChz2fCPPsZEKg73pFg3HHHAPXOQto3k=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fluidbox/jquery.fluidbox.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 1592/4583 Bytes




local SRI possible, possible hash-values:

sha256-YXVEq9RXBolPLZNxn+lJZ0NGmnNi0NcdHO0AsStRETg=
sha384-lsOWql8/9Jgwh5DolifwyjUQyo3BPOMtEbnu8t0g85DesyZEP4LSh1bV/gFRfxrD
sha512-Z+9tF2NbIynHi5xQUrtQOHlpfBqJ3uxhucxZmuQg9hYNcnWzvI3jZrpKJW2cQ4Go28Ze585cs2wEsQc5WZTUng==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fluidbox/jquery.fluidbox.min.js" crossorigin="anonymous" integrity="sha256-YXVEq9RXBolPLZNxn+lJZ0NGmnNi0NcdHO0AsStRETg=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.isotope.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 9724/35631 Bytes




local SRI possible, possible hash-values:

sha256-f+dvxdhdTlsLfTLHyf+Io/ZVY0LvptKdcBNE/8dq+t0=
sha384-Jc/KA+xhXlIRHQTAIOQUifsFp3z7eN4RJiTNbNpKyMVDT/5GLM5hnsAuj+jBZs/x
sha512-B5QLNQ3jQzxOIkRGb1hPhBgjv0e254IlOfzbzrLT1bkK6dyATOKDJ+U4BYM7RS16SzXw/F+uwzqLV0uxaloiUA==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.isotope.min.js" crossorigin="anonymous" integrity="sha256-f+dvxdhdTlsLfTLHyf+Io/ZVY0LvptKdcBNE/8dq+t0=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.uniform/jquery.uniform.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 3477/9009 Bytes




local SRI possible, possible hash-values:

sha256-tv9qovbzF3CL8rM8LpWH0CVNLlIlITV8Ps3afTHgvtA=
sha384-MbfQgRYkbMYjeVeaWKZzw4qsNKFVQKVD+QmdUujk3livnVW1N3suUPWcAikpwMC8
sha512-C+PV/GRlvB9vO6h96Gx/hIgSX52KwvMaWt4nob9t+eQCXsyo2FRUbI97z+Cz3eKXLqY5lZrUleZBoU6yEtTUiw==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.uniform/jquery.uniform.min.js" crossorigin="anonymous" integrity="sha256-tv9qovbzF3CL8rM8LpWH0CVNLlIlITV8Ps3afTHgvtA=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.validate.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 6758/21528 Bytes




local SRI possible, possible hash-values:

sha256-joSzqjOpT7UnkBP7V1gGHveGoUMtK1vp8EZAQdMunoE=
sha384-uoitRwRkITw0d4QwtYUHdLuVwroCwWRUyP+XcYWpz4ioL32v9kC4HM9ROHhvZ0iW
sha512-/Xyc1FAA9gs7lbw0fRod4c/JCBa0neNWfcv2rNNZCyevxmazdcelZSzP6OKiSWrkQXXfQmiDG8F9Irzsj3OBYQ==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.validate.min.js" crossorigin="anonymous" integrity="sha256-joSzqjOpT7UnkBP7V1gGHveGoUMtK1vp8EZAQdMunoE=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/main.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 5230/18080 Bytes




local SRI possible, possible hash-values:

sha256-hGyshn1pPpI7XPbXGDuZX0ZL+ximYEa+hT0WVysdvN0=
sha384-4IyO8QgQJXhLw811EJsIAMIWqD98B/38o/aJOs+enfrYSfXPntC4F8KkWDfF2/i7
sha512-n5gTZJO0UJP2OF9XrUDV/JZjbdNPvQL5pmqv2hMCCXIW4afCHvUCKe/k3ahafIMCa0IPpomM3V3x1d+7yTqbAA==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/main.js" crossorigin="anonymous" integrity="sha256-hGyshn1pPpI7XPbXGDuZX0ZL+ximYEa+hT0WVysdvN0=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/modernizr.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 6309/15516 Bytes




local SRI possible, possible hash-values:

sha256-nFdh4i4MGxO2Iger+N827pouiwNSJB3LcLHLu+2uo3g=
sha384-FE6PFdIWdyXip9fiNUG5CGLLgP9OYKivyrdqp0KCQ14xJv31bvmxdduvVAWFJ91w
sha512-EWsixs9Hv68bimy1nXaKD7vzQoVOYna12xzBBw7mvh2FezF5BdtF9rld3ogWSmu4Pefb5aVO6k/qD8ctfC+Ntg==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/modernizr.min.js" crossorigin="anonymous" integrity="sha256-nFdh4i4MGxO2Iger+N827pouiwNSJB3LcLHLu+2uo3g=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/owl-carousel/owl.carousel.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 10522/40401 Bytes




local SRI possible, possible hash-values:

sha256-g1U9IszVblV21UT2upNHXHErPALTEok+6irMFt5fz5E=
sha384-fHRZ/BnbZiOVCdwRiM+FDEJNTP/eJCF/DwHH++AVtmMrdBRY3ia7WqFEy0iTiMIa
sha512-TcGVyneWuYD0/x//7H7AaZEFARFrgm4jZR6uTcixVKzECnQBHriq+2CzDQKTV7AHEWpRyQxD2EuRSWxQ1yTeqg==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/owl-carousel/owl.carousel.min.js" crossorigin="anonymous" integrity="sha256-g1U9IszVblV21UT2upNHXHErPALTEok+6irMFt5fz5E=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/readingTime.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 733/1600 Bytes




local SRI possible, possible hash-values:

sha256-l2vRp1WrB/4n9lAGi87HUXygXS+35RMVshGLy638vqY=
sha384-qG9JvBlOzjAM2miHuYUC7bVQIc0vumIm5r2bbKi+a5yJ+lQZG6vtaJHqVYwPVrcc
sha512-E6SDHnmrdwhWlWTJDbqadq5DBz89yfVBGCAHvQpk+6QZlIvzJ2NF8Zwny50it+qh5oN6JDsJnZaj7cC+xmQDMQ==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/readingTime.js" crossorigin="anonymous" integrity="sha256-l2vRp1WrB/4n9lAGi87HUXygXS+35RMVshGLy638vqY=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/responsive-image-gallery/r-gallery.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 4438/13674 Bytes




local SRI possible, possible hash-values:

sha256-WdnssW861hx/UuZ86Yg0/Ik02DXeui0Mk2li8DMaDNY=
sha384-Ce2zddRjBv4C6EMEmyjxNJOSeqS69y4ZBnDeYyK2rpwmWlhbiAJf9RwbOTKr+ZlC
sha512-Ho7rMA3JA+85KIcxQhejW5gIoV5ZQ5xiLS1eJXdo3wwQx6QSEfhcjuPzsyqYdOAOJyhMCb/B6XJEM+xE2LBFgA==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/responsive-image-gallery/r-gallery.js" crossorigin="anonymous" integrity="sha256-WdnssW861hx/UuZ86Yg0/Ik02DXeui0Mk2li8DMaDNY=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/selection-sharer/selection-sharer.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 2739/7552 Bytes




local SRI possible, possible hash-values:

sha256-opszFKmkUNgzH4cmb20N4987a9nl6uoFlT0YtqcSq58=
sha384-VO/E3t4YqAgDzmKt/VlEL51o2qTjOVjcn4bkHQdv6AJbGtctNgyj1Orja3VCmZZ4
sha512-QqS8UEAn/eIbfGtfK2Z5SvYTOiJM+AUCWqe6UYOwIV5g2o/VibRybR44Tk9b8oVkU/GlxI6h0l1RdHjH1J1o0A==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/selection-sharer/selection-sharer.js" crossorigin="anonymous" integrity="sha256-opszFKmkUNgzH4cmb20N4987a9nl6uoFlT0YtqcSq58=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/socialstream.jquery.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 1674/6132 Bytes




local SRI possible, possible hash-values:

sha256-yo6WjRiAMAANHK9CMM/EuLdyjILeX77Uc2qqpAjDOWQ=
sha384-Np9n5HnEHLRXvLIL41fKBaxQyGHQtJ8Ect3qpIO7hqmZE5S0qxkcIUsELZu5qKo7
sha512-Sj3KD+6CvJpPl4r3NnVYamHmII4fyEu+zA41OrNwDnRyG5/MI8UtEQlfKzjRkFE0OiWrF1yzOSDXRa/V4YnU3A==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/socialstream.jquery.js" crossorigin="anonymous" integrity="sha256-yo6WjRiAMAANHK9CMM/EuLdyjILeX77Uc2qqpAjDOWQ=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/wp-fix.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 113/131 Bytes




local SRI possible, possible hash-values:

sha256-XSDIT6H5giaGhU1sZRZGIaO21K/VQ+atjHzZI4Bpg2w=
sha384-UYdvUTJ2oE0nJ+HprsB3p0mZzvnBnfgY6xk3BAG4/y37WEiqmJG25FyvQpwlY8Y6
sha512-cmLx+Qyr2IYce6Eksn5oCCDsTw0G0Rz8YIqN6DwhkwjloiPZ4VTtDWpHaMtUYPmayzhLtwaUnvymS9qr8Sdy9A==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/wp-fix.js" crossorigin="anonymous" integrity="sha256-XSDIT6H5giaGhU1sZRZGIaO21K/VQ+atjHzZI4Bpg2w=" />




script
src
https://blog.coroico.mx/wp-includes/js/imagesloaded.min.js?ver=3.2.0
200
application/javascript

1
ok

No Cache-Control - header
GZip: 2551/8113 Bytes




local SRI possible, possible hash-values:

sha256-EeFfHWSmPLSY0NQnIKaI7RW/eDk9jEYNaVoRAkTAZuM=
sha384-iyvLRA+ulj900F1LFHVzVHMTaIwZ0CTlyrk11v1HsxGtzXScaXytDzs3lVgOeXVJ
sha512-zaaLwYFoaF4iXwdhK/IeK++n3kkqS4RdM9Ie85vDc40C94x2kEYtO9mlXFDEEcul/iXA1Ahh1HUGdC21YqPkUA==

<script src="https://blog.coroico.mx/wp-includes/js/imagesloaded.min.js?ver=3.2.0" crossorigin="anonymous" integrity="sha256-EeFfHWSmPLSY0NQnIKaI7RW/eDk9jEYNaVoRAkTAZuM=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/jquery.js?ver=1.12.4-wp
200
application/javascript

1
ok

No Cache-Control - header
GZip: 33776/96873 Bytes




local SRI possible, possible hash-values:

sha256-HbIdgWKW5pObofQpYkluQTSuKwCB4mlwhkxAxtArsd8=
sha384-ntp7teUU/HNBX29EGk78zfJdXnkzOhOq1gG4fdvWTbNnaqqq3mbIPK+0o7rceUiN
sha512-92bfaFtnNle99XVRNUwUm+ICQ4UQKFTSyjUel2aEu4g2Hq6EjxH3FObllzwGFECDHqb1vplbif1b0tRVmg3Epg==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/jquery.js?ver=1.12.4-wp" crossorigin="anonymous" integrity="sha256-HbIdgWKW5pObofQpYkluQTSuKwCB4mlwhkxAxtArsd8=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/jquery-migrate.min.js?ver=1.4.1
200
application/javascript

1
ok

No Cache-Control - header
GZip: 4014/10056 Bytes




local SRI possible, possible hash-values:

sha256-SOuLUArmo4YXtXONKz+uxIGSKneCJG4x0nVcA0pFzV0=
sha384-uQPAXWjjvZGmVjKnobPRQOCEJ0rkCNRXW1GBUsJkjw1w0K7TxLH6Z3zMX7wtx+Lf
sha512-t0ovA8ZOiDuaNN5DaQQpMn37SqIwp6avyoFQoW49hOmEYSRf8mTCY2jZkEVizDT+IZ9x+VHTZPpcaMA5t2d2zQ==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/jquery-migrate.min.js?ver=1.4.1" crossorigin="anonymous" integrity="sha256-SOuLUArmo4YXtXONKz+uxIGSKneCJG4x0nVcA0pFzV0=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/ui/button.min.js?ver=1.11.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 2082/7236 Bytes




local SRI possible, possible hash-values:

sha256-0mXyR+PZldJs8b7+mgKLGZ2YCa0h4CIOYDySrmwI2t8=
sha384-72FnTXmuTSYUqOWTRRlHsxDk9gA9nLmkhfV/huV5tH3HSclwGQ9g0YxYmfQJwUIL
sha512-ukKrt+E98M5e4LAB7wExH+LV86P6zczK+0Zvn2S05gYkOtoTyEtfbYTph89FaD/TDty3LrpWfqDbkuVTMHHLJw==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/ui/button.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-0mXyR+PZldJs8b7+mgKLGZ2YCa0h4CIOYDySrmwI2t8=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/ui/core.min.js?ver=1.11.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 1821/4000 Bytes




local SRI possible, possible hash-values:

sha256-k2VnvHROGZ4Cv8PDP+K8nIYpmeDUeeKmlKp0hUYKOWA=
sha384-I9Fo2588xRUVSo3b1Pm/eoGdXCW1i93g3QvGeOr6l3G7+aPJrovzFr8/AMgWAB9Z
sha512-oo6oxInumbASchdCmTO4SgfNC1PkpWZ1TXuz5sdiv3kJBSzuTeXvP80fgmPKiMKCGnWQzXyzob21RZnHnGq1rg==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/ui/core.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-k2VnvHROGZ4Cv8PDP+K8nIYpmeDUeeKmlKp0hUYKOWA=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/ui/datepicker.min.js?ver=1.11.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 11002/36508 Bytes




local SRI possible, possible hash-values:

sha256-/l0JATzfid0XxRHJCL7iYo5MD5tFUPgC/bH9UIaZnI0=
sha384-7EY8bIFU0KNRIza2x51N5eIoLDFijtdSUcTEL6RGj9Tc9+iYtjw21rXOt1Wlbxb+
sha512-74zAS7nKmH5dUouIkzAMLQU/sSyUd3yFNdzCnkJc76zARtl1Huc7LOuOjHulaZcZQnYEsSgV1yUltxMCAieYcA==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/ui/datepicker.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-/l0JATzfid0XxRHJCL7iYo5MD5tFUPgC/bH9UIaZnI0=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/ui/mouse.min.js?ver=1.11.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 1021/3148 Bytes




local SRI possible, possible hash-values:

sha256-iLA3k0mk3abrzEPFvRIITSMMYQWm/TwvZRxOdxs+q+8=
sha384-OIIES4oBHHWxjC+nUeU28R36Bkzr+bIJNLHd7h1TFWs8n6RINtnShbv6x5CvVKwL
sha512-xpA56jqcZT/mJ7UpOk9o2OhOw3TJv2hinMEZXH/82E3NXkRoI9+FC/D7D5pCVbKkupQpmblQFCUTvK28F+gD8Q==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/ui/mouse.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-iLA3k0mk3abrzEPFvRIITSMMYQWm/TwvZRxOdxs+q+8=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/ui/slider.min.js?ver=1.11.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 3093/10987 Bytes




local SRI possible, possible hash-values:

sha256-CODZE6ra7yAf0yAMpJ+pkaLY0Cs9mlRiESPXGDe7xz8=
sha384-GNfJeDdrkYn8EdHWzvh/WnyT2cMm1/GMXA4NMsLGgNCmvKsjud4lCiPvRYjcnzVD
sha512-Nrd+LeLO6knITOuWjMWwo38ykzFNuWmkOUEn3xiefV4VuFSI6lGGhGKb40gwSQTwcyIQVkCmIxHcC+/111XzyQ==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/ui/slider.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-CODZE6ra7yAf0yAMpJ+pkaLY0Cs9mlRiESPXGDe7xz8=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/ui/widget.min.js?ver=1.11.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 2599/6908 Bytes




local SRI possible, possible hash-values:

sha256-OKRI6eA6n2TnYRsZr0u47Jf94scI3FfrvHcBvnrjrwg=
sha384-F1GqOB8Uc6I2qzUhMZiJ7mdcpzLeszsuyT59UIPNxa/AWMhz4TblRgcwHdlr2w39
sha512-C3JkZioMICZEU9WOfGGeUSUZEhJfpMKHt9GiWHCaZx4P0V8fIVycZW6mGHzDIji1K+24nrXfLCCp4tRatspQqA==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/ui/widget.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-OKRI6eA6n2TnYRsZr0u47Jf94scI3FfrvHcBvnrjrwg=" />




script
src
https://blog.coroico.mx/wp-includes/js/wp-embed.min.js?ver=5.2.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 753/1403 Bytes




local SRI possible, possible hash-values:

sha256-IVJVfKxp4r19bevvUDep9VT5IJzDBbgUGzMprLEMQrc=
sha384-XnSFU7x9V0Dj3v7dHnqVJLtQM6R4foycfqhGECXJXDza0+uOB7Yrvhwc9smLjZkJ
sha512-jFyvvCzjcFc1/xExqzTCrveqUL8luhPwopwHcTVhsOZSLJNZbIBH7DMuf6mFZaneVs8EBjIUmyVbWNC7xD+6ew==

<script src="https://blog.coroico.mx/wp-includes/js/wp-embed.min.js?ver=5.2.4" crossorigin="anonymous" integrity="sha256-IVJVfKxp4r19bevvUDep9VT5IJzDBbgUGzMprLEMQrc=" />




script
src
https://connect.facebook.net/en_US/sdk.js#xfbml=1&version=v3.3
200
application/x-javascript; charset=utf-8

1
ok

Cache-Control: public,max-age=1200,stale-while-revalidate=3600 - max-age too short.
GZip: 1781/3224 Bytes




Server-Header Access-Control-Allow-Origin: *
Cross-Origin Resource Sharing (CORS) supported

missing crossorigin=anonymous|use-credentials and integrity - attribute, possible hash-values:

sha256-nGioH6O7DjEnaef/8ZXcBaPhZxkb/BomUohToC8enyE=
sha384-0tCSVJxDG1O3S9sEgh+FgQIhVTm/XzMtNJMItRsMWTybTOUkuAlKIhnQ6x7V3ras
sha512-g5U4+M4J6orTLVNdWj8bMaihVNgvU+Z837D156WTbhjhP7IP0HPFpIRNmnmzG/N0TQacJecgDCcABsR7MblTog==

<script src="https://connect.facebook.net/en_US/sdk.js#xfbml=1&version=v3.3" crossorigin="anonymous" integrity="sha256-nGioH6O7DjEnaef/8ZXcBaPhZxkb/BomUohToC8enyE=" />




script
src
https://tools.pinpoll.com/global.js
200
application/javascript

1
ok

GZip: 26983/82164 Bytes




Server-Header Access-Control-Allow-Origin: not found
Cross-Origin Resource Sharing (CORS) not supported



style-attribute

https://blog.coroico.mx/wp-content/uploads/2019/07/26.png
200
image/png

1
ok

No Cache-Control header
No GZip - 426844 Bytes






style-attribute

https://blog.coroico.mx/wp-content/uploads/2019/07/29.png
200
image/png

1
ok

No Cache-Control header
No GZip - 196441 Bytes






style-attribute

https://blog.coroico.mx/wp-content/uploads/2019/07/laboratory-work-PCB5N83-768x512.jpg
200
image/jpeg

1
ok

No Cache-Control header
No GZip - 31067 Bytes






style-attribute

https://blog.coroico.mx/wp-content/uploads/2019/08/30.png
200
image/png

1
ok

No Cache-Control header
No GZip - 276307 Bytes






style-attribute

https://blog.coroico.mx/wp-content/uploads/2019/08/33.png
200
image/png

1
ok

No Cache-Control header
No GZip - 180495 Bytes





https://blog.coroico.mx/.well-known/acme-challenge/check-your-website-dot-server-daten-dot-de

a




1
ok








a

#


1
ok








a

http://blog.coroico.mx


1
ok








a

http://coroico.mx/


1
ok








a

https://coroico.mx/


1
ok








a

https://www.facebook.com/Coroico-2242068165870172


1
ok








a

https://www.youtube.com/channel/UC9_CGY043vdzRto5JJ2Azjw


1
ok








a

mailto:info@atlatlgroup.com


1
ok








form
post
#sendgrid_mc_email_subscribe
404
text/html; charset=UTF-8
Not Found
1
missing file

28552 Bytes






form
get
https://blog.coroico.mx/
200
text/html; charset=UTF-8

1
ok

11234 Bytes






img
src
http://blog.coroico.mx/wp-content/uploads/2019/05/COROICO_LOGO-04-small-1.png


1
http-link, change to https








link
alternate
https://blog.coroico.mx/comments/feed/


1
ok








link
alternate
https://blog.coroico.mx/feed/


1
ok








link
apple-touch-icon-precomposed
https://blog.coroico.mx/wp-content/uploads/2019/05/cropped-COROICO_LOGO-04-small-1-1-180x180.png
200
image/png

1
ok

No Cache-Control header
No GZip - 18350 Bytes






link
dns-prefetch
//ajax.googleapis.com


1
ok








link
dns-prefetch
//fonts.googleapis.com


1
ok








link
dns-prefetch
//s.w.org


1
ok








link
EditURI
https://blog.coroico.mx/xmlrpc.php?rsd


1
ok








link
https://api.w.org/
https://blog.coroico.mx/wp-json/


1
ok








link
icon
https://blog.coroico.mx/wp-content/uploads/2019/05/cropped-COROICO_LOGO-04-small-1-1-192x192.png
200
image/png

1
ok

No Cache-Control header
No GZip - 13110 Bytes






link
icon
https://blog.coroico.mx/wp-content/uploads/2019/05/cropped-COROICO_LOGO-04-small-1-1-32x32.png
200
image/png

1
ok

No Cache-Control header
No GZip - 924 Bytes






link
stylesheet
//fonts.googleapis.com/css?family=Droid+Serif:400,700,700italic,400italic&subset=latin
200
text/css; charset=utf-8

1
ok

GZip: 297/1025 Bytes




Server-Header Access-Control-Allow-Origin: *
Cross-Origin Resource Sharing (CORS) supported

missing crossorigin=anonymous|use-credentials and integrity - attribute, possible hash-values:

sha256-C7hO0IaoXKQROg5HlO1JFasP4wChwjc1BpuCjEeD/Qc=
sha384-MzH4ZTn2xb+mN53vqj2+wSMogz+1QvK0asztA1sn79bFr4paCZee8d3SQjyrTE49
sha512-QRn8yZYAVQSfrBhVJ3PcOWPzRLsyLG8kSzVOnJ+qGWXDEKTa7IzBEBGZxxhbyiazpzZS7khg/4PqX7zBGmZbmA==

<link rel="stylesheet" href="//fonts.googleapis.com/css?family=Droid+Serif:400,700,700italic,400italic&subset=latin" crossorigin="anonymous" integrity="sha256-C7hO0IaoXKQROg5HlO1JFasP4wChwjc1BpuCjEeD/Qc=" />



Content loaded via url("...")

https://fonts.gstatic.com/s/droidserif/v10/tDbI2oqRg1oM3QBjjcaDkOr9rAA.ttf1
https://fonts.gstatic.com/s/droidserif/v10/tDbK2oqRg1oM3QBjjcaDkOr4nAfcGw.ttf1
https://fonts.gstatic.com/s/droidserif/v10/tDbV2oqRg1oM3QBjjcaDkOJGiRD7OwQ.ttf1
https://fonts.gstatic.com/s/droidserif/v10/tDbX2oqRg1oM3QBjjcaDkOr4lLz5CwOnTQ.ttf1

link
stylesheet
//fonts.googleapis.com/css?family=Open+Sans:300italic,400italic,600italic,700italic,800italic,400,800,700,600,300&subset=latin
200
text/css; charset=utf-8

1
ok

GZip: 384/2509 Bytes




Server-Header Access-Control-Allow-Origin: *
Cross-Origin Resource Sharing (CORS) supported

missing crossorigin=anonymous|use-credentials and integrity - attribute, possible hash-values:

sha256-W6Xk1HvyNBdn/WoHy1yuPCbdNZVfg0bsOpdLmgkZCIU=
sha384-nVv5N4RVydSPG//SIiKyYeJ5iuvAfDC6unimo9z/qB3LS92pKST/uR4+tOyflFh8
sha512-MsIqWZ/DrB1fs+Mr/pOC2XvYal8DsvfBugt16yeY2yTdFDRkoiWA0xCpIqF48WZB5ZYV+qUuaTYYelQDswjdAg==

<link rel="stylesheet" href="//fonts.googleapis.com/css?family=Open+Sans:300italic,400italic,600italic,700italic,800italic,400,800,700,600,300&subset=latin" crossorigin="anonymous" integrity="sha256-W6Xk1HvyNBdn/WoHy1yuPCbdNZVfg0bsOpdLmgkZCIU=" />



Content loaded via url("...")

https://fonts.gstatic.com/s/opensans/v17/mem5YaGs126MiZpBA-UN_r8OUuhs.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem5YaGs126MiZpBA-UN7rgOUuhs.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem5YaGs126MiZpBA-UN8rsOUuhs.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem5YaGs126MiZpBA-UNirkOUuhs.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem6YaGs126MiZpBA-UFUK0Zdcg.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem8YaGs126MiZpBA-UFVZ0e.ttf1
https://fonts.gstatic.com/s/opensans/v17/memnYaGs126MiZpBA-UFUKWiUNhrIqY.ttf1
https://fonts.gstatic.com/s/opensans/v17/memnYaGs126MiZpBA-UFUKW-U9hrIqY.ttf1
https://fonts.gstatic.com/s/opensans/v17/memnYaGs126MiZpBA-UFUKWyV9hrIqY.ttf1
https://fonts.gstatic.com/s/opensans/v17/memnYaGs126MiZpBA-UFUKXGUdhrIqY.ttf1

link
stylesheet
//fonts.googleapis.com/css?family=Open+Sans:400,700,400italic,700italic&subset=latin
200
text/css; charset=utf-8

1
ok

GZip: 287/981 Bytes




Server-Header Access-Control-Allow-Origin: *
Cross-Origin Resource Sharing (CORS) supported

missing crossorigin=anonymous|use-credentials and integrity - attribute, possible hash-values:

sha256-RZfP4jCci7vHEMfOoU/0+SyyTLlyKKBz+dWDvKxOvRo=
sha384-ZjJ0ucZlkxxmnUl9VDId9ciQ4T0hSUwgZwUGsuhvP/6HWT7WZfJsMCHKegQWdqUk
sha512-GqEvfuTD/46S78ShHbOiZvcS/rB6RPIFg39DzQGgB0nukt6cVwKJTOw1Zsj+n/Ubp0Z5BeETatqpqQOvsI+8NQ==

<link rel="stylesheet" href="//fonts.googleapis.com/css?family=Open+Sans:400,700,400italic,700italic&subset=latin" crossorigin="anonymous" integrity="sha256-RZfP4jCci7vHEMfOoU/0+SyyTLlyKKBz+dWDvKxOvRo=" />



Content loaded via url("...")

https://fonts.gstatic.com/s/opensans/v17/mem5YaGs126MiZpBA-UN7rgOUuhs.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem6YaGs126MiZpBA-UFUK0Zdcg.ttf1
https://fonts.gstatic.com/s/opensans/v17/mem8YaGs126MiZpBA-UFVZ0e.ttf1
https://fonts.gstatic.com/s/opensans/v17/memnYaGs126MiZpBA-UFUKWiUNhrIqY.ttf1

link
stylesheet
https://ajax.googleapis.com/ajax/libs/jqueryui/1.11.4/themes/smoothness/jquery-ui.min.css?ver=1.11.4
200
text/css; charset=UTF-8

1
ok

Cache-Control: public, max-age=31536000, stale-while-revalidate=2592000 - with long duration found.
GZip: 7320/30021 Bytes




Server-Header Access-Control-Allow-Origin: *
Cross-Origin Resource Sharing (CORS) supported

missing crossorigin=anonymous|use-credentials and integrity - attribute, possible hash-values:

sha256-iWTx/iC9IoKaoSKD5+WVFef8ZYNIgQ4AxVpMbBw2hig=
sha384-A/CgvDCSM2jOpa4G++hlEtzweAjg53uGXJLUnen/qb5faVDcN+vaHrL5czAdzhK8
sha512-vljQ8u3XOuV0u0GLG6ZRToEi2ZKCWeJwezv27POKmq/s1MIRiSv32m5MKZaquL4WIdh3A0wE+HChNH+s6psFFQ==

<link rel="stylesheet" href="https://ajax.googleapis.com/ajax/libs/jqueryui/1.11.4/themes/smoothness/jquery-ui.min.css?ver=1.11.4" crossorigin="anonymous" integrity="sha256-iWTx/iC9IoKaoSKD5+WVFef8ZYNIgQ4AxVpMbBw2hig=" />



Content loaded via url("...")

data:image/gif;base64,R0lGODlhAQABAIAAAAAAAP///yH5BAEAAAAALAAAAAABAAEAAAIBRAA71
data:image/gif;base64,R0lGODlhKAAoAIABAAAAAP///yH/C05FVFNDQVBFMi4wAwEAAAAh+QQJAQABACwAAAAAKAAoAAACkYwNqXrdC52DS06a7MFZI+4FHBCKoDeWKXqymPqGqxvJrXZbMx7Ttc+w9XgU2FB3lOyQRWET2IFGiU9m1frDVpxZZc6bfHwv4c1YXP6k1Vdy292Fb6UkuvFtXpvWSzA+HycXJHUXiGYIiMg2R6W459gnWGfHNdjIqDWVqemH2ekpObkpOlppWUqZiqr6edqqWQAAIfkECQEAAQAsAAAAACgAKAAAApSMgZnGfaqcg1E2uuzDmmHUBR8Qil95hiPKqWn3aqtLsS18y7G1SzNeowWBENtQd+T1JktP05nzPTdJZlR6vUxNWWjV+vUWhWNkWFwxl9VpZRedYcflIOLafaa28XdsH/ynlcc1uPVDZxQIR0K25+cICCmoqCe5mGhZOfeYSUh5yJcJyrkZWWpaR8doJ2o4NYq62lAAACH5BAkBAAEALAAAAAAoACgAAAKVDI4Yy22ZnINRNqosw0Bv7i1gyHUkFj7oSaWlu3ovC8GxNso5fluz3qLVhBVeT/Lz7ZTHyxL5dDalQWPVOsQWtRnuwXaFTj9jVVh8pma9JjZ4zYSj5ZOyma7uuolffh+IR5aW97cHuBUXKGKXlKjn+DiHWMcYJah4N0lYCMlJOXipGRr5qdgoSTrqWSq6WFl2ypoaUAAAIfkECQEAAQAsAAAAACgAKAAAApaEb6HLgd/iO7FNWtcFWe+ufODGjRfoiJ2akShbueb0wtI50zm02pbvwfWEMWBQ1zKGlLIhskiEPm9R6vRXxV4ZzWT2yHOGpWMyorblKlNp8HmHEb/lCXjcW7bmtXP8Xt229OVWR1fod2eWqNfHuMjXCPkIGNileOiImVmCOEmoSfn3yXlJWmoHGhqp6ilYuWYpmTqKUgAAIfkECQEAAQAsAAAAACgAKAAAApiEH6kb58biQ3FNWtMFWW3eNVcojuFGfqnZqSebuS06w5V80/X02pKe8zFwP6EFWOT1lDFk8rGERh1TTNOocQ61Hm4Xm2VexUHpzjymViHrFbiELsefVrn6XKfnt2Q9G/+Xdie499XHd2g4h7ioOGhXGJboGAnXSBnoBwKYyfioubZJ2Hn0RuRZaflZOil56Zp6iioKSXpUAAAh+QQJAQABACwAAAAAKAAoAAACkoQRqRvnxuI7kU1a1UU5bd5tnSeOZXhmn5lWK3qNTWvRdQxP8qvaC+/yaYQzXO7BMvaUEmJRd3TsiMAgswmNYrSgZdYrTX6tSHGZO73ezuAw2uxuQ+BbeZfMxsexY35+/Qe4J1inV0g4x3WHuMhIl2jXOKT2Q+VU5fgoSUI52VfZyfkJGkha6jmY+aaYdirq+lQAACH5BAkBAAEALAAAAAAoACgAAAKWBIKpYe0L3YNKToqswUlvznigd4wiR4KhZrKt9Upqip61i9E3vMvxRdHlbEFiEXfk9YARYxOZZD6VQ2pUunBmtRXo1Lf8hMVVcNl8JafV38aM2/Fu5V16Bn63r6xt97j09+MXSFi4BniGFae3hzbH9+hYBzkpuUh5aZmHuanZOZgIuvbGiNeomCnaxxap2upaCZsq+1kAACH5BAkBAAEALAAAAAAoACgAAAKXjI8By5zf4kOxTVrXNVlv1X0d8IGZGKLnNpYtm8Lr9cqVeuOSvfOW79D9aDHizNhDJidFZhNydEahOaDH6nomtJjp1tutKoNWkvA6JqfRVLHU/QUfau9l2x7G54d1fl995xcIGAdXqMfBNadoYrhH+Mg2KBlpVpbluCiXmMnZ2Sh4GBqJ+ckIOqqJ6LmKSllZmsoq6wpQAAAh+QQJAQABACwAAAAAKAAoAAAClYx/oLvoxuJDkU1a1YUZbJ59nSd2ZXhWqbRa2/gF8Gu2DY3iqs7yrq+xBYEkYvFSM8aSSObE+ZgRl1BHFZNr7pRCavZ5BW2142hY3AN/zWtsmf12p9XxxFl2lpLn1rseztfXZjdIWIf2s5dItwjYKBgo9yg5pHgzJXTEeGlZuenpyPmpGQoKOWkYmSpaSnqKileI2FAAACH5BAkBAAEALAAAAAAoACgAAAKVjB+gu+jG4kORTVrVhRlsnn2dJ3ZleFaptFrb+CXmO9OozeL5VfP99HvAWhpiUdcwkpBH3825AwYdU8xTqlLGhtCosArKMpvfa1mMRae9VvWZfeB2XfPkeLmm18lUcBj+p5dnN8jXZ3YIGEhYuOUn45aoCDkp16hl5IjYJvjWKcnoGQpqyPlpOhr3aElaqrq56Bq7VAAAOw==1
images/ui-bg_flat_0_aaaaaa_40x100.png2
images/ui-bg_flat_75_ffffff_40x100.png1
images/ui-bg_glass_55_fbf9ee_1x400.png1
images/ui-bg_glass_65_ffffff_1x400.png1
images/ui-bg_glass_75_dadada_1x400.png1
images/ui-bg_glass_75_e6e6e6_1x400.png1
images/ui-bg_glass_95_fef1ec_1x400.png1
images/ui-bg_highlight-soft_75_cccccc_1x100.png1
images/ui-icons_222222_256x240.png2
images/ui-icons_2e83ff_256x240.png1
images/ui-icons_454545_256x240.png2
images/ui-icons_888888_256x240.png1
images/ui-icons_cd0a0a_256x240.png1

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/contact-form-7/includes/css/styles.css?ver=5.1.3
200
text/css

1
ok

No Cache-Control - header
GZip: 651/1685 Bytes




local SRI possible, possible hash-values:

sha256-OtL8sygpXxGZ1ZOtq6kJ8+6nkPaVVUrDwdp6oAn8Dg0=
sha384-DWWCyZvrXhAnC81iVUgJpPe20AtJOqZrM2q30eu48sf1YteUyvVYNF/t8EPpZWLv
sha512-8Mcb8YVE+7B2uMI/wUfYJKL3RVJBooROas8hWpV1nZj3CnMkHUZzSqfAZQDpYmV87aOS59XHM4tcYQ8RDGx+4Q==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/contact-form-7/includes/css/styles.css?ver=5.1.3" crossorigin="anonymous" integrity="sha256-OtL8sygpXxGZ1ZOtq6kJ8+6nkPaVVUrDwdp6oAn8Dg0=" />



Content loaded via url("...")

../../images/ajax-loader.gif1

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/jquery-ui-timepicker-addon.min.css?ver=5.2.4
200
text/css

1
ok

No Cache-Control - header
GZip: 333/648 Bytes




local SRI possible, possible hash-values:

sha256-BX1MIynuR5aqNZHQMzmBu/aORhTWuK9VAAiBjwUv5nk=
sha384-9iIibg7F08Llglja4fCdPdoDJN7w9WM6f4C5eu8cIBZ0d9ezJHw4zUp5GjItlDZ/
sha512-N0otkKJPjawyFU9mE5U+kWxmutA681ia9V3h1hxw8UfVzGKYbKh9DTLLJ5w7yn4JXW7iylO+WMumF3/dxHUdRg==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/jquery-ui-timepicker-addon.min.css?ver=5.2.4" crossorigin="anonymous" integrity="sha256-BX1MIynuR5aqNZHQMzmBu/aORhTWuK9VAAiBjwUv5nk=" />




link
stylesheet
https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/academicons.min.css?ver=20190406
200
text/css

1
ok

No Cache-Control - header
GZip: 1266/6758 Bytes




local SRI possible, possible hash-values:

sha256-lJ0/etdIH9CSZCDjK56BaqEFT2biZcwKeUQSxp2BRc4=
sha384-2zw26kZCAo3OOPxHdSGlYxqFNNyZaNtyfyUHc54acoRrCIDbMVLEDVcCEWVmO4xM
sha512-vDI/OCjYt11qT3Q6c8Dw3ho2Up9bIQ8J0nVBK6D7RLoXxq2KFVYH7sNUkgSx3rAYnV/GthzC3yCdb2zQb3/CRQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/academicons.min.css?ver=20190406" crossorigin="anonymous" integrity="sha256-lJ0/etdIH9CSZCDjK56BaqEFT2biZcwKeUQSxp2BRc4=" />



Content loaded via url("...")

../font/academicons.eot?v=1.8.62
../font/academicons.svg?v=1.8.6#academicons1
../font/academicons.ttf?v=1.8.61
../font/academicons.woff?v=1.8.61

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/font-awesome.min.css?ver=20180625
200
text/css

1
ok

No Cache-Control - header
GZip: 7051/30994 Bytes




local SRI possible, possible hash-values:

sha256-3GjqhYLNCSvoydUEnbNA91PUwU0F5Xm4odWNjDNIeZ8=
sha384-FjIDn4xq3dtDtq/tN4hYAjwxbLyI/ID/RlPmixS6c7XDvdKcntlwUeowdsC2vXaJ
sha512-6vCwRp6xtDdNdHJ4qIrcKsQVdcr0LV9bDuc3x76gV+/Pg/cJYVpDIPCcnR0cJ/1gU5lRG4bHU/hU1DSgvA3MLQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/font-awesome.min.css?ver=20180625" crossorigin="anonymous" integrity="sha256-3GjqhYLNCSvoydUEnbNA91PUwU0F5Xm4odWNjDNIeZ8=" />



Content loaded via url("...")

../font/fontawesome-webfont.eot?#iefix&v=4.7.01
../font/fontawesome-webfont.eot?v=4.7.01
../font/fontawesome-webfont.svg?v=4.7.0#fontawesomeregular1
../font/fontawesome-webfont.ttf?v=4.7.01
../font/fontawesome-webfont.woff?v=4.7.01
../font/fontawesome-webfont.woff2?v=4.7.01

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/genericons.css?ver=20180625
200
text/css

1
ok

No Cache-Control - header
GZip: 16447/28296 Bytes




local SRI possible, possible hash-values:

sha256-0l60NvWEVi98KRxmdy3jC4GdmdvYMZZIeX4/uF4JvtI=
sha384-7I/oTd3JGDqLJGPZLQVOuFhz3+PzoOqqWZmQ+y25gaiUicUazL7k2Mz5I0hjfnTu
sha512-dm8OCvWe3O3gghuspY8EEU28FehK+yfpmNNCRa/Oc0Ii84QTCK/bQPJsMWMTkY4gEFfPcl2jUMJdSeZtUfsIqQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/genericons.css?ver=20180625" crossorigin="anonymous" integrity="sha256-0l60NvWEVi98KRxmdy3jC4GdmdvYMZZIeX4/uF4JvtI=" />



Content loaded via url("...")

../font/Genericons.eot1
../font/Genericons.eot?1
../font/Genericons.svg#Genericons2
../font/Genericons.ttf1
data:application/x-font-woff;charset=utf-8;base64,d09GRgABAAAAADakAA0AAAAAVqwAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABGRlRNAAA2iAAAABoAAAAcdeu6KE9TLzIAAAGgAAAARQAAAGBkLHXFY21hcAAAAogAAACWAAABsqlys6FjdnQgAAADIAAAAAQAAAAEAEQFEWdhc3AAADaAAAAACAAAAAj//wADZ2x5ZgAABFQAAC7AAABIkKrsSc5oZWFkAAABMAAAAC8AAAA2C2BCV2hoZWEAAAFgAAAAHQAAACQQuAgGaG10eAAAAegAAACfAAABOFjwU3Jsb2NhAAADJAAAATAAAAEwy4vdrm1heHAAAAGAAAAAIAAAACAA6QEZbmFtZQAAMxQAAAE5AAACN1KGf59wb3N0AAA0UAAAAjAAAAXo9iKXv3jaY2BkYGAAYqUtWvLx/DZfGbg5GEDgkmLVWhj9/ycDAwcbWJyDgQlEAQABJgkgAHjaY2BkYOBgAIIdHAz/fwLZbAyMDKiAFQBE7gLWAAAAAAEAAACXAOgAEAAAAAAAAgAAAAEAAQAAAEAALgAAAAB42mNgYf/MOIGBlYGB1Zh1JgMDoxyEZr7OkMYkxMDAxMDKzAADjAIMCBCQ5prC0MCg8FWcA8TdwQFVg6REgYERAPvTCMQAAAB42i1PsRXCUAg8SAprl7FN4QZqb2WZGRjAIVLrHj4be4ews7OJHAd54cMBd+Af7JHmt3RPYAOHAYFweFhmYE4jlj+uVb8nshCzd/qVeNUCLysG8lgwrojfSW/pcTK6o7rWX82En6HJwIEv+wbi28IwpndxRu/JaJGStHRDq5EB+OKCNumZLlSVl2TnOFVtl9nR5t7woR0QzVT+D7cKLeIAeNpjYGBgZoBgGQZGBhBYA+QxgvksDBOAtAIQsoDoj5yfOD9JflL7zPGF84vkF80vll88v0R+yfxS9lX8/3+wCoZPDJ8EPil8ZvjC8EXgi8IXgy8OXwK+JHwp+Mrw////x/wsfHx8HHxMvJo8Rjw6PGo8CjxSPCI8fDwc3PVQ2/ECRjYGuDJGJiDBhK4A4pXhDABtHClYAAAARAURAAAALAAsACwALABaAIQAzADyAQABHAFGAZQBzgIIArIDTAOkA+AEEgTCBRYFYgW+BjAGwgbkByQHSAeCB+AI2Ao4CowLGgvQDBwM6g08DX4Nug4kDkYOYg6ADsoO7A8yD4gP8hAwEGYQpBDuEUgRshHUEfYSQBJeEnoSlhLEEtwTIBNYE6oT6hQaFC4UShSQFJ4UtBTyFSAVjBW4FegV+hYUFiwWQBZWFmQWchaIFuYXFhdUF4gXyhgEGCwYThh8GNYZEhlCGVgZZhl8GZIZoBnQGhIaShp8GtIa6Br+GzAbVBt+G8Ib/Bw6HGgciBy8HOwdHh1WHXAdmB3eHvYfIB8uHzofSB9WH6of4CA4IMghACFCIcQh4CIGIjoiSCJ8IpYiyCLmIxAjWiPwJCQkSHja1Xx5YFTVvf/53nUm++zJJJnMkpkJJJkss5GFMIQ9w04IS0BZRSJLMIIo1l4XFETQFkVFBKwVrbuWpRaXPOtalZaCPKu1D2yf28NX21qfQubk9z3nzoSAS//+Mbn3nnvuuWc/n+/n+z3fCxHIaEKEJfJMIhKVhJ4GUtP8jCqRz+ufVuQ/NT8jChgkT4ssWmbRz6gK9DU/Ayw+bPKY/B6TZ7TgpuVwN71Unnnm0dHS24QQRSACUYis8XyzST6xEAch4LF5ZJsnKkc9NsDDj2ETXgUikT4iaClNJEBSGoZIP74qa+l//YRfKB5EAEyj4g/ztWBZbslcIEjucqHATOpjkYBXsYo18DNYeOQI3UMvonuOHIHXj+/YcXyHSs7FLGQp+o7sYA8IFq+BpmqKhtk6SDEZinWVWfMsHlLfIkRCgjdPsLpAtMlRUu8CmzVP8HlDEInJmkC+wcbihT54cN/6cePW79Mv/f1E+MUT2zvCM68cOWt7Rwc2pk8TNQ3IWW0gEbuI3yxI7KW9HdtnjbxyZrhj+xPbWX0EYhjcf9h3Jg9gldjBfhLm1af1ERF7BTAEmoxngQDeU35mB/YPsDiFtU0gxChgX2tn8S6FP3zG38O+zMWEVkU1yaYQRCMxt13WblvTT9bcdgpaTsnahlcqUp9owt0Vr2zYc+oUHwN8S2FjwMYV62PNA5+pPhaFc0EP4JhuPr2la4eQCVCsNRvnLac3A9nRNShIBFZPXpciEmHjareZsEbRWNTEBhVvHDasmyniwP7HJ+4AhlsgbmOP7PUsWVA8DFmHuzoSa3avSXR09XZ0HaZfHa7raOARKjm8kWoLdwfuamwHbcqaNVOo1t54V2D3QtA2nsQL1TYePrwRtMTaWUWYhvI0gGlYz5FeldWtgPiwvfW8bpVgAk/cwxqtR/hwhHxeVq9YWNG6duzo0miCHtBgy55TlN/jbYIHFGwyi6IJ6NVO7RG0c7c7ugBDRITMuMlYqovNAFYeuNg4BWPRSBCDBRhsEaKRQJCl5mOvSfmxpqbY3GQSCmYvXjy7s6bVP2WcjI/P4iEUxG7ddWt0brKrC5/P+Yz2fTans2bNjWMvPTwOi8B2Vhtw5pEr+cpyCWabVVAkVQngpGDFtChYcIsQCIYgT1ADQUUNifmQB7g4HIrN6pIdiponhCAYkoJDMd7ucEkOlxK32q02qxIMlAewtuYWQVwLdsg6+fyNbcufpfRunw+CruicxZMm1JYsV4zGfIuUV9+8OH7VzTdfFV80IpSVVZBvMErLS2rHT140JxrJtYfGjRjrFIyl3liplFNkNDlFY6nTmwuKwx0fu6gZfL67aOrZ5W03Pn/SQNiZfrXlIfr62RfrVXeh9JvpoxY4FUt5/eRFm2bsvTy/YvzFdSDK5jq/F8DrrzMpglAxtSFekt2zZ/rmRZPr/WYl1JmVJxdEq6VcX3GhoGY7zaAUuoZ5pNwhrqF5WabyKXVZhW4l/MJZaHhoC28cdiIDKkJ4nxqIiZQittSTBJlKiL8+LogKUe3+mDleLrvAjLhidsRIPBDMAda9LsERkxwCsETlccHiVXx2S4sUD1SBWyIIewRxjzDgk8iBw54n/0w3db0rjt/1ViE9TY/nNXaeue+KFT+Cxz4uSNCP6Bp5+biD/9dsLw0qj8DEq51nG1+if695Cb68Zevjbs19yW+VvZO2LB9yLT1Er4JdsAEsP/85/ZxupEvw+PznPweLNhWq4MY2evS13r0roL03FCq+m/5W2Jx4iP5u/dsQm1SrddTDuw0Xd7lKw+05HqUYSuGfM+nhE/bxIXBCrGAf3Sc0ultay6/9qXZB5lggL5R1FyAeVyEef0Aa8EZR7Qi4kuRz++3helzyOL0wgJfhOL8YXsXtkgNnaIsQrrc7YvE8UGOqllwpVM/Vnvo9pdvoEdpfVTXzgZ+MuPJ5n99dV/vjhyfPTs6uvwVu+TCrcfGm5OQt4R+tsLY3rFJquycX25Yff/vwfT0jH5QDY+vEbavV3KI3b5QrxfqfXbS445E3s4dUtm1a3Dg8XpRILPfm6vUlKD9UjQQH0MGHKG3xDEcZEXbEAz4UIKUIiyg0zwMI+hHk5dCPKlv3yZOWX/TT2VWUpqrYAxUR4SxB6HwNpN6c5jj8Iyt28drRp2lfqmFHl4xPOLZjufLHWK6b4YPIBAMrI9IiYU+Ugejl5YrSbpiQT1+lvX/+s6N6/EXXtsW7nE51/pKKiNMofU2P9h0SJ0ANCJEFs8bHShVRpB+Z/NVeUTASRJ9M2yyIzB6yhKzi2GA3s0HxeXFFF5hjgDMXFKjHuZsNdgtYYvEWMRphQGBA6AjXOwLlPq+kqPXh+tgIiNkVVVHBIiKOxBz2c3F+HGpVjJmjEbENVsDEL7aN7Nn38idXH6T7v9i27Qv6pzNv0x+PFQO3XC8JX/+j+y/gmypIBXkW1VFoBYdslvMkVZjcCMZV9NN7b6H9R8YXF/lX+Lw2S561qhb8T13bbs23WjdOCVzm82GkrVLwycO/OvSeqmHu+w9e/cnL+3pGbvsCJvLSU3mn6YYlUul9fTUhWREeSo30SHv7dkOOklNXNzZcGJoT9Qp+gzu7JL/Qlt3QAUu6Ox9YJQsilHlFWei7SzDBbFXwuiErE6lWVN68M9XQBT3vH2FzXSC3wj9Rlm4ldWQ4G0W73q8hITOh1ZARh5FBLM5+Me7xh20+my/qi4ajYeE9IZAbGLPkmh3T1723++JF9797+do3WncKVqO9oMjucpWblz66ZMmjS0d2j48VSXS/uE9nVJIWDE/fcc2SMYGLd7+3bu37uy+ePPEeyFVzDdmqURIXP/rbRxeXx8Y0Fb3Nk2M9RZ13Kc8jJzFjXTkjCTJxx4YX4R/FPkZF2FQHFYWyxxz02FoUfCbYhPn0ILQ9KExbumxGvL0KqjrkAnpoWkfluKG52fSQJMGEbJvbUxNuLZ++eVkDEPG/bl40oW1h9aS62kmhszsF8/Ir/WF3cSz1n+L187eaSnzFxZbs+GWPr2ZcKT0/Gct0k+ZBKzC91Bg/saCYDoEPiYTVjhG8moIa9dgLbCrWOs672mbSVyVbeCiGHfSbG0ZPg6mto6ZPGyk1PbSpftowbwH9GgAMhixvg3fMyMwy1ZfkGSIW9X0sbpzS2DxpclPjlL4N8NqTB4sqg4XdHtpz4CAcrrQ5h5Re3E5nY2c+isJhGsqFqazGLkkf9kBQwJURDMQtbALEWKWsrD/ZGsFVEULemYdJkQSpeewvyOeJLNWt++MT2xZEqmdctePgksVPeicUeOffqZb+TMqzb71kxuxAc57j6iVrn1005obXfzT/0ZtXTQjOMKuqaBVUn33munj5xBV3/fIvBhJftGnvgfkbPnxx18rm+Qn6wbAN22MPXy08ZfQsj9x6+LLp4e3/0bD49l9B3cFLn76uLTSt+6a7p965yOYszJmSVWgy+u54rnvS7nu3rp9Vr+N4RvYtzvCJAiFPwGYGY3ELn8/AGiXqjbI77AgbEI8Fgmk0x6nD2CRS7TinOWxuYboywE5yBMiFXCIt5+/YliwZX7J12lW/u31a0+W73u5Zd3T3tVOGdC0zl8iCSZDlvNHjtN41Sx/oGjZ1x0XRdn9Odp1r3KjY3GiBwbjG4pAP0NO7BjMH+hn9iuU/dP1icEaTlx0G8c7Ox+9YnYhfdM3td7bdcmyoIc9iSGRZbaYpVy185uZpzctvm7n96zujndGaXVcObZ01+upk5TSLhfpnLNo8BRyw7sgAQRDIXmGBukDei4srn/PeAuS2BeXpq2yF2V9+SR/+MnVFOiDvZecv03d41eUlUW9Xc4gXbyQR+bkP0TuIkwWpYhx/FrPDjCITQxhlVjaAtSAHlaGfpu5bsco7bZ71qvaN1z0152hdxNo8YdiabkPBpsSYG1VioA/SFB1Oh0AZ3HYtlLWvuKLnboOV/p7+agr9+1NPzbu7FB5nbcjoT/mIDd9af0ZBIag27OnjZ+CanoKsl/J7Ac99nL0SgHeJplTgWvbqWgUqEw47kw9xEwoHnDaMeEZNvihvVFwaBb+gs0wF1c0TN93cM3/+ig0XXzSqNfJqVzIZqjapGm2iH9PIrqoqZ/ls+lHMbi8ra2i8boOwNuVLJObO2cKm52D8cJBqjsEX1J+4lQK7O1aANeKr0c05B9bNHkb2b8J5WQlepRSs9iaojw2GELGMvnSKqVBIzf/XvPk0/ez0ZjP932RUJtFkMqqlT+ejCCWn9Lf6TolkbCMqSKg7NY1JsVekA5l3knxp9QOooPSTbeSnZAe5h9xH7icPkoeZNodNsNUq7M+q1KHOoNQpqpWdFBsDFOxOJR9A8QahtgYCwdpANKB3byAYCfIVGIhiZAS7IFobi8bqIqzPo/VxftV/I6A2DrF6B9Ta62rtYbtj4GdjRy37szqsdXYwyXEjOPyyLQ4mv+qPB1UjBGV/VFVx1Pk/Af+E9BkvqVZThSnVCiLgdBZZrADn/RNgIDGKVuEFTC68AAIM5JHOCDArcH2cujJ19mNwpV59EO6kH34sjPv000+hUpA/ph8KjQ9K/5AlWi2oAkjsHVaowIpM54D5A63OzoFjLPt0TUX+HC+AL+GLEhyTZAFkEPCWHew1ngE7H8vOptXpFop6jqwMlgzfgCn07Rd3wmz68M4X9/5pVeoFiLx47+Rdu3ZhaPbOF+//06rz56oF5dwL5GM2V5GJFaCO5uaqVQsSYVTXBJQPDrsUV9I8AjEVgXUEMEzFFKiHWTgDUxiRRmStjdQhVQuUsyj+aoyBcAgUPUI4B8whIRjggocnY1Qcc2MP2T0TSiIqi0GO1w6XiLfsjfStAPXlOINQiAVZlojhEpYZDJjjMYyPK5KCcG+2SxI5yJgfI2T0Dkb8OAc8tpueWLlyidW075r14N4wIbn6rTtmlSdC2KNGEUb+/OVlD4Brodt/KX3/dnHo0I4tV6xrn7vgyWuT2V3tl9AvV14xvCXLsHPlqv9qanEkQxs3RTsstnBBVbS0am4gEDEYzEUFlfXFzki1udghK5VlFTWh8bmohxlt9jGBwFirTTYbi70V9spOj9cvCh0bW8Mza3Js5qmXrBtWPjJsKjaaHRsebp91+0y64TRsuqRp1o43eibdsNAZG9/TTQ899BD9dFxb7qzZUP2MyXwv/fSNdde9DyGdd+rNZLQzzUDvMqxdfRn945139E8Yn9dgm739re6xm9bWY1uzBEiuaLp1Q7j62jtTWaNuGtYz1FfiTV775ALhshdbJlmbWpZfds3637g80+d3fpgMV1uDwxcsnFlcWaZm5zkc44YMbfc4PBZByHGai9v8/haTXYFhlQKUTSh1eQSo9Pnag1aP0yIZi8rcc2pHXhYy5Yy5aHU00l5tsOfVDC+Pb2ieclU0P2flA303f/3WTTeuPXrvZVb3yq3T7qJPrN/QXer8rz27YOU99/7BJQk5t7xL/7x7H/3D+9f//8R1mT73Y3W4ej25BG9cuAjy5BAqSKY8A858HnIJsTiKJ5eI+ngspPiC3kAeJgOXWAZqSMLF0iK6RIe8Wy2aMGb26CZnXlnlitVXdl86K2E2I+waTFa3P1IaWdU+xmzxjB41rACGKdbEiNmTpo+oyxLKW6Z3zpsx0mKRCsKR5NgZ48aXFBeJJmeR0XhKdTQOKc0eP2rMww899bO7N8xzqkPEnKH1M+ffsO3QojmbZ8Qtcm6uqtD/EVS7w+3yuUqzzUKRKycXCr2VeeXV4jOpjwQ5W5It1aMuGzPx+s62Km++ASFJyS+sCCerqxdMm9hYlZP9htG9fNWD9786b/LlTW4hr6QoKz2GiEFXIAYNIddh79hVbgwNMqiRUCwy5iaivseUAtlmBWapCgz+YRqmD9rTgn3gORITJpusg2SINS3zB57bMnQgpo4Mw6QbDiy5auWUiZe//yukq6ZRdZ3r75y69cq2sYteeHB7z4wqekmT1ze8qX368g6Xu9xtKYjEOxdVDvWUOIpqIj5vkXPYsBkzu7ctXzGsIR7tnL1xXsswr6el9dLJ1aFCp8NWUlYV8/pikVlXHrxnVbfYuuzyJQdumNSYN3zFrmff62mfefnGqXeu76xL5lTN6Nn+4AuL5tPftl86e3hzRbDY6bAYjeZ8zCPkLXe7W0I2e3l5dai+FqmIMzhkQtuCS0a3BgMlVrPJ46ofMbTKbvN4orWFRagDJSdNrBkRCnH+jKyIKMzuGGESHXFX1wbwrFQiS+EcJSRUgomjOO94Zp1Gwe6ptyuaPVhkZ0cymmCsgSZGXjFu7lCtt27VwgSoiACeOWMLDAbYG01KpLiu3OAJ6mdM3ZWsqK0QtIvu/3qzbKr2lLTvnD5zrz+Q1Cn927BVDas93KIVJLVkBBmPesxmrGUMq6UPWwSJAY4VYC3TWqK9nKkzCrvzxzidV+0oE1iQWwesdgmsjhgzlyjEqzCzbsRi1e0/gBKO866MXoTpLCimHHILYgXrCtQSgn7R7mD3LpBezx/qyu949nBHvmto/rDbfkL/1hoKjRwZCrXC6HmtrfNaBU9lw5DqshmpLY+C75FH6AePPkY/eOQR8KU+rKiZWVo1pFGuxoEYUb1vWCjvilfoF/QE/eKVtQWllUXrZtTNKDn03/Nks9kGDYXT69qWL2+rmVIn0jOT/vxkycz62LyYaMh3VeZ3dORXuvKHgRJqxeJbW/VzKDS8rHZIQ3B4alnXgctWHOzqOnjiYJdwb03JxOHlDUJ7qCVUnUg9Fe8srq9b+uzGKVM2/mop6n/hkb4Z66oDC43whj07Rx4/pG75HcurJ4Wa6bU5CypCsXlsfSK/Znq6RnwkjuPBjDBM7RX5loUwHDw23VzOu81hU2VPRscKRh1x/aE0ze63e2sA5t03f4w2LwZqzega+bUtW16X7kMaoc7bPX/+7nmw/D6Mlo7Os/ttIS8tm3vPnGjnj0YfPeKpqfHAx5uef3HTZdU/Ptq5a+6cnZ1/qA0dZ/FEryPbP8B5nU/KM3ybb+Lo+jrbxkF+yPZyHBB3IamOOxRkxpn9GyTW7wWSXX76Hn3P35UMwHLZ1DC6wSSr3Kx+VN/iOcrs6Kl9LAF9H/z8hR1Sqc9XKhHdrvUCcqnWgT0WByFG0WTMiduMEHUIt8Ga1Od0O6wULBTDggVWpv4u5NPtqc9hDb0dLt+d+iL1xW61lb5FD0F56lnw0V/RtyAC4+kH9CFxL/0TTIDI2W/o28t66EvQ0rOMt10ghCpzsO0uMoa3XRUFNU9iKoQKeaBrOEwcMr6F65vtb8TNyLCYcqGzMKaZcMuiBxVo+dXZjdbIHFlWrEU1rjMGWaVX5g11Z1vL8suaK4RTXtlpSa2ylcr/dFpLyz6wFouCS5RcFvr3Yp+vGEZk2wtUsmgRpbTFarVV2MyCgTYU5IqyWlkh2xxVVSV09S/tZW5zn0GRcZ4U5jnzDLtyrT5vcbDYk2PhOMX2R9h+0GDtb9BmCPnezY/0bgfHOgFnLd9TYnsdqPw5PDaPGBZ6xd5+wjRETJ7i8jylIRPW+klmLmHJCmPHOdwqZYTMRqCESyFFKBHf7GKApmAwRdg+U5Ldk8weC5+HZcSftmtm2DQza+q7f4hNeCdZTKhsmcQ6cIH8XHf3c/Qs/ZCefX716ufhjrXv3NvZee87a3fRr3buhKw/wdBO+rRKVj+vJ2LJkefji8+fXd2588RnJ3Z27qRf0dcxuUToXPqfnTAV3tPnB9aJ8L1IE957GY7arSLrVQ/rTKmL72ZqTGs+tUfS+B4m/ezUnn7siD2nCBncrmxSTKp0W53JEw3b8LAw45c+rbj+mh4vNlQ+VlhYRqFzBg9NwM5ORvu4xiniOdXrRKYcSODZqWhn2RLStLOYjCVIsbNwIOCkhD2HXkx5fl1cZChpxLrUoqasioxHxS16iZ4mqK0PowJRAnU/VFUJy1JC4RJ1xRO8DMK0KYebmya/s8bSb0AwqFij4pxQETyNVRLcDtTnDn9X5QnJGajr4H3rYpwblaQJZdwohqdhm5g+MmFPOowc1Wb6oZ7OvHtuO5vVmF+/pwGU6GnYM37Q9DVzFsh3NQWi+qY5Xx8zYaZ6tXo1tseNCAcOQB2tRYA4qAFvPt+jUyFurx+BsAt/Fsrmpk6VNzUGvTnWYcLX+4WyA/6uwIFCs7lwf+rkgQCG/cIwnspfU5pnDIWnS88dSJ3c7/cfKGptLTwglGHwoL9rYG1ynC8gJdh3KqCUZjv15W7JjOyOIM9HBEMJhdhHNGq6+9n0+oFhkLVzdd/q9Ue+PLKenQAb/LfVmSe4dHY9eze8mX64fv2AfTpdFm/pBcWRdFGoXtgtUY9NNsHfvlVmauxAngZBE1dT07fKpd+cq5VhsG2cr7cSUsFtVza2FeOJMjj6gXqIOIw4UGzpCv+mOkomIb6S+jf14vKNQKWBKO+QXKxTKaJbNdv/Z9AWNEIMqyIagXe8EZi2FUNVI8aNjgLnXYifMpyl8hL6JfKeL5dSBc4shRwYCjl+WEu3Tnrl3Zcn0lvh8kmvrFjxypQUYWauU/SlhRxbZXyTypf09CyDM3BmWU9PXyVcAT2TZ0yfTG+lW/EKL+3RXzglRDk6n1dn5ofh46uOgDcIjDWyuiOtjDNLeByCFgcE46whqEtk8N7PmSM2KK7zTYkUeWC/ckoAWMBbcucvdm2/qH3FK0lY+8fQdWfJdRpt5M268//eSG3h1YC3u257eAVvWsuaEaf2rEDIgf2eoj2nhJN0L2vTlO3e6ZPhinfhQ54DvMoauDf1Fm/4V13LeRNfWrNgJQdjEBho6b4S2P/M7IX1MwIKo15IaLSX9mqQ4CdIyBfcayxNen+R29HPz8NA+nrFhNbX29eriQl+EhPqBfcaS8PmqJaWKxbEsyjzcLFVGqJ+ziLsKutBhlWIVHJ4wPgZPveTiQ44mo49ySgg0DCB4OxPA76mg4+eQuGJEYoOIOjiX2+KqyACXjMH5w1QirxhBzGy9WrBP5CLQSW0/BD1U/8hWi5M3L9f+jE9mPoUJtL9ggPaQHCkPmXYovMFDbs2i692BN4gMxqj1Ne0PqKJuGAUBpiUGahTvdBLE+f4MeMLRu6TZAT8M3kYi0jhT8TfGQxzF5pedmJVJRLvv16lF98zkDzGdIwCW90OHIoaQfXjfMQ+6u3TaELUUo8vEGak9moLEgs0mIThBQqW3qdBL7acPetbwJ/lskdp/oS5syE2Ztx8VOQ5jPYgDCVS/E1WFegdjDc5uLY5g+a+Gp6IUO4z1aMYcwLeZEGgCnxmphyhmAWi7zm09ZMjdPfvj8I2mAYlr67qJ/Me/Jx+TA880b23G//kjLvE72HREZGsepX+lT5JLz/6BCSh6PMH5/VpPB2X7f3fADEo6ovYG07uo+JCecJ1UlyiLcgsBpZmMXgs6luVeZErZnxzunVZs8PhE76u7L68u5L+H193f4zQj8LC3LHa/LgvMbNrmPTO2AkTxp45ylcVRNmeAQ5MZp/BhtgQ1nkNQwXUXeJc3+RIhqCG6Oth0GB3sMYH1ZAgcBqleJnHFv1tkv7mpVkPbm0E1AoC0S2TmIMOHqi+JmH4S9d/MofFg2/G4i95YyWcSo8dD7U3AWoT/tjwU0IZ28h47PiSOSwCyutLaS3vPd3fivsxVWa8mPLAyzg9Liu7m7sz+bwDTkt8rXGazJ2XOIJrLLRmytRuXDcauzLXpZR2NcP2qxk2MD8lQZuypntqmmy9TJvZnUA2snUBP1HY3Mgjhbp/HIKnyrA+GjGjClHAii+wi+VccsyZSpfT5VPn7IR9Nz733I2Ys0qYNFl7DB/AXVOPrd0FWSnnc2B4jjlTMTxbwPBMPsmWEJIJH8QdMucl9KR2Uj65IEVgr9aLY4Vz1EAGuBQpwsFi48WuBvI10Q82k3GZ4pHionAQZ7CQIZhHEFd1HrMLO0w4iKwJzALi8JjKcIJxDwMTTn34y18E7ZOa0f4/PnTz6UcXrZc3DVs69i8pzfLO+KlLnljF4pRSvP8k1L1xzNP0b1X0jH3zqyDeugvsdPKlrz48Dt+3vDP215euPbKtFBR8SFNMJxGxrZLGW8OWpcb87tL1ZPjDOoG1j89EfzrFWVRP+vC9PsKd3RjSzBASBtZnKtczy9gq5/wgfQGHlN7vM6fXizCM/gu2a9QCa6UH04HuvlE4Mdgw/H33mjW718j30zLEJyLsSZ3Sry0L2VOcPvTwGpbkPG6icj7L8IW7kg1emTL3HUNVCa+QPLceEYnTsSJ3IBu8GAnLisuUdN4ZphzXmTJJ4475gqs/7f2pM2Vd/Mhc8Hi4EEK1Ecmzz8TSCPu48Bj8B2nnRuZHmRFDNKGrA/ycwMqx5zgI/A3QX6T6ZZ9OjCVOm5lE0nM9yzVK5oTKCB0j4kRlumgJ12d1cRiJNUHajsVtTNw+OWizT1UPb2xdVxV67vI9pwolwvWyHWWejYfD1Us3nNrT0srXpqaCKqf9Ye1Wxr+DbGEEA5ERbCdNRFquHEwmP207mqQN9CS8Bm1tnyaPt83e20/2yruSx/ARjKcN4GaPjuNdW2rHXiAMkIHJLpnRKPVc/4t6RWS9Qtym+Af5f+UnuKwRsPCoByQCn1PLLJjFXFTpL+THqYVaOmCWBrO4HRIX2B8UTX8H1zySWyS1EplFf8G8UGHWLGqRH++gv8B3O+BzrssnFFYPxuiYgASEiFRvCllNr8xksYDUJsHTMSxJsHRYFyMm41YCIYE/jQlsDKZ6B3wJRKwe88bEGSxyd9o+Pg8BVyhWTX+Gc5st0syzNE+QNe6STIwiq7zGSBmbAWeJoDsecx5fwG5kTfm2/ucjQZzZNShz4lwTJBl9jx3xsM03+D48SB/8vnthgEylMqE+7cLAgAN0xgP6e0K8awRuB+G2DFbnb+1iZ5CF4ZisG2T4WbeNMEMJs5718TiJObNo6dUu4qM0jvD8GX4FLsg/zASuzRcdVI4YZYownCtKYxlpmQI5K2NWwEyZqOExxfhcwQeYituv2xAydnCGM8U6FjN5Lqev4LEKCiOAIRBEfIc3iF/6cJBv+vQn/eQnn96kcODglnD9mnrzbvqvX5bSf0Ju6S8hm9FEoq97Ja3FMXxOAwBDq8Eg4IIBFJCwesz1FnDe8NZi43SHX0U5vLGqfVypDgoCVk3HLmBmGyZH8OJ2bzzsqHSlMeIc9pQPYI9ej+8rPe1JSDJ10If1/JI5HOnQ+R1lCtxfn/EqI7fgmdjWlkfl8hqBGDECFy3zLmf6JzNHpN6bKwToXIGNEMV1xy1yKMD38Qfn2bDymZgo5c4cePJFue86MKjFNP2MZbNhuUpNsdXI8gaUm/q6TY+5iY84kxBNyGrTs5nVLRCJc41F4apFIjN1+4hYX1/fd4TZo9hU0vT5fBZLi/80zjRNAdFyj7pAXUCq+M6K6ldUixpkRDFoCQTlINMf48G4HIuLcQeictwh2h1+h2rHseaT216vLmikv6tptm95Y4Sz5Y0ttqZa+rvGTwyGTxqhrrbJtuWNkdaRb9xqb6qFOhZNN3H4FU7fam+uOZdSzyA3O4E5NNfoST/RM771dcy4jGM3ucDGYEV9/rwvH4Ab+VWI+fnOaRyUC7+BkOo3n96yaYNweHwf4aHUmPHf+iAidWTL6c3jU2M2bGJX4fCGb/GH4nNypTyjVyCgstXPlrusc4eUfmEsCGGYsEkj4ezRY/XF/SaTwWx1n5srOo8y6SyRxWZEvUx0qGbceoBz8ZTsyxH965GBbxIyOK+7D4n48AwrnmTwftD+QyYtkiELm576dyB6iSkuIAa+nyCDvp/A0tLfT4jAHbwN34u5ZBDm6kbwNNalQRc7x4AAeEZfsXj+OgO6vKoixyOWv4LaFcNcjqnG84rxpH+DihPS4CoMFAm82rj0M0XzL1Gw/0UtUzy+hO1mrR+oxoXzznLhvJMym3TI1zy2MDK3C+edsExH+720V9v7rQlXz4vpSzJooWk5dl55ju/+wodx1m995ZMazFsvKOjskfP0yPPKCH93GfrONa4qB9+uZkDLfqUQjnIPqO8pH170t7ffsf/n825aUlHkLCyKjC52vmUyj5n+fXUSGhqndSdGXrR/XEFBia+k2Du0umpkg7fUaquOpH3hdZ1Xn9Xsp+K8YYYKjrknqRuHzQ0nL0jLEhpZ2hSOvESYwZ6lZcyHupk9I2MHYUzHTOz4RhgVg7AFj6DPb0HNLlzMggqjGimWeQe00/85UamlPuvgtkitYwTeybwu3I7JE6bDvO7/xPrkKtvYTgbTQFsEexnEW8CF0horv35CU/DGZ1+YcP/9E1741caK5gk4ZZeO+c1r97YMHXP33WOGttz7+ktj2Jwgl8BJdafixhWsfw3F7F8iqBbRwQzaQeGyE/Qo1Jw4Kh09cfToCag52/U1kK/lhm3IoRu2QQO8to2+Rl/bBq/RshaJtDCdjOunaTtQEdv9MQpRFLSoxX3LgTjKtTREubBJNxIpiCqsnX0oqges7lEm33UTrcxhhFnz8IRU9lwKbtMfMPp+ux6lP1wP2w+Xn/p3JWvkO8os+4EyLSj+g+oPldoHL8+lOw50/lDJOH1e7mSJGIqm56iMcgzLNRkF5rRgCqIIY/Y0k8CtngyARYJyaEfbc0v6OR7LCWYdpb18CrMPyujxHW0Tqabfp/0ldFzP4z7Vg3OVL8iLfMf752wPIuuTjCzycgdl0Weq5w4WHD0kPsnHrk4mV48dt6Il3ODzNYRbVozjMcB7SsaVxzRSdogDoUEYx/lRNrPSQBrEeYnMv9kT5Fv1wC0jDLgljS2shmHdKdLtDxcxNS/FxaPE51EfSW6Nr1lTPvfiem0wd+K2hguHlDkEurFzZE+Uf1qncEW4j583nwb76c1slxR5h3TeGGq6J6rG6SbTNwQiz8I2FBAn99f1cJRUVBt3QfF5mCmOQWglFOlBH8qkZV+uXr1w6sqFf/0NnQbk+iVz6uouXbt96YK3FG3smHuW3ZinFt20+r6nhV8NH9daWkpb6PFJU28jaTs6kTP7wz4xrHriYYsv7pFna19oFTRRwS6oXnKFikvOtM1b49wim2EQ6+eMYwmYgswRk7MLOJCWxzhxe/s5Vko6Xel7U0j0phaAm00QI/ezZv3KeIOR5HB/ZxuOIMp+i8ljYR8asNk2BEC3DKt+I6BKr+nKDWjf8DHTzS2gm5i1bzROhPFeThNjiqVnDC9shEHjLErjagYztmnny0kz+Y/zZZgjqKgjuLtlMF4j5EONMEJ1jIAyCNRAvhQcAY54cIQQCKoO/MsXWSK8RVkXR3jmCeP5QhnGYaAM8iGuloEazzcEK/HGEccMJYdaIyvMXdNRI48QkDiPEPBtScWkIuboyMdZd6GIzBPFLNnkEsjLkGhT8n1FhcMiFUEAWXbkWnL9geJRzsJch5xX6nCGC8XcGkOhrSJ/Yo9k9Ug2Q/OkZqUgJ2R3j3FdtuidJwO1bl+NSynJrk2Wx3ODxV6Lx2MszbYmY0PlvOxQgbMsz+fMcjsNhaFgnVLamD8kWIUKowEMcpYMTtc1726SsrJHubPUPIMh35rbHBTyLaPrvEaDx1BTWyY4Suoryk2CRxr6LcH9L0mxIMPum/zHp7LCRQaLTSyNueOq2ZdndfogS/VnNcdkVbD7so0VTtHuNNqz1ycFk5wlGLN8pc0em9VkMIH/ZsgxGBTVLDrkItvQfHOJN+AwmbPiVos9x1SgWixyvsliLXQ2O2srKt2uSqfRPKW2oNWUZcpxlIcWz/gJ7X+mPOeWEa3DSgqiLXK2Uc01Fxepdq9FrjMWZEuWxpGjyzplh8mpcBm6V3SrC6SMDfJbPH6Az/t+fcMNv75BFAdfpJM38Ougv7SfJLO79DJUxzlvIF9rYq84YK/BGwNbKyRqArEXUb8vwd6REnwvC+ORa/BYA+lLcDtOIr3PJXD+wqL1PAfbACpILRmmf6+sey4hJ/Po3y2nv5YxIWOLDYd0VHl6wUtpYodI08i/Ru4njWOZLtwYuPqmrh083KfvRQrJtMPI2LXeB5jc6NIkn3fdGIZ8oY5WB7WP29H1gHftWIyw87QHMoRZGdAtzv/2PS1LMps7me+4gejSpI8wBV5EAU55jMhAgmlOeFCSCQHnYXqY41ucY4BGcvX9EKOIOjEEWyS+Y+rzBiEaDCj5oDBfLodubiyDcyYaAp9igf/0+8EP3MtP/G0M2xGjBxPOTv9Ef5c/X9Dy/RjKdya0p6KBQNSvatSBtDPX3xWAclG2jZu+8QyNTkx2xaBNSzjzMbH+VheGOp2J1L/wJX+UkMHfEo4mE0k7mUeW8D2jtE9gC8SZU6DHNBDDfGzZ8A6KiHLlf2C0mdUHrxlQH/D8ueCqDgx1Mpoe9rGN/Sjx0kG2m5MOMiealD4N+tJq2vmX+fq484nwAJKqD9L3Y9Z5wZeMPpCeJ3j7wJ5TkJk2OJPoB6f2pMXKmeQgZTiZmTsC9skpNaH08v00ou/Lh42CiGzXwbZHM2tWfsS3plXMFmh3v84k6fH/Hsc9A/Cnb0TJPdEWoe+kwGcPqoOzerYxkxi7F36W3sETYBWuqZ/imvLwvRYH9w6Iu8BhYh7XgzrZFrb5TC2Q6WaZ3rGMPkCX0AeW3TH2lR5NS/edpvW8Qn+kd9OROY/+9s1H5rRdYoF/aQ+c64UHNJptWSqm0o0W0nOCkMk4H3SLVyX75tdcCqytwyESZFt85UFlIMIcDwR9ujUsEg+YeC3xoUtwtwjML47dFah2m98bCOreoI48QeWbBG/neucuCkQC18+lX+28h/5rzg14s3iOJ+9t9rS39D68XfrY5yB9/thSDO4qSWk7U8Pn/mNT5+M/aarY8mu+qTCybRnt38rzS5x49MpbNl/52HH9bivAsgmtmGTqgiMg6HHXY1aY5fX6He0/0tmh/WLzwpXhzsTcWyZnbF3aoL1swZNGC1nTTXps3TOeInHGwMaQMgSAAQ7AuI09bPJWAclCLcHqUO3EIb9+371H6eX0SfrXV1cJpOv5S6D+sBgOU7LqVSiBabDt6Ocnnn+a/m06r8OrOBca+f8FUcr9zjhX5CTaGg8rAjOvBoRg2AXumDR1z5o1UyJzws/2Wr98up88/aW11/EOFB8XtTVTBDJlTXhOhJKpBYfoF0PoF1AwBAoObT50KO3TLGJLB++pySS9p3buO2pHxoLDDZ+mwWE13SeDzpxAZc6MOn1XPKTfy+gJvL+zM9+Z6T/mLsDwltnSGbHWQ6y/+TduhNfNyHbRQPTIoh//PCIKMe654JHIOroVqtahHh25Eqro1nXHhMdT77yTOpE68U7qHeFx+WN6zx/onvffh4V/EFENodekboRb6DrhGrgx8917poyMP4SnGFCFH5TJsWOo7g96Mb0ZN7h++YPfFnklL8zjWKaK386MVrD6wbK07x7X1ezI8CuZ/cmIs4vtZnOc9nBvczbv1EAQYZk9hfq43cFs1gof036udnWxweCBueOHzLphj77r20f0O8q4MQcyLpaBpP/TkKZrF3Xq8ZSH4cLv9arJBLLoO7029Z3hgId9i8x2j+3hWJhv3NnjulJSnv5M2Wp31PNHkqPebhl4xp+EM0/s4njohol/27r1b3Q/vZ3uZyGxy+LKN+bn/Z3+NXb1xNEmk6nI6cz95SU//uKiXK2kPLiJPvPIuFunjA6HyhSn0vPLn0OgK8epuWrCd9Dr3+l7JBEO5Lvlx359GGZfXaRqg7OGiby4s8vykRcX5qlbTWaTIbvYbHPlOpsacj6qcTVYJ8/GEk3NJZGs3GDbqFxwRvxh57xZYduYQDg3MCWZc15fidybtIjNdh//TwL4ZrzoyzARWxxn7y6hZFffxcpwWk3v/+yvlChLzpyFiz+Fx+THaDUcYwccP/s8HcUIiPR6apQ45+yOY8c4DqVtSen95cHaJhPPusJznmcmV3XYyuQx/Pz/AAfdhq542o2QsWrDMBCGfyVOSjOUDn4AdSlJiY1sMCTZ0hQHQqcM6RyMahsSKVj2EChd+wgd+wZ9s7xDz4pKl0IrkO7T3a+73wZwhU8wnNcNHhwzDPDiuIMLvDvu4hYnxx4G7M5xD9fsyXGf8q+kZN4l3e7tq5YZfDw77tDcN8ddPOLDsQef+Y574Cxx3Kd8gQU0DjiiQokcBWpwDJFhRDGGQIQEY+IV6SQU0RwGezR0GpvBQh+OVZkXNR9mIx6LKBnzlZaKz82+MUaSZGmV0k7JqJOit1hKJasy04p4TcWcmu6wJRHWMm92W4LUimsbK1JIayskYxwz2r81PlciTBBgSvv7M5BqVae6yiWPQ8Fn/McAXaJJMA1a8/9wu7FFQ2Vtf4mwE0IbW2fYyMqUWnEholAIwf/u+QXtVlqxAAAAeNpt0meTFVUUheH7DhkJEgQJgpIFhdvn7NM9gxKGCZKzKGZyUHJGySAgSq7i5wrFfYdPdFXX+tRP9V61Wl2tt8//rdbh1vueV29eWl2tYXQxjOGMYCSjGM0YxvIB4xjPBCbyIZOYzBSm8hHTmM7HzGAms5jNJ8xhLp/yGfOYzwIWsojFLOFzlrKML/iS5aygTUUiExRqGrrpYSVf8TWrWM0a1tLLOvroZ4BBvmE9G9jIJjazha1sYzs72MkudvMte/iO79nLD/zIT/zML/zKb+xjPwc4yCEOc4SjHOM4v/MHJzjJKU5zhrOc4zwXuMglLnOFq/zJX1zjOje4yS1uc4e73ONv7vOAh/zDI/7lPx7zhKc84zkveDnqwsljg1W7bVZmMrMZZjFrszG7zZ63mfSSXtJLekkv6SW9pJf00pBX6VV6lV6lV+lVepVepVfpVXpJL+klvaSX9JJe6njZu7J3Ze/K3pW9K3tXbg9915id/wid0Amd0Amd0Amd0Il3TueesJ+wn7CfsJ+wn7CfsJ+wn7CfsJ+wn7CfsJ+wn7CfsJ+wn0h6SS/pZb2sl/WyXtbLelkv62W9rBd6oRd6oRd6oRd6oRd6oVf0il7RK3pFr+gVvaJX9IperVfr1Xq1Xq1X69V6tV6tV+s1eo1eo9foNXqNXtPxijsr7qy4s+LOijsr7qy0h75rzG6zx+w115l9Zr85YA520l0Wd1ncZXGXxV0Wd1ncZama1x+EcTsAAAAB//8AAnjaY2BgYGQAgosrjpwF0ZcUq9bCaABTzgdAAAA=1

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/socicon.css?ver=20181009
200
text/css

1
ok

No Cache-Control - header
GZip: 3523/19394 Bytes




local SRI possible, possible hash-values:

sha256-e/rv9LETTG4AcU2zzLeX3+kwQS+Nk0gesLK6yqGrFmM=
sha384-aMgsSFYRkMHHlODRZpRjtNNlTtHs8bxbqfgPX12dWVmWZAOGbx2pA14GbnGhvD7v
sha512-7GEoVPpCBDIe/ih84uANs+rvFSfEM78/8iIDw6/q2q69L/m/uGIQR+FqPHkLxOO/yhllkxtDaxdAqupWKaRd6A==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/css/socicon.css?ver=20181009" crossorigin="anonymous" integrity="sha256-e/rv9LETTG4AcU2zzLeX3+kwQS+Nk0gesLK6yqGrFmM=" />



Content loaded via url("...")

../font/socicon.eot2
../font/socicon.svg1
../font/socicon.ttf1
../font/socicon.woff1

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/trx_addons/css/font-icons/css/trx_addons_icons-embedded.css
200
text/css

1
ok

No Cache-Control - header
GZip: 133901/217709 Bytes




local SRI possible, possible hash-values:

sha256-Hlzz8MXbxjv8jMFJvdnuNrVEaQ7ugJ0j3MDAJya0mr0=
sha384-PTvPP+1RLWgpRN3vXKG4G3Mx5f8JRcHloKh3iEmX3upem1klDjtmcaP+p9k57QfV
sha512-hZVJbiWcLYnH55m4ywLeAPBGQr08cxXyIWGI9AAstjlJo8tmaGleILaxEZC9ShjAO3FtQiUxopJ5FSoBNjJkWA==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/trx_addons/css/font-icons/css/trx_addons_icons-embedded.css" crossorigin="anonymous" integrity="sha256-Hlzz8MXbxjv8jMFJvdnuNrVEaQ7ugJ0j3MDAJya0mr0=" />



Content loaded via url("...")

../font/trx_addons_icons.eot?59224671
../font/trx_addons_icons.eot?5922467#iefix1
../font/trx_addons_icons.svg?5922467#trx_addons_icons1
data:application/octet-stream;base64,AAEAAAAPAIAAAwBwR1NVQiCLJXoAAAD8AAAAVE9TLzI+aVPdAAABUAAAAFZjbWFw7z8EyAAAAagAABDWY3Z0IAdn/nIAAVfoAAAAIGZwZ22KkZBZAAFYCAAAC3BnYXNwAAAAEAABV+AAAAAIZ2x5Zm4CUu8AABKAAAEwImhlYWQQbFwAAAFCpAAAADZoaGVhCDwFbQABQtwAAAAkaG10eKCb/ssAAUMAAAAEPGxvY2Hq6zphAAFHPAAAAiBtYXhwBF4ONAABSVwAAAAgbmFtZbCvFuMAAUl8AAADLXBvc3QFxGuMAAFMrAAACzRwcmVw5UErvAABY3gAAACGAAEAAAAKADAAPgACREZMVAAObGF0bgAaAAQAAAAAAAAAAQAAAAQAAAAAAAAAAQAAAAFsaWdhAAgAAAABAAAAAQAEAAQAAAABAAgAAQAGAAAAAQAAAAEDbQGQAAUAAAJ6ArwAAACMAnoCvAAAAeAAMQECAAACAAUDAAAAAAAAAAAAAAAAAAAAAAAAAAAAAFBmRWQAQOgA8pgDUv9qAFoDmwDfAAAAAQAAAAAAAAAAAAUAAAADAAAALAAAAAQAAAQeAAEAAAAAAxgAAwABAAAALAADAAoAAAQeAAQC7AAAADAAIAAEABDo6+kS6RjwR/Cw8LLwy/De8OTw6PD18PfxMfE08V7xY/G58fDx9PI28k7yUPKY//8AAOgA6Q/pGPBH8LDwsvDK8Nzw5PDo8PXw9/Ew8TPxXfFg8bnx8PH08jbyTvJQ8pj//wAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQAwAgYCDAIMAgwCDAIMAg4CEgISAhICEgISAhQCFgIYAh4CHgIeAh4CHgIeAh4AAAABAAIAAwAEAAUABgAHAAgACQAKAAsADAANAA4ADwAQABEAEgATABQAFQAWABcAGAAZABoAGwAcAB0AHgAfACAAIQAiACMAJAAlACYAJwAoACkAKgArACwALQAuAC8AMAAxADIAMwA0ADUANgA3ADgAOQA6ADsAPAA9AD4APwBAAEEAQgBDAEQARQBGAEcASABJAEoASwBMAE0ATgBPAFAAUQBSAFMAVABVAFYAVwBYAFkAWgBbAFwAXQBeAF8AYABhAGIAYwBkAGUAZgBnAGgAaQBqAGsAbABtAG4AbwBwAHEAcgBzAHQAdQB2AHcAeAB5AHoAewB8AH0AfgB/AIAAgQCCAIMAhACFAIYAhwCIAIkAigCLAIwAjQCOAI8AkACRAJIAkwCUAJUAlgCXAJgAmQCaAJsAnACdAJ4AnwCgAKEAogCjAKQApQCmAKcAqACpAKoAqwCsAK0ArgCvALAAsQCyALMAtAC1ALYAtwC4ALkAugC7ALwAvQC+AL8AwADBAMIAwwDEAMUAxgDHAMgAyQDKAMsAzADNAM4AzwDQANEA0gDTANQA1QDWANcA2ADZANoA2wDcAN0A3gDfAOAA4QDiAOMA5ADlAOYA5wDoAOkA6gDrAOwA7QDuAO8A8ADxAPIA8wD0APUA9gD3APgA+QD6APsA/AD9AP4A/wEAAQEBAgEDAQQBBQEGAQcBCAEJAQoBCwEMAQ0BDgAAAQYAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAADAAAAAAMuAAAAAAAAAEOAADoAAAA6AAAAAABAADoAQAA6AEAAAACAADoAgAA6AIAAAADAADoAwAA6AMAAAAEAADoBAAA6AQAAAAFAADoBQAA6AUAAAAGAADoBgAA6AYAAAAHAADoBwAA6AcAAAAIAADoCAAA6AgAAAAJAADoCQAA6AkAAAAKAADoCgAA6AoAAAALAADoCwAA6AsAAAAMAADoDAAA6AwAAAANAADoDQAA6A0AAAAOAADoDgAA6A4AAAAPAADoDwAA6A8AAAAQAADoEAAA6BAAAAARAADoEQAA6BEAAAASAADoEgAA6BIAAAATAADoEwAA6BMAAAAUAADoFAAA6BQAAAAVAADoFQAA6BUAAAAWAADoFgAA6BYAAAAXAADoFwAA6BcAAAAYAADoGAAA6BgAAAAZAADoGQAA6BkAAAAaAADoGgAA6BoAAAAbAADoGwAA6BsAAAAcAADoHAAA6BwAAAAdAADoHQAA6B0AAAAeAADoHgAA6B4AAAAfAADoHwAA6B8AAAAgAADoIAAA6CAAAAAhAADoIQAA6CEAAAAiAADoIgAA6CIAAAAjAADoIwAA6CMAAAAkAADoJAAA6CQAAAAlAADoJQAA6CUAAAAmAADoJgAA6CYAAAAnAADoJwAA6CcAAAAoAADoKAAA6CgAAAApAADoKQAA6CkAAAAqAADoKgAA6CoAAAArAADoKwAA6CsAAAAsAADoLAAA6CwAAAAtAADoLQAA6C0AAAAuAADoLgAA6C4AAAAvAADoLwAA6C8AAAAwAADoMAAA6DAAAAAxAADoMQAA6DEAAAAyAADoMgAA6DIAAAAzAADoMwAA6DMAAAA0AADoNAAA6DQAAAA1AADoNQAA6DUAAAA2AADoNgAA6DYAAAA3AADoNwAA6DcAAAA4AADoOAAA6DgAAAA5AADoOQAA6DkAAAA6AADoOgAA6DoAAAA7AADoOwAA6DsAAAA8AADoPAAA6DwAAAA9AADoPQAA6D0AAAA+AADoPgAA6D4AAAA/AADoPwAA6D8AAABAAADoQAAA6EAAAABBAADoQQAA6EEAAABCAADoQgAA6EIAAABDAADoQwAA6EMAAABEAADoRAAA6EQAAABFAADoRQAA6EUAAABGAADoRgAA6EYAAABHAADoRwAA6EcAAABIAADoSAAA6EgAAABJAADoSQAA6EkAAABKAADoSgAA6EoAAABLAADoSwAA6EsAAABMAADoTAAA6EwAAABNAADoTQAA6E0AAABOAADoTgAA6E4AAABPAADoTwAA6E8AAABQAADoUAAA6FAAAABRAADoUQAA6FEAAABSAADoUgAA6FIAAABTAADoUwAA6FMAAABUAADoVAAA6FQAAABVAADoVQAA6FUAAABWAADoVgAA6FYAAABXAADoVwAA6FcAAABYAADoWAAA6FgAAABZAADoWQAA6FkAAABaAADoWgAA6FoAAABbAADoWwAA6FsAAABcAADoXAAA6FwAAABdAADoXQAA6F0AAABeAADoXgAA6F4AAABfAADoXwAA6F8AAABgAADoYAAA6GAAAABhAADoYQAA6GEAAABiAADoYgAA6GIAAABjAADoYwAA6GMAAABkAADoZAAA6GQAAABlAADoZQAA6GUAAABmAADoZgAA6GYAAABnAADoZwAA6GcAAABoAADoaAAA6GgAAABpAADoaQAA6GkAAABqAADoagAA6GoAAABrAADoawAA6GsAAABsAADobAAA6GwAAABtAADobQAA6G0AAABuAADobgAA6G4AAABvAADobwAA6G8AAABwAADocAAA6HAAAABxAADocQAA6HEAAAByAADocgAA6HIAAABzAADocwAA6HMAAAB0AADodAAA6HQAAAB1AADodQAA6HUAAAB2AADodgAA6HYAAAB3AADodwAA6HcAAAB4AADoeAAA6HgAAAB5AADoeQAA6HkAAAB6AADoegAA6HoAAAB7AADoewAA6HsAAAB8AADofAAA6HwAAAB9AADofQAA6H0AAAB+AADofgAA6H4AAAB/AADofwAA6H8AAACAAADogAAA6IAAAACBAADogQAA6IEAAACCAADoggAA6IIAAACDAADogwAA6IMAAACEAADohAAA6IQAAACFAADohQAA6IUAAACGAADohgAA6IYAAACHAADohwAA6IcAAACIAADoiAAA6IgAAACJAADoiQAA6IkAAACKAADoigAA6IoAAACLAADoiwAA6IsAAACMAADojAAA6IwAAACNAADojQAA6I0AAACOAADojgAA6I4AAACPAADojwAA6I8AAACQAADokAAA6JAAAACRAADokQAA6JEAAACSAADokgAA6JIAAACTAADokwAA6JMAAACUAADolAAA6JQAAACVAADolQAA6JUAAACWAADolgAA6JYAAACXAADolwAA6JcAAACYAADomAAA6JgAAACZAADomQAA6JkAAACaAADomgAA6JoAAACbAADomwAA6JsAAACcAADonAAA6JwAAACdAADonQAA6J0AAACeAADongAA6J4AAACfAADonwAA6J8AAACgAADooAAA6KAAAAChAADooQAA6KEAAACiAADoogAA6KIAAACjAADoowAA6KMAAACkAADopAAA6KQAAAClAADopQAA6KUAAACmAADopgAA6KYAAACnAADopwAA6KcAAACoAADoqAAA6KgAAACpAADoqQAA6KkAAACqAADoqgAA6KoAAACrAADoqwAA6KsAAACsAADorAAA6KwAAACtAADorQAA6K0AAACuAADorgAA6K4AAACvAADorwAA6K8AAACwAADosAAA6LAAAACxAADosQAA6LEAAACyAADosgAA6LIAAACzAADoswAA6LMAAAC0AADotAAA6LQAAAC1AADotQAA6LUAAAC2AADotgAA6LYAAAC3AADotwAA6LcAAAC4AADouAAA6LgAAAC5AADouQAA6LkAAAC6AADougAA6LoAAAC7AADouwAA6LsAAAC8AADovAAA6LwAAAC9AADovQAA6L0AAAC+AADovgAA6L4AAAC/AADovwAA6L8AAADAAADowAAA6MAAAADBAADowQAA6MEAAADCAADowgAA6MIAAADDAADowwAA6MMAAADEAADoxAAA6MQAAADFAADoxQAA6MUAAADGAADoxgAA6MYAAADHAADoxwAA6McAAADIAADoyAAA6MgAAADJAADoyQAA6MkAAADKAADoygAA6MoAAADLAADoywAA6MsAAADMAADozAAA6MwAAADNAADozQAA6M0AAADOAADozgAA6M4AAADPAADozwAA6M8AAADQAADo0AAA6NAAAADRAADo0QAA6NEAAADSAADo0gAA6NIAAADTAADo0wAA6NMAAADUAADo1AAA6NQAAADVAADo1QAA6NUAAADWAADo1gAA6NYAAADXAADo1wAA6NcAAADYAADo2AAA6NgAAADZAADo2QAA6NkAAADaAADo2gAA6NoAAADbAADo2wAA6NsAAADcAADo3AAA6NwAAADdAADo3QAA6N0AAADeAADo3gAA6N4AAADfAADo3wAA6N8AAADgAADo4AAA6OAAAADhAADo4QAA6OEAAADiAADo4gAA6OIAAADjAADo4wAA6OMAAADkAADo5AAA6OQAAADlAADo5QAA6OUAAADmAADo5gAA6OYAAADnAADo5wAA6OcAAADoAADo6AAA6OgAAADpAADo6QAA6OkAAADqAADo6gAA6OoAAADrAADo6wAA6OsAAADsAADpDwAA6Q8AAADtAADpEAAA6RAAAADuAADpEQAA6REAAADvAADpEgAA6RIAAADwAADpGAAA6RgAAADxAADwRwAA8EcAAADyAADwsAAA8LAAAADzAADwsgAA8LIAAAD0AADwygAA8MoAAAD1AADwywAA8MsAAAD2AADw3AAA8NwAAAD3AADw3QAA8N0AAAD4AADw3gAA8N4AAAD5AADw5AAA8OQAAAD6AADw6AAA8OgAAAD7AADw9QAA8PUAAAD8AADw9wAA8PcAAAD9AADxMAAA8TAAAAD+AADxMQAA8TEAAAD/AADxMwAA8TMAAAEAAADxNAAA8TQAAAEBAADxXQAA8V0AAAECAADxXgAA8V4AAAEDAADxYAAA8WAAAAEEAADxYQAA8WEAAAEFAADxYgAA8WIAAAEGAADxYwAA8WMAAAEHAADxuQAA8bkAAAEIAADx8AAA8fAAAAEJAADx9AAA8fQAAAEKAADyNgAA8jYAAAELAADyTgAA8k4AAAEMAADyUAAA8lAAAAENAADymAAA8pgAAAEOAAAAAv/9/2oD6wNSACcAUABRQE4kFgYDAQJMQjQDBAMCRwABAgMCAQNtBwEDBAIDBGsGAQAAAgEAAmAABAUFBFQABAQFWAAFBAVMKSgBAEdFMS8oUClQFBIMCgAnAScIBRQrASIHBgcGBxQWHwEzMjU2NzY3NjMyFhcHBhYfARY+AS8BLgEPASYnJgEiFQYHBgcGIyInJic3NiYvASYOAR8BHgE/ARYXFjMyNzY3Njc0Ji8BAe6DcW1DRQUFBARUEwU1M1NXY0+ONDoJAgz3CxQKBDoCEglBRFpcATMTBTUzU1ZjUEhFNTsIAgv4CxQKBDoCEgpARFpdZoJxbkJFBQUEBANSQD5rboEICQIBEmJTUS8xPjg5CRMDMgMJFhDjCAsGPEYmKP4EEmJTUS8xIB44OQkTAzIDCRYQ4wgLBjxGJihAPmtugggIAgEAAAAMAAD/agPoA1IADwAhADUASQBcAG0AfgCQAKQAuADKANoAq0CoDAECARwEAgACVU0CBAB7c2piBAMGiwEIBcQBCwfXvAIJC88BCgkIRw0BAgEAAQIAbRABCAUHBQgHbQAHCwUHC2sACQsKCwkKbQwBAQAABAEAYA4BBAADBQQDYA8BBgAFCAYFYBEBCwkKC1QRAQsLClgACgsKTMvLpqVubl1dIyIAAMvay9nT0cLApbimuImHbn5ufXd1XW1dbGZkIjUjNQAPAA4mEgUVKwEiBh0BFBY7ATI2PQE0JiMXJg8BBhYfARUWNj8BNiYvASYFIg8BDgEfATAxHgE/AT4BLwE1JgUiDwEwMQ4BHwEeAT8BMz4BLwEmBSIPAQYWHwEWNj8BMDE2Ji8BJgUxIgYdARQWOwEyNj0BNCYjBTEiBh0BFBY7ATI2PQE0JiMFIg8BIwYWHwEWNj8BNiYvASYFIg8BIw4BHwEeAT8BMDE+AS8BJgUiDwEOAR8BFR4BPwE+AS8BMDEmBSIPAQYWHwEWNj8BNiYvATAxFyIGHQEUFjsBMjY9ATQmIwHOBAcHBEYFBwcFtAYEWwMCBTwECgJbAgIEPQH+UAIEPQQCAlsCCQU9BAICWwMCZQQCnQQDAiMDCQSdAQQCAiMD/M8IAyMCAgSeBAoCIwICBJ4EAscEBwYFtwUGBgX8LwUHBwW2BQYGBQJOBwMiAQICBJ4ECgIjAgIEngL9xgMCnQEEAgIjAgoEnQQDAiMGAc8EAj0EAgJbAgoEPQQCAlsD/ooHA1sCAgQ9BAkCXAIDBDyPBQcHBUYFBgYFA1IGBbcEBwYFtwUGLwEGngQKAiIBAgIEngUJAiMBAgIjAgoEnQQDAiMDCQSdAQajAVsCCQU9BAICWwIKBD0HBgY9BAkCWwMCBTwECgJbAusGBUYFBwcFRgUGBQcFRgUGBwRGBQeZBjwECgJbAgIEPQQJAlwBBQFbAgoEPQQCAlsCCQU9BnoBIwMJBJ0BBAICIwIKBJ0GAgaeBAoCIwICBJ4FCQIjOAYFtwUGBwS3BQYAAAABAAD/nAMgAyAAJwBEQEEhAQUEFAsCAgMmBwIBAANHAAQFBG8ABQMFbwADAgNvAAIAAm8GAQABAG8AAQFmAQAgHhsaExEODAUEACcBJwcFFCslMhYUBiImNTQ2NSUGIyImNDYzMhclNCY1NDYyFhQGIyInBRYUBwU2Aoo+WFh8WAL+/CoyPlhYPjYmAQQCWHxYWD40Jv76AgIBBiTIVn5YWD4GEAScIFh8WB6cBBAEPlhWflggnAgiCJweAAP//f+xA18DCwACAAkAFgArQCgFAQAFAUcABQAFbwAAAwBvAAMBA28CAQEEAW8ABARmFRQREhERBgUaKwEXIwUzCQEzNyElFA4BIi4CPgEyHgEBrXDhATw1/wD+/zU6ASMBG3LG6MhuBnq89Lp+AferfQGC/n5ZNnXEdHTE6sR0dMQAAAYAAP9pAxIDDQAIABEAHgA4AE0AWQC7t0lGQAMACwFHS7AJUFhAQAALAAALYw0OAgIKCQoCCW0PAQkDCgkDawwBAwQKAwRrCAYCBAUKBAVrBwEFBW4BAQAKCgBUAQEAAApXAAoACksbQD8ACwALbw0OAgIKCQoCCW0PAQkDCgkDawwBAwQKAwRrCAYCBAUKBAVrBwEFBW4BAQAKCgBUAQEAAApXAAoACktZQCUfHxMSWFdSUUhHPTwfOB84NTMwLywrKCckIhkYEh4THhgQEAUWKwEyNi4BDgIWFzI2NCYOAR4BBTIWBxUUBiImPQE0NgURFAYrARUUDgEmJzUjFRQOASYvASMiJicRJR4BFSE0NjcnJjc2HwE2Mhc3NhYHExUUBiImPQE0PgEWARMJDgIKFggEEPMJDAwSDgIK/kYXIgEgMCIiAmckGSogMiABTSAxIAEBKRoiAQF/O0j9/EY9JwQGCAQoNXY1KAQOBOMiLyIiLyICRQwSDgIKFggCDBIOAgoWCGkiF/AYIiIY8BciC/6NGiR/GCACJBZ/fxggASIXfyQaAXPiHm5CQm4eSQgEAwdKGBhKBwcI/qfwGCIiGPAYIAEiAAYAAP9qAsQDUgAHAA0AGQAqAG4AmgCmQKOBDgIBABQCAQMOAYx5AgYOckgLAw0HYwkCAw1bAQwKUgEJCwdHAAEADgABDm0ABg4EDgYEbQgBBwQNBAcNbQANAwQNA2sACQsFCwkFbQAPAAIADwJgABAAAAEQAGAADgAEBw4EYAADAAoMAwpeAAwACwkMC2AABRERBVQABQURWAARBRFMl5WIh399eHZta2ZlX11ZV1ZUIhYoJhoVIyolEgUdKwEHFzY1NCMiAxc2NycmAxQXNjMyFycmIyIGAxQeATcyNjc0Jy4DByIGBxQXHgE3MjY9ATQmJy4BJyIHBhQeAjIWNzMyFhcGBwYHDgEHFBYVBwYVJicGIxYVFAYHIiY1NDcXFjMyNjU0JiMiBgc0NjcmNTQ2MzIXAjU0NjMyExc3PgMXMhYVFAceAxcUDgIHIicuAQIUQEJcFh/QEhUTKBafWQkSCSFEKRsLCi06SBQIDAESBxYeKA4MHFgOIYpYf6sOCh+uQBQHBxgmMDIuEA0NEQMQJiISJDABFAEDTAUFEgEsHy5eEiIrHwcQYhAYHkAwNBBEIxAXWy4rSWwFKAsmIi4TKC5ZIiwWBgE0YIpXPj5TegJ/twz8JSD+AzEXDgcEAfU37AYDxHoS/kwUXFABEAcNLBEuNCgDHsYXI1FcAb2QJQ0sCRwcAQYDJBwQDAQCFRQQDwwNGkwmEkARBgcBBXMBBAceKAFYLRMSKjoICBN8Mh85RA8qECNECAEBOy04/rwNbh9SNiwCOCg89wgiNjIlU5JqPAEXIJYAAAACAAD/sQMJA1IAIAAwAHNACigBBAMaAQEEAkdLsApQWEAZAAUDBW8AAwQDbwAEAQRvAAEAAW8CAQAAZhtLsAtQWEAVBQEDBANvAAQBBG8AAQABbwIBAABmG0AZAAUDBW8AAwQDbwAEAQRvAAEAAW8CAQAAZllZQAkhISQhEiMGBRorJQYHBiMiJyYiBiMiAjU0NjMyFjMyNjMyFxYXBgcGFRQWAxQGBwYHBgc+ATceAR0BFAMJFS9ISBszMEZaHVWlfmAodBMZcChCNR0dLBQkTJ8hJB4eFCYCU2IBAqxGRW4SEiYBI4d/oiImJBQkJR00P0VwAoEiVCMeCgcDU3gXAggCBgQAAAAGAAD/+AR4AsQAAwAJAB8AJgAuAEEBOLU3AQoCAUdLsBNQWEBQAAANAQ0AAW0AAQwHAWMABQgJBAVlAA0ADAcNDGAABw8BAgoHAmEACwAKAwsKYAADAAgFAwheEAEEDgYEVAAJAA4GCQ5gEAEEBAZZAAYEBk0bS7AUUFhAUQAADQENAAFtAAEMBwFjAAUICQgFCW0ADQAMBw0MYAAHDwECCgcCYQALAAoDCwpgAAMACAUDCF4QAQQOBgRUAAkADgYJDmAQAQQEBlkABgQGTRtAUgAADQENAAFtAAEMDQEMawAFCAkIBQltAA0ADAcNDGAABw8BAgoHAmEACwAKAwsKYAADAAgFAwheEAEEDgYEVAAJAA4GCQ5gEAEEBAZZAAYEBk1ZWUAnCwoFBEE/MS8uLCknJiQiIB0cFxURDw4NCh8LHwgHBAkFCREQEQUWKwEhFSEHIgYHMyYDMjY3MwYjIiY3NDYzMh4BBxQHIRQWJTMyNTQrATUzMjY3NCsBJyEyHgIVFAceARcUDgMnIQQH/uMBHYwzPgPjClwjQgl7N7d3jgGQdE1yOgEB/pFA/VSlcm+onCwyAWqRmwFMMExCImBAQAEcLkBGKP6rApVFqTozbf66JB6rknl0mkx8TQkRPkQdXWRqKipQeBAkSDJlLhFeQylGLiAQAQAABQAA/5YDEgMzAAoAFQApAEIAZAAiQB9WPzwgAAUBRQABAAABVAABAQBYAAABAEw+PTIxAgUUKwEWBicuATY3Nh4BFy4BBw4BFx4BPgETLgEvASYHDgIHHgEfARY/AT4BEw4DBw4BJicuAycmJz8BFiA3HgEGEwYDDgIHBicmJy4CLwIuASc+Az8BNjc2FxYXFhQBxwRAHxUQDhYUKh4+CG43IyoBA1JmRH8LKAwoopoYGiILEDQPMX97Mg8yMQQKBBwTMHRsOxkoLiQLDhEDCnwBPnwMAghlDy8DGBgTjMiLUQgMCAEGHwYOBQIQEiIIG0Zp06ZWIgkBcyMsEwkuLgkLCCAKPEAZD0QmM0gJVgFhDxQCBxobBAYSDxAUAgYQDwcCFP3ODjgmKAwbGgIJBQoUHhM2bQkFU1MDFB4CE17+8BEcEghGFQ8/BhAYByqtImInDhoQEgMKGgoVMRkrCyIAAAAD////sQNaAwsAAgAJABkAOEA1AgEAAgkBAQACRwAAAgECAAFtAAUAAgAFAl4DAQEEBAFSAwEBAQRYAAQBBEw1NREREhAGBRorJSMbATMDIwMzNwERFAYHISImNxE0NjchMhYB/6RSgq219bWu1QFZXkP96UJgAV5DAhdCYPQBNP4YAjz9xLABev3oQl4BYEECGEJeAWAAAAQAAP+xBHcDCwAZADUAVwBbAOxLsBBQWEA8CQEDBAAEA2UGAQAFBQBjEAEPAAwCDwxgCAECCgEEAwIEYAsBBQcBAQ0FAWEADQ4ODVQADQ0OVgAODQ5KG0uwEVBYQD0JAQMEAAQDZQYBAAUEAAVrEAEPAAwCDwxgCAECCgEEAwIEYAsBBQcBAQ0FAWEADQ4ODVQADQ0OVgAODQ5KG0A+CQEDBAAEAwBtBgEABQQABWsQAQ8ADAIPDGAIAQIKAQQDAgRgCwEFBwEBDQUBYQANDg4NVAANDQ5WAA4NDkpZWUAeWFhYW1hbWllRTz89NDIsKignJCIRJiISIyIQEQUdKwEzDgEHIiY0NjcyFhcjLgEHIgYHFB4CMzIlMw4BByImNzQ2NzIWFyMuAQciBhcUHgIzMjY3NCYnJi8BJiEgDwEOAQcOAhYXHgIXHgEzID8BNjc+ARMRIREBtnQIXklaaGhOU14HcQMiHSAiAQYOHhY1AZVzB15JWmgBaE5SXgdyAiIcICQBBBAcFxsgyxIZAwQVMP6r/qMvCgcKAxkQARIYBAoMBBjamgFUMRUGARoQbPuJASBZZAGC3IIBYlkkKAFEQRooJhROWWQBgm9tggFiWSQoAURBGigmFCpmc3AiBQMOJCQGBAgEIXDocCEFCAYEEhIkDgQFIXACHfymA1oACAAA/2oD6ANSAAMABgAKAA4AEgAVABkALQAtQCoZGBcVFBIREA4NDAoJCAcGBQQDAgEVAAEBRwABAAFvAAAAZiopIB8CBRQrNwU1Jwc3JwElJwcnNycHJzc1DQEXNQc3JRUFERQHAQYiJwEmNRE0NwE2MhcBFnkBULq5bGwByQFRl7ormJiYTbr+sAKtbLmX/q8ByRP+NwwYDP43ExMByQwYDAHJE8bhyXwUSEj+P+FkfEpmZmY0fMnhmEiQFGThyRj+0BcN/s8HBwExDRcBMBcNATEHB/7PDQAAABcAAP9qBHcDUgBGAE4AWQBgAGUAagBvAHYAewCAAIgAjQCSAJYAmgCdAKAApQCtALAAswC2AL8A30DcOy4CDwarAREPr66VkZCPjYmIXAoKEb28u7CtrKijop2cmpmYloyLioeBfnt6eWloZ2RXVlVUT0EoIxIKHwYCDBK1s3QDDgwZDAIBCwdHAAoREhEKEm0IAQYYEAIPEQYPXgkHAgUAEQoFEWAZFxYdExwGEh4bGhUUBQwOEgxeAA4LAA5UDQELAwEBAAsBXgAODgBYBAICAA4ATLS0ZmZhYbS2tLaysaCflJN9fHh3c3JubWZqZmphZWFlYF9eXVtaTk1MS0pJSEc/Pjk4NzY1NDMyMTARERERHh8FGSsBFAYPARYVFAYPARYVFA4BJyMGIicjBiImJzQ3Jy4BNTQ3Jy4BNDY/ATU0PwEmNTQ2MhczNjIXMzYyFhcUBxcyFhUUBxceAQEzJyMHMzYyARwBBx8BNzUnBgclIxclIwYiATQ3JwcjNycHHwE/ASMXBTM3IxUXFiczNycPATM1BxYRMB0BFAcXNTcVFzcvAQcVNyclIwUXFQcXNyUnFQUHMzcXEycjJyY9AS8BAxcBNQcTIxclBz8CJjU3JwMXNgR3DgxyAg4MawESGwngCR4J3gobEgECawwOAnMLDhAKbxN0AhQaC9wJHgnfChsSAQJzDRIEaAsO/drZv0+/yQoW/fkBdAhpaAcJAXvYagE1nAkaAYECIwoRDY2lI9EJJe+6/ggCv9ACCArgJKxYbFtdAgRfEVWmfH0CcmoB7An+pXemrqX+mEwBDxcvpIVJAQEMBXgH9K3+L1tbW1sCXhtJFnMBAl9IKwIBXwwSAsYFBQwQA7wFBA0SAQoLCwsSDgQHuwISCwUFxgMSFhICwAMUCcoGBA4SDAwMDBIOAwfIEg0HCLUCEv44xcUJAbwCCwPJA2/CbAUB+m9vCf1lAwMmLDuUqyTND62/BsW7AwPSJbNde2liBQHKAQEJB2OWBq1YsIN8BJQqcAV9fRiwsqsJTp57GduMAVwDDAcJAdID/v63ARh9nv4Rnp5+fifKBQMJpf6qLgIAAAEAAP+OA+EDCwAPAC9ALAgHBAMEAUQAAQIBcAAAAAQDAAReAAMCAgNSAAMDAlYAAgMCShERFBQQBQUZKxMhAwUlNzMHFyU3ITchNyGaA0eU/j/+eyemEOsBECb9XSECohb9XgML/RiVlcZSWVm+pWsAAAAAAgAA/2oDEgNSAA0AGwAzQDAPAQMCAUcFAQBFAAAAAgMAAmAEAQMBAQNUBAEDAwFYAAEDAUwODg4bDho3NCIFBRcrETQ2MyE3ERQGIyEiJjUlJzU0JgchIgYVERQWF2ZJAZ7FZkn+TElmArBjJBn+8hokJhgB10lqyPzMSmpqShRk7RomASQb/u4aJAEAAAAAAgAA/7EDWQMLAA0AHQAzQDAAAAECAQACbQACAwECA2sABQABAAUBYAADBAQDVAADAwRYAAQDBEw1NSETIREGBRorJREhESEiBhcRIREhMjYTERQGByEiJjURNDY3ITIWAzX+eP70NEoBAYkBCzRKI15D/elDXl5DAhdDXlIBDAGJSjP+9P53SgJL/ehCXgFgQQIYQl4BYAABAAD/sQI7A1IAEwA4QDUAAQQFCgECAQJHAAUEBW8AAgECcAAEAAMABANeAAABAQBSAAAAAVYAAQABShMRExMREgYFGisBAxczFSEPAiM1EycjNSE/AjMCO6kOm/7mGU8RqKkNnAEbGU8RpwKp/rsR6BCZEaoBRRHnEZgRAAAAAAgAAAAABHcCtQAFAAkADQARABkAHQAlACkAikCHFwEIAAhvAAAHAG8ABQELAQULbQAHFgEGAgcGXg8JAgITDQIDBAIDXhkUGA4VBQQSDAIBBQQBXhEBCwoKC1IRAQsLClYQAQoLCkomJhoaDg4KCgYGJikmKSgnJSQjIiEgHx4aHRodHBsZGBcWFRQTEg4RDhEQDwoNCg0MCwYJBgkSEREQGgUYKxMzESERMxE1IxUTETMRJxUzNRchESE1MzUjNzUjFRMhESE1MzUjNzUjFbdy/te3ReVycnIuASn+17e3t0XlASn+17e3t0UCtf3bAYX+187OASn+ewGFoHJyoP3yWy5czs4BKf3yWy5czs4ACP/9/7EDXwMLAA4AHwAmAC0AMAA8AFQAYQEnS7AJUFhAF0c/NzUiBQIDEQEEAj0rKRcLAgYABwNHG0uwClBYQBdHPzc1IgUCAxEBBQI9KykXCwIGAAcDRxtAF0c/NzUiBQIDEQEEAj0rKRcLAgYABwNHWVlLsAlQWEAyBgUCBAIBAgQBbQAHAQABBwBtAAkAAwIJA2AAAgABBwIBYAAACAgAVAAAAAhYAAgACEwbS7AKUFhAPgAFAgQCBQRtAAQGAgQGawAGAQIGAWsABwEAAQcAbQAJAAMCCQNgAAIAAQcCAWAAAAgIAFQAAAAIWAAIAAhMG0AyBgUCBAIBAgQBbQAHAQABBwBtAAkAAwIJA2AAAgABBwIBYAAACAgAVAAAAAhYAAgACExZWUAVX15ZWFNSUVBPTUxKNDImJRQsCgUWKyUmJyMHDgQHJxYzMgMmJwYjFRQWFz4DPwE+AScmJw4BBzIFJgcWFz4BASIwBSYjIgcWFz4DNxMmJwcGDwEOAgcfARYXNzYWMh4CMh8BFA4BIi4CPgEyHgECOxc3AQEJHlJIShQJZ4NJIgsSrsowLRxSTkQVFQIKOUNGTWoTqQIndW8xFj5U/koBAUpniissSUAnRCggBYQCUQEFBhgSLEIpGQMCAykVKCYgIBYSBURyxujIbgZ6vPS6fg2GkAEDDCoyTisGVAFwGyM0DEV+MTFYMigHBwECeHdcJIhUhSERhYEqgAHqUVsKX3cPJh4iBv77gWQBBwYZEx4qDzUKBwIEAgIEAgYDBXXEdHTE6sR0dMQAAAAABQAA/7EDxAMQAAMAEwAXABsAHwAPQAweHBoYFhQPBwIABS0rEwUHJQUVBRU1BzUlNRc3NRc1FRcBFwUnBRcFJxMFByXgARS//u8C4/7uAf7vUr8BwP6Av/7svALkvP7vv78BEbz+7AHIq5+ynjykAQEBAaQ8Np8BAQEBnwK0n6mWlpiynwHzspapAAAEAAD/cgNZA0gAFgA1AFsAgACrQA5WAQcDNAEABwJHdAEGRUuwC1BYQDwABgQGbwAEBQRvAAUIBW8AAwIHAgMHbQAHAAEHYwAAAQIAAWsACAACAwgCYAABCQkBVAABAQlZAAkBCU0bQD0ABgQGbwAEBQRvAAUIBW8AAwIHAgMHbQAHAAIHAGsAAAECAAFrAAgAAgMIAmAAAQkJAVQAAQEJWQAJAQlNWUAUYWBSUU1LRUM/PTs6Li0qGSQKBRcrBSYHDgEHIicmIgcGFBceATI3PgI3NicmJyYjIgcGBwYXFjY3PgEyNjI2FjYXMh4BFx4BNzY3NC4CIg4BJwYuAwciBgcGFx4BNzI+AhceAzcWNjc+ATcUDgIuAyc0PgU/AT4BNz4BNxYXHgEXHgYCiwMKEUApSCMDCwgEBBM8NhwXMBgEBxgLCw0eGg0QHA4HBggOAggEBggGCggIDxIIBAUEBQ3BBgwaI0hIFA8qKjQ6IUBcAQEqECYnIFJEQhMPKiYmDBQaEg8SHER2mKyceEYBFiAwJjIWDTsLIBEUGgNIIBlgGAwULigsIBQjCwgNEgEcAgcDDAUSDgICFAwGBkoaCAkGBxgOCwQECwEICAYCBgMICAgKAgEHqQwaGBAuMAEBGB4iFgFYNz8dCwoBJComAgEiKCQBAhIaF0RyW55oQAQ8dJpbMlxIPCwiEgUeBhYODzItVhYQLA4IDCgoQkZgAAAAAAEAAP+xAhcDUgAUADNAMAABAAYBRwADAgNwAAYAAAEGAGAFAQECAgFSBQEBAQJWBAECAQJKIxERERETIQcFGysBFSMiBh0BMwcjESMRIzUzNTQ2MzICF1cwIqQWjquOjnRhUgNLkygoaqX+WAGopXpocgAAAwAA/7EDWQMLAA8AGAAhACxAKQYBAAIAbwQBAgMCbwUBAwEDbwABAWYBACAfHBsXFhMSCQYADwEOBwUUKwEyFhURFAYHISImNRE0NjcTNCYOAh4BNiU0Jg4BFB4BNgK4Q15eQ/3pQ15eQ+VGYkQCSF5KAThEZEREZEQDC2BB/ehCXgFgQQIYQl4B/lMxRgJCZkICRjExRgJCZkICRgAAAAQAAP+zA1kDCgAKABQAHgApABdAFCgmIyEYEhANAwkARAAAAGYoAQUVKwEGAAcmNTQ+ARcyFxYXBgAHJic2AAM2ADcWFw4BByYFJicGBz4BNwYHFgIJsf72QwtyxnMuxjQo2f7APTQiPgE8w0EBJscWCKP6QjoCIGxhS1Y8uHILLSQC/kP+8rIyMHXEdAFNJDM//sDaKTLXAT79V8cBKkEzOkP6pQgLHCQvDHK4PlVJYgAAAAMAAP+wArkDUwAjAD4AQwA6QDcIAQMAQAEEAQJHCQEERAAFAAADBQBgAAMAAgEDAmAAAQQEAVQAAQEEWAAEAQRMOys1JzgkBgUaKwE3NiYnISIGFxEUPwE+ATsBMjY3Njc2JgcjIiYnNTQ2FzMyNjcOAgcOBCsBIgYDDgEnJjURNDYXITIWBwM3PgECLhUDEAz+cw0SAQOiDRIRhgwQAw0HAhANpBAUARYPwQoUgAkqJAEEAg4OHBOXBwrpDCoGHiouAe81JAxYExEsAmBsDRIBFAr9mQQExA8IEAlIIgwWARYQFxAWAQ6GKdiuCgwMGA4KC/7yDgQFDCoDEx82ATw6/kdhWNYAAAYAAP9qA8IDUgAGAA8AOwBHAGsAdAEAQBhZUhMRBAMKSDECDwNJLAIHDwNHEAEFAUZLsA5QWEBaAAwREAgMZQAGCAIIBgJtAAMKDwoDD20ABw8JDwcJbQAACQEJAAFtABEAEAUREGAABQACCgUCYA0LAggOAQoDCAphAA8ACQAPCWAAAQQEAVQAAQEEWAAEAQRMG0BbAAwREBEMEG0ABggCCAYCbQADCg8KAw9tAAcPCQ8HCW0AAAkBCQABbQARABAFERBgAAUAAgoFAmANCwIIDgEKAwgKYQAPAAkADwlgAAEEBAFUAAEBBFgABAEETFlAI3Nyb25raWdjYmFfXltaWFdMSkNCPTw7Ojk3JiQiIyEhEgUYKyU0IyIUMzIDNCYnIhUUMzITFQYHFhUUBgcOARUUHgUXFCMiLgI1NDc1JjU0NzUuASc0NhcyFzITIzY1ETQnMwYVERQlFQYjIi4DPQEzNSMiJyIHNTM1NCczBhUzFSImKwEVFDMyARQGLgI+ARYBTFxYYFQhIiBFRUKWFBgJUkUWFhomMi4qFgLLJkQ+JGYmIyg0AWpONi429XwCAnwDAVIoOSMyHBAEAQsHAwwVNgR/A18IIAgvMCL+2ixALAEsQioFOHMB4SIsAVFLAQFwBwYYF0ZkDQUUFxEWDgoUFjAfqg4gPClcIQMWMD0PAw1eLk1oARr+LxkxAVQ1ExMy/qkxY24WGB46LCTEAgEDaioeFBdFagLMSQIjIDIBMEIwATIAAAAABAAA/7EDoQLDAAwAGQAzAFoAS0BIWVJORwQCCA0AAgADAkcJAQcIB28ACAIIbwQBAgMCbwADAANvAQEABQBvAAUGBgVUAAUFBlgABgUGTFVUIx1LNyISKxwTCgUdKyUUDgEuAz4CHgEFFA4BLgM+Ah4BFzQmIyIHBiInJiMiBgcUHgM3MzI+AzcUBw4EByIuBCcmNTQ3JjU0NzIWFzYzMhc+ATcWFRQHFgFlDiIuJAwCECAyHhIBYw4iLiQMAhAgMh4SWE5BF1YoYCdVGEJMASQ2UkouXi5KUjgifiIWSlRqVjIrSFxOTDoTI0wPHD1aPVJaU0o6XDsdD0yrFi4oAiQyKDQiBCosGBYuKAIkMig0IgQqLBhDXgwGBgxeQzFILBYMAggaKEySdEUrPiIUBAEEChgiOCRFdIRZLTJAOSwvFBIuKgE5QDEtWQAB////sQNIAwsAIwA2QDMSAQMCEwEAAwJHAAIAAwACA2AAAAAFBAAFXgAEAQEEVAAEBAFYAAEEAUwVJSMnJRAGBRorASEWFRQOASMiLgM+AjMyFwcmIyIOARQeATMyPgM3IwGtAZQHZrx5WJ50QgJGcKJWp3h1RGZIekhIekgwUjQoEAXzAZslInm+bERyoK6gckRxcENKepZ6ShwmNiwVAAAAAAIAAP/EBQYC9wAjAC8AXUBaDwECARABCgICRwAKAgUCCgVtAAcEAwQHA20AAQACCgECYAgBBgQFBlIMCwkDBQAEBwUEXgADAAADVAADAwBYAAADAEwkJCQvJC8uLSwrERETERUlIycjDQUdKwEUDgEnIi4CND4CMzIXByYjIg4BFB4BMzI+AzcjNSEWJRUjFSM1IzUzNTMVAyJisnVTmG5AQG6YU6Byb0FiRXRERHRFLk4yJhAE6AGCBwHkdXV1dXUBVXW0aAFAbpimmG5Aa2s/RHiMeEQaJjAuEo0kJHZ0dHZ0dAAAAAAEAAD/agPoA1IACgASABkAKABBQD4RAQADDw0CAQAcAQIBA0cABAMEbwYBAwADbwUBAAEAbwABAgFvAAICZhMTAQAlIhMZExkXFgUEAAoBCgcFFCsTMhcWFyMmJyY2NwUGByYnNjcWNxYSFyMCCQEUBwIDJicmNjsBMhYXFvYTCpU1+UeGBgoLAggbKyxjFwJ2fYOoE/wX/uMCdTgmow4tAgoKyAwSBEAB2w7M5PasCRIBx29srZ57gL7etP5e3wFzAcL+v+3YATgBJKieCQ4ODOQAAAIAAP+xA1kDCwALABsALEApCQUAAwIAAUcABAEBAAIEAF4AAgMDAlIAAgIDWAADAgNMNTQSFREFBRkrARMjBwYHLwEjExUzAREUBgchIiY1ETQ2NyEyFgHElD9XDgsXV0OTOQGVXkP96UNeXkMCF0NeASIBFq4bGDOu/u21Afr96EJeAWBBAhhCXgFgAAAAAAIAAP+OAxIDCwAQABUAOUA2FAsGAwJEAAUAAAQFAF4GAQQAAwEEA14AAQICAVIAAQECVgACAQJKAAASEQAQABAVFBERBwUYKwE3IRMhDwEvASMfATM3EyEnAyEDBSUCdwn+EhoBVgxubgdhDMoCyBz+mQj/AxJI/r7+vwIFYv7WgB0dTps3NwEwZQEG/N1aWgAAAAAFAAD/sQNZAwsACAARABoAVABtAGNAYBIBAwUBRwAKAgcHCmUADQsOAgYFDQZgAAUABAAFBGAAAwAAAQMAYAABAAIKAQJgCQgCBwwMB1QJCAIHBwxZAAwHDE0gG2plXllSUT08Ojk4NzY1G1QgUxMUExQTEg8FGisBNCYiDgEWMjY3FAYuAT4CFjcUBiIuATYyFiUiKwEiDgEHDgEHDgIWBhYGFhQfAR4BFx4BMhY2FjYWPgE3PgE3PgImNiY2JjQvAS4BJy4BIiYGARQHDgEHBiInLgEnJhA3PgE3NiAXHgEXFgI7UnhSAlZ0VkuAtoICfrp8Px4sHAIgKCL+5gQnOxRELhEcKgwGCAQCAgICAgYKDCocEDBCKkwKSixANA0cLAoGCAQCAgICAgYKCyodEC5GJlABqgMFgHMy/jJ0gAUDAwWAdDEBADF0fgYDAV47VFR2VFQ7W4ICfrp+AoKKFR4eKh4eZgQGCAsqHBAwRCZQBlAmRBgoHCoLBgoEBAQEBAgCCgsqHBAwRCZQBlAmRBgoHCoLBgoEBP6igDF0gAUDAwZ+dTEBADF0gAUDAwZ+dTEAAwAA/7MEdwNOAAwALABPAE1ASgAMAAQDDARgDQEDCAECAQMCYAABAAAFAQBgCwEFCgEGBwUGYAAHCQkHVAAHBwlYAAkHCUxOTEpIQkA9Ozk3JiIjJRIjJDMyDgUdKwEUBiMhIiY0NjMhMhYXNCchIiY0NjMhLgEiDgEXFBchMhYOASMhHgEzMj4CNxQGKwEWFRQOAiciJicjIiY0NjsBJjU0PgI3MhYXMzIWAzAaFv55FBwcFAGHFRx3Df3cFBwcFAH7MaTEqGIBDAIkFRwBGhb+BjGkYUqGYjrPHBRJCUh8ql2J4jdqFBwcFEoKSnqqXoniN2kUHAGCFBwcKBwcFDAvHCccUF5iqGIwLxwoHE9eOmCI2BMcMC9drHhOA5R5HCgcLzBdqnxIAZZ4HAAAAAQAAP+wA1kDCwAbADYAUgBuAElARmk0HQMCA2NiW1pWUEtKQismJR4bExIOEQECQT0FAwABA0cHAQMCA28GAQIBAm8FAQEAAW8EAQAAZm1rYF8ZJy8YHicIBRorJQ8BDgEnDgEnIiYnNDY3JjY/ARcHBhQWMj8CAxcHJyYiDgEfAQcvAS4BNy4BNTQ2MzIWFzYWARQGIyImJwYmLwE3FxYyNjQvAjcfAR4BBx4BAxQGBxYGDwEnNzY0JiIPASc/Aj4BFz4BNzIWAlVZZSRiLglAKC9CATImDBokB1QGFSk6FWVaagdVBxU6KAIWvlRaZSYYDicyRC8qQAcvXgHnQjApQAgwaCYGVAcUOioVEa5VrhAkGgwrOAE4Kw4aJQZVBxUqOhS/VVpVECVoLwZALC9E+1lmIxoMJzQBRC8pPgkwYiMHVQYVOikUZlkBKAdVBxUqOhW+VVlmJWgwCEAoL0Q4KAsa/YgvRDYnEBgmB1UHFCg8FBCuVa4RI2IuBkICSitCBTBmJQdVBxQ6KhW/VVlVESUaDyo4AUQAAAACAAD/+QR4AwcAGwBPAFNAUBQAAgcBOwEFBzwkAgQFIQEDBARHAAIBAm8AAQcBbwoBBwUHbwgBBQkBBAMFBGAGAQMAAANUBgEDAwBYAAADAExOTEVDIyQmIyUmIyk1CwUdKwEeAQcUBiMhLgE1NDY3JjU0NjcyFz4BFzIeAQcFFBYzMjcnJicGIyIuATYzMh4FFzI2JzQmJyIHFzYzMhYHFAYjIiYvAi4CByIGA+09TgGEXf1NX4Q+MwdcQTUrKqRkXZxcAf0YXkVNORoRCCUrHyoBLB0YLiQkKC5AI0ReAV5EUDc0JSodLgEqHxgsEiUnFC4+I0ReAaMZcERbggaAXT1oHhYYQFoBIVZqAVqaW6hEUDgfFAgkJjsmGCQwLCgUAlBCRE4BNjwjJB0gJhYUKi4YIhwCTgABAAD/+QPoAmYAYAA0QDFZJiUABAIBAUcGAQQHAQECBAFgBQECAAACVAUBAgIAWAMBAAIATCwvKScoJSwrCAUcKwEUFx4DFxYVFAYjIi4FLwEuAyMiDgEVFBYzMjc2NxcGBzEGIyIuASc0PgIzMh4GFxYzMjY1NC4GJyY1NDYXHgEXMR4CFwcmJzEmIyIGAtEGBRIaGBO1dlMhOiwqHCAQDhQSIjBELTViOHZYYy0fDy8IEEmPUopKATBSbjsxUDowICIWIg41TS1AFiIuMDIoIgQCYj4rMBoGDg4ESA8PDSobJgHJAxQQFhAGBzKHUWwUIDIwRC4lNS06MhY+ZDVZhjUkHVUTFFVYkFE7cFQ0FiI2OkhCUB9wNi0YIBQQDhgiOCkJCT5aAQIMGAYQGAM3GwwMJAAAAAADAAD/sQR3Ar4AFgArADsAcEBtEwEHBC8fAgwKOTQqJBoFAQYDRwcBAEQLAQoHDAcKZQ8NAgwGBgxjAwEAAQBwBQEECAEHCgQHYAkOAgYBAQZUCQ4CBgYBWQIBAQYBTSwsGBcsOyw6ODYyMC4tKSciIB4cFysYKyIjEiIiERAFGisBEyInJiMiByYjIgcGKwETNjMyFzYzMgMyFhcDJiMiByYjIgcDPgI3Mhc2NwMGByYjIgcDPgEzMhc2FwQgV0lHb2x+U1J+bHBHRQNXfZCCVVaCkJdIdFdFYG59VFN9bmBFO0RgNHBgYIgfdlNUfGJaP0V0QnRcYHECd/06IDNTUzMgAsZHOzv9kyAlAjosT08s/cYYGhIBPT0SAfsDVFcl/fMcHDk8AwAAAAADAAD/zANZAv8AAwAOACoASkBHIgEFAQFHBwkCAQgFCAEFbQYEAgAFAHAAAwACCAMCYAAIAQUIVAAICAVYAAUIBUwAACknISAcGxYUERANDAkGAAMAAxEKBRUrExEjETcUBisBIiY0NjIWAREjETQmIyIGBwYVESM2PQEnMxUjPgM3MhbDuMQ6LgEuODpcOAKLty4wIy4NBrgBAbgBCxgmPCJfdAH1/dcCKaspNjZSNjb+QP7DASg7QiYdERz+y9+KpRtQEhogEAF+AAAJAAD/aANWA1MABwAOACEBAAENARwBKQE9AeEDLEuwClBYQSsBHQEKAHUAawBgAFkADQALAAcACQAGAAMBGgCcAAIABQAEAMAAMQAkAAMAAAAFACIAAQAIAAAB2wFwAAIAEAAIAPcA2wACAAcADgDfAAEACwAHAAcARxtLsAtQWEErAR0BCgB1AGsAYABZAA0ACwAHAAkABAADARoAnAACAAUABADAADEAJAADAAAABQAiAAEACAAAAdsBcAACABAACAD3ANsAAgAHAA4A3wABAAsABwAHAEcbQSsBHQEKAHUAawBgAFkADQALAAcACQAGAAMBGgCcAAIABQAEAMAAMQAkAAMAAAAFACIAAQAIAAAB2wFwAAIAEAAIAPcA2wACAAcADgDfAAEACwAHAAcAR1lZS7AJUFhAagAJDwEPCQFtAAMBBgEDBm0ABgQBBgRrAAQFAQQFawAFAAEFAGsAAAgBAAhrAAgQAQgQawAQDgEQDmsADgcBDgdrAAcLAQcLawwBCxEBCxFrAA8CAQEDDwFgABEKChFUABERClgNAQoRCkwbS7AKUFhAcAAJDwEPCQFtAAIBAwECA20AAwYBAwZrAAYEAQYEawAEBQEEBWsABQABBQBrAAAIAQAIawAIEAEIEGsAEA4BEA5rAA4HAQ4HawAHCwEHC2sMAQsRAQsRawAPAAECDwFgABEKChFUABERClgNAQoRCkwbS7ALUFhAZAAJDwEPCQFtAAMBBAEDBG0GAQQFAQQFawAFAAEFAGsAAAgBAAhrAAgQAQgQawAQDgEQDmsADgcBDgdrAAcLAQcLawwBCxEBCxFrAA8CAQEDDwFgABEKChFUABERClgNAQoRCkwbQGoACQ8BDwkBbQADAQYBAwZtAAYEAQYEawAEBQEEBWsABQABBQBrAAAIAQAIawAIEAEIEGsAEA4BEA5rAA4HAQ4HawAHCwEHC2sMAQsRAQsRawAPAgEBAw8BYAARCgoRVAAREQpYDQEKEQpMWVlZQScBzgHNAb4BvQGpAacBdQF0AVsBWgFXAVYBVQFSAU0BTAEwAS8A/QD8APQA8wCnAKUAoQCgAIkAiAB5AHgAaQBoAF8AXgA3ADYAEgAFABQrAQ4BIwY1NDcXBiYHNhcWByIOAgcGFzI2NzQ2NDInNScmBTQnNz4CJjYmNCYnLgEnFhcWBwYHBi4BJy4BLwEuAScuBDYmJy4DNjc2FgcGFjc2PQEuAi8BBhcUIy4BBjU0JiIGBxQeATc+AQciJic0NhcyHgEHDgIVDgEXHgMXFjc+AT8BNjc2Fx4BBgcGDwEOAScmFBcWMz4BPwE2FhUUDwEGDwEOAQ8BDgImJyYHBhUUDgIXDgEHBhQHBicmJyY3NiMHBhcWHwEWHwEeAQYHHgIXNicuAS8BPgEXFjc2NzYWBxQHBhYzPgE1Ni4BNzYzNDYWATYmIyYVFjMyBwYzMhcuBgYjBhYXMjYnNC4BDgEfARYXFDc2NzQuAScmIgYWDgEUFj8BNjc0MjYBHgEGFA4CIgYnDgEHDgEnLgMnIyIHIg4CLgEvAS4CJyY2NzYuATY3PgE3PgE3FgcGJyYHBh8BHgEUFgYWFxYfAR4CNz4CJi8BJicmBwYnJjU+Aj8BNj8BNjc2NyYnJjY3NjM2FhceAQcGFxYXHgEXFg4BBw4DIy4CLwEmNyYOARcWBwYWNjc+ATc+AS4BJy4BNjceBQFyBgYBAwo3AwgGDgQCxwMCAgQEBQUCCgICAgEBAQHdHwQCAgICAgYEAgUqEw0TMBIGFhEIAgUFDAUJBAYBCBIQCgYMCBQJIAgEDA4VEAYGCgwHAwoMBw88CgEFFhASHxACBAwCBgUGBAgCCg4KCgICDAoWBwQGCAwGEAsbHgEYBxEKAgUGAgIECAsUGRkdHgUKDhcKFAoxBQoBAgECBQMEAwYPLCAXFwwCARAQCAoNLAQBAwQMEgIBAwIDAhQaAwsNCy80CQISEAQYBgEaFgIIAQECCgYaQ0oZDQwBDQUEDAEOAQgCDgkUJir+rgIGAwUBAQYCAQYB6gEEDAUEBAICAgcWCwUGZAYGBQQCAwgCBQEeAggCCAoEBAMGBAIGBAUKBgE9Cw4CEggaCBwBFTYPCToVCgwGFBBoFQsZKBQcIFwjOQoYDAQFEgEBBgYCBQcwChEMAQweEhwTBQcKBAMEARICEwwjOA04JA0YGAIKBgtDGyYZBgMBAQoQBQ4KBxEKCz4IBwIBHC0WJB46FSAmAgMTEzgeMggFBAoGBRAOIBIKDgwBBwYBDBYICAsLBR40FSEiKR4aBhYRExICBwEICA4KDgJtAQoBAwcCCAEKAwYHA/AECgYEBgEIBgIEBAICAQHICg4PBxAIEAYSBhYDGz4LCyRaQRYBAhhGGRUiCA4GBAIjLhAWFyQSBQIQAhwcAQIkDwoKBQISFREWDAIEBEYJBQICBB8mIBEIGBIBAgsBEAsMEgEYFAIJDgwBCBACBAwKBAIBCQEGAwcEBggDAgYIAQMJCwsFBAEECA0BBgUaAwQEAQEDAgECAQQBAggiDg0jEQUCBA4iHCYQA14gCjgFDgwRJA8QCgMkOAcJCw0mKgkaFgIIIB4YDSYFCAMDAwYFHQkJKBUIGg0mDRAKQhEMOjIOChUSBgHECRABBQMJC2wEBAIEBgIGAgkeAwp9BgoEAQIBAgIPAgMBgwEEAgMICAYHBgQFAgUDAgEC/RYGDg4KEAQSEgILKBAJBAoFEA4IAQIQEg4BIgcKAggIBwwyBQkcEhgDBgQEChQSKRILAwEHCBgKBwYMDyYRBQQHCwMSCAIDGB4kCxRqHSoTBQ0JDBAaGgsoHA8jFApPHT9uM0QYDAEQEBdYJzVCPzshdDAcKBQDARIWEAEEDAIMCgEUCC4fJ0YkKAITHBIPChQUDAcGKiYIEhwSDAoEAAAAAAEAAP/5A9oCwwAVAClAJg4BAQFGBAICAAEAcAAFAQEFVAAFBQFYAwEBBQFMIhERESMRBgUaKwEDIxM2JisBAyMTIwMjEychMhYXHgEDzly6YwgfH19yunKgcrpyVQLIOGIiIRgBo/5WAdAfJf3sAhT97AIUtiwqKGwAAAAEAAD/sQNZAwsADwA+AFMAYwBYQFUXAQECAAEAAU4BBAADRwANAg1vCQMCAgECbwsIBgMEAAoABAptBwUCAQAABAEAYAAKDAwKVAAKCgxYAAwKDExiX1pXUk9MSUVCNCU0JTQyNSYkDgUdKwEVFAYnIyImPQE0NjczMhYFNTQmKwEiByYrASIGHQEUOwEyPQE0NjczMhYdARQ7ATI9ATQ2NzMyFh0BFDsBMiU1NCYrASIGFxUUOwEyPQEWOwEyNhMRFAYjISImNRE0NjMhMhYC3BANcQ0QEA1xDg7+7yQeSiYPECZJHSQLHwwQDTUNEAsfDBANNg0QDB4MAUkmHZMdJgEMHwsSI2oeJEdMNf2qNkxMNgJWNUwBfD8OEAEODz8ODgEQjYseJB0dJB6LDAyADg4BEA2ADAyADg4BEA2ADEFWHiQkHuQMDGQXJAF1/ao2TEw2AlY2TEwAAAACAAD/sQPoA1IAEgAbAAi1GRQCAAItKwERBy4CJzQ+ATcVDgEVFBYXEQUXJTcmJzUWFwJemH/QdgFwxHh5nKyDAg0V/ttSQlqacgNS/KdIDFqQUE6KXA5gFX5PVYARAvf72T8vJxBgE0UAAAAB////agMOA1IAbQBUQFFYUE88OjAlBwMEZSMVCgQABgJHHQEGAUZEAQRFAAQDBG8AAwUDbwAFBgVvAAYAAAIGAGAAAgEBAlQAAgIBWAABAgFMbGthYFdWKCcjJxQHBRcrJQ4DIi4CLwEOAQciJj4BMzI2Nw4CLgMnPgEeAhc2NyIOAS8BLgQnPgEeBR8BNjUnLgQ2Nx4EBg8BBg8BFTc+BBYXDgMPAQYmBi8BBgc2PwE+Ah4BAw4RMjQ6ODQsIggKP8R1ChACDAxhpjkUKDQyNjAuE0BwSkIgEB0PBAwoEy4bLDIiGgMnRjgwIhwSDgICBgwIJiAcChgbKTwiFAICBgsFBAQFAxweMDZIJgEWIiwXMBkmJgcJDRwDBxwVLEJCTustQCQQCg4QBQaAkgEOFg54aAgKBAYaKEgtGwoSLCoZSVkCAgIFAxQcLD4oEAgIGh4mIB4HCUQpCAUoKEA+UCUOKC4wNCwUIw8ICUQKBiQeIBICDStILCQHDgcEAgMCUkwEBhcRGBgCGAACAAD/agNaA1IAJgBEACxAKQAFAwVvAAMCA28AAgACbwAABABvAAQBBG8AAQFmQD04NjEsODYzBgUXKwEWBwYhIyIGDwIOASsBIiY/AT4CNzY7ARY3Njc2NzY3NjI2FxYnFAcGBwYHFCMnIgcGAxQrASImNxM+ATchMhYXHgEDUAoNMP71GA4WAgMfAxYOjAwMAQ4JDBIGAxVJSzliPjkeDQYBAgICLFUaLXtATTIzNwoCLgekDBIDggIaEAFNE0gaPD4B6i9D+BIPC8kPEhAMXj5AeiEVAg0WOzVUJyMEAgMhZDxIgi4WAQEBNgT+3QYSDQM1EBQBDgsXXAAKAAD/bwRaA1IAggC8AMoAzgDbAOIA5gDoAOwA7gEhQDy4owIKC5R9fHJubQYGCd7cAgcG3YJXAwAHzAEBAF9BFwMFAc7NIyAECAXXAQwO5uUOCgQNDAlHsJwCC0VLsChQWEBYAAsKC28ACgkKbwAJBglvDwEGBwZvAAcAB28ABQEIAQUIbQACBAMEAgNtAAMOBAMOaxABDgwMDmMAAAABBQABYAAIAAQCCARgAAwNDQxUAAwMDVkADQwNTRtAWQALCgtvAAoJCm8ACQYJbw8BBgcGbwAHAAdvAAUBCAEFCG0AAgQDBAIDbQADDgQDDmsQAQ4MBA4MawAAAAEFAAFgAAgABAIIBGAADA0NDFQADAwNWQANDA1NWUAk5OPi4NvZycfAv6Cfk5B2c2RiWlhVU0RCPDotKyopFRQQEQUVKwE2HgMXHgIXDgIHLgUjDwEWFx4EHwEWFB8BFA4CByYGIyInJjU0Nz4CJyYHDgEnIi4BJyYnBCMiLgE2NyUmNDY/ATYyNzI2MzIWFzYzMhYUBg8BFQYWMzI2NTQuAjc0Nyc2NTQnNjMyHgUXNw4DBzcuAy8CJgYnLgEGJyMiBz4CPwE+ATceAjsBFRc2PwE+Bz8BBgcOAQ8BBgceARUUAz4BMzIeAxcGIyInAzcXBxcWFA4DByc+AT8BAwcnNzYzMhMzFwcBNR0BBzU/AQKqKkw4OCYXEzIiJhpEVhUZIBISHjIsBQMCBQMYBg4GBAYCAgEEBAoBFEgTFhIBAQEiHgENCxRUIg44QA4EC/7zEgkMAQoHAQ8EBgYLBRACAwwECA4EWwUKDgoIZgFcDRpQGh4cAQYmGAMuIhkeGAwKCAoJGwEWGhIBIgIKBAgBBQQEAgQECA4FKEYzCRYoEBoKJAYHEhIMBg2KRRwNFBIODgwOEAkEAhYtjGUzDAoCGIoWaB0FEA4QCgNDRSIjkxs8KOgCFB4gGgUEDCwSIvg1BBMNBgp2EQYXAfABAQEBTAEaJkQ0Kh88HCQRHiQIFFhgaFQ2AQIDBQMUBBIECg8FGAsSDyIYKgkBDAYJESkNByAiCwEOHjQBRlYKAw4+DBEOATsIDAgCBAIDCBIKFQwSDAIWCQ9mWhsUEgQIDwkKCxgpDhIJAgYKEhIkDw4XFgIECngDCggEBAQEBAIEAQQCARgREhAMFAguBQUaDioBNTUWChYMGgoeDCoJBR4wXG4ZCQIGCiACB/30DhgQIBgiARkGAcEHYxuqCAQKBAYCAhgBCAECAV8LCQQD/pkuBwN0AQECAQECAQAAAAEAAP+xAsoDUwBKAEVAQiMBBQITAQEDAkccAQFEAAIEBQQCBW0ABQMEBQNrAAAABAIABGAAAwEBA1QAAwMBWAABAwFMRUQ7OTEvKScoJQYFFisRND4DFzIeARUUDgMnIiYnBw4FDwEnJjU0Nj8BJjU0NjcyFhUUDgEWMzI+BDc0JiMiBhUUHgIVFAYjJy4DKkpgbjpYmF4UMEBgOiZKEQ8KCA4QEiISBwUJGBkdEjotIiYwATIkHzQkGhAGAXpjb5YOEA4QDQkdLBgMAgU8alA6HgFKjlk2ZmBGLgIkHz8pGDgWMCgcAwZYETOAYXEkOi9QAS4iJYpHLhwwOkA8GmBskG8ZLhoaBA8yAQksPjoAAQAA/2oD3wNSAGYANkAzX1kaCAQBAFM2MgMDAQJHAAABAG8AAQMBbwADAgNvAAIEAm8ABARmSEVCQTw6JyYsBQUVKxMmNTQ2NyY2NzQ2NzYzMhceBh8BFhUUBh0BFDIHHgEHFAYjIi4FIwcGBx4CFw4BBwYjIi4BLwEuAQcOASMiLgM3NDY3PgE/ATY1Jy4BLwEiBw4BByMiJicmNTSXBQwIAQoIZkdNZ0tKGy4iGhYODgUBHwoEASsyARYUBQwIDgQKAQEDISkMLh4FAQIDJIUdQC4jDQgkBBdgLhQmQi4mAQwRBiAMCAEBG0IIAwIFCigXAQICAg0BkAsSCyIIDCIHTqYiJR8LHiIqKDYuIAIvJQgeBgICAkBwPBhACAwQDhACAlYnCxQaGAIOAzYKDAsEAgIBGRYCCA4gExcUEgEMAQEBAQIGaCQCDBckAwQBHxmaAAUAAP9oA+gDVAAPABgAIQBLAFwAa0BoMyopAwgJOSYCAwZJQAICAwNHAA4JDm8ACQgJbwoBBwgGCAcGbQAICwEGAwgGYAUBAwQBAgEDAmAAAQAADAEAYAAMDQ0MVAAMDA1YAA0MDUxZWFFQRUQ7Ojg3MjAUEhQTFBMWFxMPBR0rJRYHBiInJjc2MhcWMjc2MicUDgEmNDYeARcUDgEmNDYeATc0JgYHJic3FxQWPgEuASciBycmDwEGByYiBhcUFhcGFRQeATY1NCc+ATcUDgMuAjQ+Ah4DAmMJCSKaIgkJAwoEG4YbBAqoHigeHige3B4oHh4oHowmOhNIZSNwHCoeAhoXHg58CgQmZUgTOSgBFBIEntucBBEUyFCEvMi8hFBQhLzIvIRQxwkIIyMICQMDHBwDYhUcAiAoHgIcFRUcAiAmIAIaLBsoAhMyBJ4aFB4CHCocARwcAwyuBDIUJhwUIAgQEE9wAXJOEg4IIANmuIhMBFSAwMTAgFQETIi4AAMAAP+xA1kDAwAIABIAHAAUQBEZFQ0JBgMGAEUAAABmEQEFFSsFBiInPgE3HgEDERQGByY1ND4BARQHLgEnER4CAnhf22BNbhITbsiOcWVeogJZZXKMAWSkXBo1NTCMT1CKAuz+8YzoN3icaLZ2/myceDfojAEPEXi0AAAFAAD/xgR3AvcADwAfAC8APwBcAF1AWlEBAAkIAQIAGAEEAjAgEAAEAQYERwACAAQAAgRtAAQGAAQGawAKAAACCgBgAAkABgEJBmAHBQMDAQgIAVQHBQMDAQEIWAAIAQhMVVNQTjQmJiY1JiYmMwsFHSslETQmKwEiBgcRFBY3MzI2JxE0JgcjIgYHERQWNzMyNic1NCYrASIGHQEUFjczMjYnNTQmByMiBh0BFBY3MzI2JRQGIyEiJjU0NjcmNTQ2MzIXPgEXMh4BFRQHHgEDRRAMNAsQARIKNAsSnxIKOQsQARIKOQsQohIKOQsQEAs5CxCiEgo5CxAQCzkLEAMXhFz9SVyERjsGWj85LBmmalOMUgdLYFUBmQwQEAz+ZwsSARAMASgLEgEQDP7YCxIBEAzvDBAQDO8LEgEQDMoLEgEQDMoLEgEQXVyEhFxBbhwTFj9aJmaEAVKMVCUfEnoAJwAA/40DWQNSAAQACQANABEAFQAZAB0AIQAlACkALQAxADUAOQA9AEEARQBJAE0AUQBVAFkAXQBhAGcAawBvAHMAdwB7AH8AhQCJAI0AkQCVAJkAowDQA3ZAN8YBQAfEAQkGr6sCCwixAT49PyMCDDoFR0FAPTw7OTg3NTQzMTAvLSwrKSgnJSQJCAUEAwIcDERLsAxQWEC7Vi8CHiAFIB5lADsFBEA7ZQAAAAIPAAJeTh1NG0wZSxdKFUkTSBFHDw8cGhgWFBIQBw4DDw5eQQEDAAEfAwFeLlUsVCpTKFImUSRQIg0fLSspJyUjIU8IIB4fIF4wQgIFVzECBAcFBF4yQwIHWDMCBgkHBl4AQAA/PEA/YTREAglZNQIICwkIXgA8AD0+PD1gNkUCC1o3AgoNCwpeOEYCDToMDVIAPlwBOgw+OmA4RgINDQxWWzkCDA0MShtLsB1QWEC8Vi8CHiAFIB5lADsFBAU7BG0AAAACDwACXk4dTRtMGUsXShVJE0gRRw8PHBoYFhQSEAcOAw8OXkEBAwABHwMBXi5VLFQqUyhSJlEkUCINHy0rKSclIyFPCCAeHyBeMEICBVcxAgQHBQReMkMCB1gzAgYJBwZeAEAAPzxAP2E0RAIJWTUCCAsJCF4APAA9Pjw9YDZFAgtaNwIKDQsKXjhGAg06DA1SAD5cAToMPjpgOEYCDQ0MVls5AgwNDEobQL1WLwIeIAUgHgVtADsFBAU7BG0AAAACDwACXk4dTRtMGUsXShVJE0gRRw8PHBoYFhQSEAcOAw8OXkEBAwABHwMBXi5VLFQqUyhSJlEkUCINHy0rKSclIyFPCCAeHyBeMEICBVcxAgQHBQReMkMCB1gzAgYJBwZeAEAAPzxAP2E0RAIJWTUCCAsJCF4APAA9Pjw9YDZFAgtaNwIKDQsKXjhGAg06DA1SAD5cAToMPjpgOEYCDQ0MVls5AgwNDEpZWUDym5qWlpKSjo6KioaGgIB8fHh4dHRwcGxsaGhiYl5eWlpWVlJSTk5KSkZGQkIeHhoaFhYSEg4OCgrCwby7tLKurKmnoJ6ao5ujlpmWmZiXkpWSlZSTjpGOkZCPio2KjYyLhomGiYiHgIWAhYSDgoF8f3x/fn14e3h7enl0d3R3dnVwc3BzcnFsb2xvbm1oa2hramliZ2JnZmVkY15hXmFgX1pdWl1cW1ZZVllYV1JVUlVUU05RTlFQT0pNSk1MS0ZJRklIR0JFQkVEQx4hHiEgHxodGh0cGxYZFhkYFxIVEhUUEw4RDhEQDwoNCg0UFRBdBRcrESERBS0BESERBQE1IRUXFSM1FxUjNRcVIzUXFSM1FxUjNRc3FwcXNxcHFzcXBxc3Fwc/ARcHPwEXBz8BFwc/ARcHARUjNTMVIzUzFSM1MxUjNTMVIzUzFSM1MxUjNTMVIzUFFSM1MxU3FSM1MxUjNTMVIzUzFSM1MxUjNTMVIzUXNSM1MxUHNTMVBzUzFQc1MxUHNTMVBzUzFSUiLgE2FzIWFAYnFB4CMhYXFCMiJyMHFjMyPgInNC4BIiY0Nj8BMhYXMzcnJi8BJgciDgIDWf5P/lgDIf0XAXEBeP0XLRUVFRUVFRUVFSQIOwkRCToIEQg7CRIIOggsOgk7QzsIOkM7CDtDOwg6/elAmkCaQJo/mkCaQJpAmj/9nBVBWkCaQJo/mkCaQJpAhitAFRUVFRUVFRUVFf6fSGYBaEdJZmalFiIkJBQBPzYPARImNRAeIBQBHi4qIBgKFxMqBwIRIwcGGAgFECAcFANS/Pe8vCUCBP38pQLhcHCmQEBTQEBSQUFTQEBTQEBPExsSCBMaEwcTGhMHEhoTExoSGzUaExo0GhMaNBsTGgKwFBQUFBQUFBQUFBQUFBQUFL4sQBQUFBQUFBQUFBQUFBQUQCwUQFJAQFNAQFNBQVJAQFNAQBRmkGgBZpFm1BQWBgIKDBscIxgGDBoQGhoEBBgOAQIMDSAOAwEFAgIGDBoAAAAAAwAA/6oEdwMSAAgAEQArAC9ALAcBBQYFbwAGAgEAAQYAYAMBAQQEAVQDAQEBBFgABAEETDMTNTUTFBMSCAUcKwE0JiIGFB4BNiU0JiIGFB4BNhMRFAYHISImJxE0NjczMhYdASE1NDY3MzIWAeJafFhYfFoB4Vh8Wlp8WLQkGPwBGSIBJBjxGCQBpSQY8RkiARI/WFh+VgRePD5YWH1YAlwCAP0QGSIBJBgC8BkiASQYWloZIgEkAAIAAAAABHcCrQAAAFgAX0BcV0ACBwABRwAIBwYHCAZtAAoACQUKCWAABQACAAUCYAsBAAAHCAAHYAAGAwEGVAADAQEDVAADAwFYBAEBAwFMAgFTUUdFPj07OTUzLSsmJRgWEhAIBgFYAlgMBRQrARcyFhcUBgciLgcjIgYXFBYzMjY/AT4BFzIWFRQHDgEiLgEnNDY3Mh4FNzI2NTQmIyIGJyImJzQ2NTQmIyIOAgciJjQ3PgEzMhYVFAc2Ax6RU3QBelgvVkRAOjo+RlAxVm4BdFk4eDALCRAECAwiOJSSfkoBnnNDdlpOTkZiLzlKSDUQOgkMEAEKeFkgPCIcBQgMDiFiNWqOAiACDXJuUld0ASAyREhMQjQeZlVYaCoiCggMAQwHDh0yPEJ2S3OWATBOXGBMMgFEOTVIFgEQDAosC1h0FBoSAQoUDyYojGoUEAgAAAACAAD/sQNZAwsAPQBdAGZAY1MBAgkMAQEATAEEAVwBAwRDAQcFBUcACAkIbwAAAgECAAFtAAEEAgEEawAEAwIEA2sAAwUCAwVrAAYHBnAACQACAAkCYAAFBwcFVAAFBQdYAAcFB0xWVCoiJiQkLyUlLQoFHSsBNC4DLwEuAyc0MzIWHwEeATMyNjU0LgEHIg4CBxQeAh8BFhcWFAYnIi4DIyIGFRQWFzI+AhcUBiMiJwYjIi4CJzQ3JjU0NjMyFzYzMh4CBxQHFgKPFiAyKhxTCBYMBgFQGCYLFQoaDhogQF42Jkg+JAEULCwkUTMMEi4jHSweFCAOHByIXilKQCLMflhJOisoUJJqPAEJLX5YSTorKU+Saj4BCCwBARwuHhgOBhQCCAoOCSsMChMJDiQZHzAcARIiPikiNCAWBxQMCAssHgESGhgSIhg0SAEUKEBPWX4tCT5qkFEpKzpIWX4tCT5qkFEpKzoAAAAAAgAA/7EDoQNSAFIAVgBUQFFWVU9FOzowBwAFUCYCBABUJRsREAYGAQQDRwAGBQZvBwEFAAVvCAEABABvAAQBBG8DAQECAW8AAgJmAQBJR0JANzUqKB8dGBYNCwBSAVIJBRQrATIWFxQPARcWFRQGIyImLwEHFxYVFAYjIiYvAQcGIyImNTQ2PwEnBwYjIiY1NDY/AScmNTQ2MzIWHwE3JyY1NDYzMhYfATc2MzIWFRQGDwEXNzYFNycHA1AiLgE0YB8EMCAaLAcfrR8ELiIbKggfVRELIi4gGFc7Vw4NIS4eGVgeBC4iGiwHHq0eBC4iGiwIHVsLDSEwIhhYO1sN/lKtO60BoS4hNhMhXQwOITAeGVw7Ww4NITAeGlseBSwjGioJHa8eBS4hGiwHHlgODSEwIBhZO1kNDSEwHhlaHwMsIRkoCR6xIASSOrA8AAAABAAA/18D5gNTAAkAEwA3AGEAQ0BAXlUdFAQAAQFHTURDOi0FBUQHBgIFAAVwAAgABAEIBGADAQEAAAFUAwEBAQBYAgEAAQBMW1gROhk1FBQUEgkFHCsBFA4BJic0NjIWBRQOASYnNDYyFhcRNCYHISIGBxEWHwEeAjYWNhUyFxYXFhc2HwEWNjI+AzcGBxYHBgcGJyY3LwEHFgcGJyYnJjcmJyY2FxYfARE0NhchMhYHETc2FgHnRmRGAUhiSAEXRmRGAUhjRn4kLP2ULyABGBotEzQcMg4yJg8DAg8TBD5GExYmHigiKm5EjC88JEI6KzACARoBAjAsOkIkOi6MRA4YFQMEBjQmAr0lNgEMFRgBtS5CAkYsL0JCLy5CAUQtL0JCkwF0MCoBJjP+iA0JEAcGBgIECAMPBAEODzMCAwEECgQSDBBTOZ9lPxMSGhxAtga8QBwaEhQ/ZZ45UxUeEAEDBAGDKDoBOCn+fQgPHAAGAAD/agNTA1IABwALAA8AEwAXABsAdUATCwEEAQFHFxYVExIRDw4NCQoBRUuwDlBYQCIDAQEEAW8ABAUEbwYBBQAABWMAAAICAFIAAAACVwACAAJLG0AhAwEBBAFvAAQFBG8GAQUABW8AAAICAFIAAAACVwACAAJLWUAPGBgYGxgbGhkREREQBwUYKwUhESMRIREjJTcFBwE3BQcBNwEHAwEHCQE1IRUCz/2QWQMjWv3zEgG1Ev6EJgGUJf7bOQFXOXkBCkf+9f63Ab89AQz+mwFlGVdcVwEsUr1RAYNF/uFEAfH+mjUBZf0BWVkAAAAEAAD/sQPpAwsACAAcACUAPABcQFk4AQABMgEFADMBBggxFw4DAwIERwABBAAEAQBtAAAFBAAFawAJAAQBCQRgAAUABgIFBmAACAACAwgCYAADBwcDVAADAwdYAAcDB0w7OjYjFBMULCQTEgoFHSsBFAYiJj4BHgEBNCYjIgcXHgEOAScuASceATMyNgE0JiIGFBY+ATcUBiMHDgEjIiYvATUXNjMyFzc+ATIWA3NQcFIESnhI/lZSOQ8POiskI1QrDC4LEkIoOlAB0GSNZGSNZFSUavQGbkhEaA6A2Sw1BwyfAZTSlgINOFBQcFIESv4mOlIEFxFUViQSBBIFIihQAdlGZGSNZAFiSGqUskhkVkAz8FgbAeNolJYAAAIAAP/FBC8C+AAcAC0AREBBHBsAAwIAJyYlAwMCAkcFAQIAAwACA20ABAAAAgQAYAADBwEDVAAHAQEHVAAHBwFYBgEBBwFMGBMVFRMTFRMIBRwrATU0Jg4BFREUBiImPQEzFRQWPgE1ETQ2HgEXFQcXMxUUBiImPQEXNxUUFj4BNwJRIi4ijMeMtyIuIo7DjAFt3reMxoxJbSAyHgEBxUIXIgIeGf6qYoqMY5WSGCICHhoBWl+IAYhgTCBalWOMimOWIiCXFyICHhkAAAIAAP9qAqsDUgAeAEoAOUA2BQEAAgFHAAEDAXAABgAFAgYFYAACAAAEAgBgAAQDAwRUAAQEA1gAAwQDTEhGFyclHigiBwUaKwEUBgciJwYHBhMWBgcjIiYnJj4DNzY3JjU0NjIWFxQOASciJy4BPgEXFjMyPgIuAw4DBxQXFg4BJicmNTQ+AjcyHgEB1kAsIR0iHooZARALAwsQAgcKGCQoFiInCD5aPtZYllgkJQwMBRQMHCA2ZEYsAihKYHBgSigBHQUGFhYGJDRWekFYllgCEy0+ARQmLM/+8A0SAQ4MRohqZkgiMioTGCxAQDJYllgBCAMUFwwBCCxGZGxkRiwCKEpgOEA6CxYMCAtEUEJ4WDIBVpgAAAADAAD/sQNaAwsADwAfAC8AQUA+IAEABRkRAQMDAAkBAQMoAQQBBEcAAwABAAMBbQAFAgEAAwUAYAABBAQBVAABAQRYAAQBBEw1NhcmJiMGBRorJRE0JiMhIgYVERQWMyEyNiURNCYjISIGFREUFhchMjYTERQGIyEiJicRNDYzITIWAYkKCP70CAoKCAEMCAoBdwoI/vQICgoIAQwIClkUEPzvDxQBFg4DEQ8WZAI7CAoKCP3FCAoK3gFlCAoKCP6bBwoBDAGz/O4OFhYOAxIOFhYAAAEAAP+wAjsDUgAiADRAMQ0BAQMBAQAFAkcAAgMCbwADBAEBBQMBXgAFAAAFVAAFBQBYAAAFAEwlEREpFiMGBRorJRcOASMGLgMnESM1PgQ3PgE7ARUzFSMRFB4CFzYCDywMYjI6YjwuEAFeKEAmGgwCAQQCiLq6BhQkGyxshBMkASAyREIhATB4DjIyQC4aAwTtjP7fERwgDgEBAAQAAP+xA7ADUgADAAcADwAZAGlAZhgBAQQRCQIFAA4BBwUDRwAIBwhwDgEKAAQBCgReDAMLAwECAQAFAQBeDQYCBQcHBVINBgIFBQdWCQEHBQdKEBAICAQEAAAQGRAZFxYVFBMSCA8IDw0MCwoEBwQHBgUAAwADEQ8FFSsBFSM1IRUjNRM3ESERMxU3AREHIwcjNSMRNwH0UQEvUVGN/Wa2eQG88rZ5ed49AmDy8vLy/liNAbz9t3l5Apr9y/J6egKGoQABAAD/9wOIAsMALwBNQEouLCogAgUFBhkBBAUWEgIDBAsBAQIERwAGBQZvAAUEBW8ABAMEbwADAgNvAAIBAm8AAQAAAVQAAQEAWAAAAQBMJBYWIxEiKAcFGysBBgcVFA4DJyInFjMyNy4BJxYzMjcuAT0BFhcuATQ3HgEXJjU0NjcyFzY3Bgc2A4glNSpWeKhhl30TGH5iO1wSEw8YGD9SJiwlLBlEwHAFakpPNT02FTs0Am42JxdJkIZkQAJRAk0BRjYDBg1iQgIVAhlOYCpTZAUVFEtoATkMIEAkBgAAAAEAAP+lA0MDUwA1AEdARCkBAwQAAQUDGQECAAUDRxcBAEQAAQIEAgEEbQADBAUEAwVtAAIABAMCBGAABQAABVQABQUAWAAABQBMJCclHB4SBgUaKwEVBiMOAgcGJy4GJzMeAxc2Ny4BNTQ2HgEVFA8BBiIuASc2NTQmJyIGFRQWMzIDQzg2JHBcGS0uDyQ8NkI0Mg6eDjJCRiteQk9adMdqIAsHJCQgDBEgHB4kdlojAYVvDUyWWg8ZGwkeQFB8lMx0esqYbjZehSikaGuKAXZrWUYCAQYWEjotMDIBODJoeAAAAAH////3BDsCXQCGADJAL3RWAgMCJQEAAwJHAAQCBG8FAQIDAm8AAwADbwEBAABmg4FjYU5NPz0sKhYUBgUUKwEWBwYPAQ4BHgIXFhUWHwEeAQ4BIwcGJi8BLgMHIg4DFRQGDwEGByMGLgIvAS4EJyY0PwE2MzceAR8BFhceAR8BHgMyPwE+AT8BNicuAS8BJicmNzY3NhcWFx4CFBYGHQEHBh8BHgEfARY+Ajc2Nz4BPwI2Fzc2FhcELg1hDRcfCRACDhYVAk8cBAIEBhYWjg4kCwsRLCAkDgEGDgoIBAICChRAKFJCMBAOBRQ8Ok4iBAICCReZBwwDAwkECx4ICRAeGBYQBwMCCgIFAwMBCAMEDiEICwgNHWguHQwOCgQEAQEBAgEKCAkFFBYkFCEbAgYDBQgIA6AWHAMCMCSAEh4oDB4SFBwQAQFJMgcEFhAOAwIKCAYMMCYcBgQMFCYZCA4DAwsBAxgiKAwOBRhMXoxSCQwDAwsBAQQDAgYMHDoRECIwHBADAwIUEC4eJxckCAYTBQIMCgcOAQEGAwoQFB4gGC4XEQoWDBQEAgEOGDQiOkMGCAIDAgICAQMIBgAAAAAGAAD/jQR3AzAACAAUAB0AKQBGAFgAaEBlJA8CAwI9MgIJA0xKPAMLCQNHSwELRAAKAApvBAEAAQBvBQEBCAFvAAgMCG8HAQMCCQIDCW0ACQsCCQtrAAsLbgAMAgIMVAAMDAJYBgECDAJMVlRPTURCNTMjFSQTFCQkExINBR0rATQmIg4BFjI2ATQmByIGBxQWFzI2AzQmIgYUFjI2ATQmByIGBxQWFzI2JyYjIg4BFxQXBiMiJi8BLgEjBzcmNTQ+ARcyHgEBFAYHFycGIyIuATQ+ATcyHgEBRBwvJAEmLhwBnhwWEBgBGg8WHIMcLyQkLxwBYh4VDxgBGg4WHJMSFl6eXAENFBIPGhIZBy4FjSiibLxtYq52AVxMQh9vVCZenlxcnl5anmACURccHiscGv79DxoBGg4QGAEYASwXHB4rHBr+/Q8aARoOEBgBGO4DVpRWLCkCAgMEAQpGeXKgXp5cAUiE/ndBdjFlPBROiJ6KTAFOigAAAwAA/64DWgMOACoAPQBRAGBAXToBAANLPDsDBABJAQcEA0dKAQdEAgEBBQMFAQNtAAMABQMAawAABAUABGsJAQYABQEGBWAIAQQHBwRUCAEEBAdYAAcEB0w/PiwrSEY+UT9RNDMrPSw9HyIaKAoFGCsBMhYXFhUUDgEjIicuAScmNzU2NzYzMhYzMhYXHgEVFAYHFBcWFxYXFjI2AzI+AjQuAg4DBxQXBzcWEzIeAg4DJyInBzcmNTQ+AgImB14DARI+GiBKN1AqKQECJw4PBAwFCwgEBRwmAQMTJh81Bw4sa0eCXjg4XoKOgGA2AUMsh1hoVpxwRAJAdJhYbF/pTDxCcpoBMzIFAgYSLh4jGVI+PDAFMiYMAgYNC0wDDCoFAwUpIx4bBDb+2ThchIyEXDoCNmCASHFcgis6AwNEbqCmoGxIAjVL4mN2Vpp0PgAAB//+/8YD8QL8AAkAEwAdACsATwBkAHkAGUAWQgEAAQFHAAEAAW8AAABmRUQyMQIFFCslNi4BBgcGHgE2NzYuAQYHBhcWNhcOAS4BPgEXHgE3LgIHDgEXHgI3PgE3FA4DLgM3NDY3PgEXFgcGHgE/ATYyFgcOAR4BFx4CAx4BBw4BJy4BNzYmBwYmJyY2NzYWNx4BBw4BLgE3Ni4CBwYuATY3NhYBeQsKJywLDQomLkAFBg4SAwkRCBBlGX56LDR0Oz42lAVYklB8pAgFWo5SfaKlKFJqkpyYdEwCTkdewigkGQIEBgULTngyGQEECgQHIDQkKBcOCgUYDQwOBQswJA0YAgMQDCJCfDEcFgUcHg4EEBRGYDAQGggSEESIhhMmERAREyYUElUHEAUGBxIIAgY1OTQmaGg0EBBkITVSKAgNhFI1UigIDYRPJk5MNigGIEhgP0CSR15KKCRRCAYCAQMhRUAHCAYEAQogPAE6G0QgDAwDBRgNIzYIAxAMDhYDBxRBNo4/DxAMGhAuZE0eCwMSHhwCDyoABAAA/2oDoQMLAAMABwALAA8AMUAuDwwHBAQBRQoJAgEEAEQDAQEAAW8FAgQDAABmCAgAAA4NCAsICwYFAAMAAwYFFCsBESURAREhEQERJREBESERAX3+gwF9/oMDof4FAfv+BQEh/pQ1ATcBnv6RATv+lv5JRgFxAer+RQF1AAAG//7/agPqA1IABQA9AEUATwBgAHEAZ0BkNAEAA0tFQSEgHw8OAwIKBAACRwADAgACAwBtAAQABwAEB20JAQUACAIFCGAAAgEBAAQCAGAKAQcGBgdUCgEHBwZYAAYHBkxiYVFQamlhcWJxWVhQYFFgREIyMC4sKSUXEwsFFCsTNDcTLgElFA8BDgIPAQM3PgEmIwcmJyIOARQWMx8BCwE3PgEmIwcjIic+ATMyFhcjIgYHFB8BHgIfARYFExQXBiMiJwEWFRQGBxM2NTQBMh4DDgIiLgI+AxMyPgI0LgIiDgIUHgJHJc1thgLQAgUDCAoFK5sxCwgMCXMqRwYKAgoGLENenDELCAwJcw0JBTq+blKWOgYfKAEBAgEIAgYXI/7lhQJGSD47AfE1dGKEIf6EZriITARUgMDEwIBUBEyIuGZhsIBMTICwwrCATEyAsAFeW1T9zzXQkwsLGxASMAiPAc0EAhIQBgEFBgwICgS3/ucB0AQCEhAGAVloOjcsHwcHDAUQBgomPHX+lwQDGBICaWFtdcQ6AXtePBcBO1CEvMi8hFBQhLzIvIRQ/C9MgLDCsIBMTICwwrCATAAC//7/sQMVA0wAEwAkACVAIh8XCQMAAQFHAAMBA28AAQABbwAAAgBvAAICZjQ4OTMEBRgrAQYHBisBIiY/ATIvASY3NjsBMhclFgcBExYGKwEiJwMBNjsBMgFNBYoPFYYMCgWNAQFaBwcFDIYWDwIdBgb+2bwGCwyGFw69ASgOFocMAd4K9RkSC/oBnAwICRrHCQz99/6oCxIZAVwCDRkABQAA/2UDLQNZABUAKAA8AEoAYQAoQCVhAQABAUdIAQFFCgEARAABAAABVAABAQBYAAABAEwjIhwaAgUUKyUVFAcGBwYmJyYnNDc+ATcyNz4BHgEnBg8BBiMmJyYnJj4BMzIfAR4BBQ4BBwYnJi8BJjY3NhcyHwEWFxYBFgYnAyY3PgEXFh8BFgUWBwYHBgc1BiYnJjcyPwE2NzYXHgEXAa8DBxUfjhMIAgIDIFUBIQgcGw5TARxDmQoTCwYDBQoYEwhpbw0OAcwEXhwVDwdfGwcCChMbAUKHFgQQ/oUDQSDSBQ8XuiAXBQwLAXQBEAivJg0NGAkREQEpVA4FDxUbUgVyR6MHEgQGNhYJCwcIBihlJwsGCxaAHwgWMQETDhwqZiQrLQUYtR54CggLBpsrCxwMGAoWLAcFDAFLORUyAU0UDxg0CQUUqqBwFgsGKgkEAQMKDRoXOXITAgsKDHwgAAsAAP9qA0oDUgAJAA8AFwAqADsAVwBfAHgAhACUAKYCzUAkpaGEfnsFFhWYARsWMQEBCQYBAgFWPjwgHAUGABI2KgIHAAZHS7AJUFhAcRwBGh4abx8BGxYdFhsdbQYBBAUJBQQJbRMNCwMJAQUJYw8IAgcADAwHZSQjIQMeABUWHhVgIgEWIAEdGRYdYAAZDgEFBBkFXgMBAQACEgECXgASEQoCAAcSAGAUEAIMABcYDBdhFBACDAwYWQAYDBhNG0uwClBYQH0cARoeGm8kIwIhHhUeIRVtHwEbFh0WGx1tBgEEBQ0FBA1tEwENCQUNYwsBCQEFCWMPCAIHAAwMB2UAHgAVFh4VYCIBFiABHRkWHWAAGQ4BBQQZBV4DAQEAAhIBAl4AEhEKAgAHEgBgFBACDAAXGAwXYRQQAgwMGFkAGAwYTRtLsAtQWEBnHAEaHhpvBgEEBQkFBAltEw0LAwkBBQljJCMhAx4AFRYeFWAiARYgHx0DGxkWG2AAGQ4BBQQZBV4DAQEAAhIBAl4AEhEKAgAHEgBgFBAPDAgFBwAXGAcXYBQQDwwIBQcHGFgAGAcYTBtLsA5QWEBxHAEaHhpvHwEbFh0WGx1tBgEEBQkFBAltEw0LAwkBBQljDwgCBwAMDAdlJCMhAx4AFRYeFWAiARYgAR0ZFh1gABkOAQUEGQVeAwEBAAISAQJeABIRCgIABxIAYBQQAgwAFxgMF2EUEAIMDBhZABgMGE0bQHIcARoeGm8fARsWHRYbHW0GAQQFCQUECW0TDQsDCQEFCQFrDwgCBwAMDAdlJCMhAx4AFRYeFWAiARYgAR0ZFh1gABkOAQUEGQVeAwEBAAISAQJeABIRCgIABxIAYBQQAgwAFxgMF2EUEAIMDBhZABgMGE1ZWVlZQEaVlZWmlaakoqCfm5mXlpKRiomDgn18enlzcmdmZWRfXltaU1JLSkZFQ0E5NzU0MzIwLykoJCMfHRsaERERERESEiMiJQUdKyUVFCMiJzU2MzIXFSM1NDIlMzUjFTMROwIRIxUGIyInJj0BIxUUFxYyPwE1NCcmIgc1IxEzNRYzMjc2NzUjFAcGIyI9ATM1NCcmIgcGHQEUFxYyNzY3NgE1NCIdARQyARQHDgEHBiAnLgEnJhA3PgE3NiAXHgEXFgEzBxUjNSYnJiczHwEVFAcGIicmPQE0NzYyFxY3ESM1BiMiJyY9ATMVFjMyNzUCHhYNDAwNFr0zMv3lPK47N6EyMhEPCgEBMgUHNB7wBQo6GDIyGRseCgW8MwEEEhpkDxZLFg8QFk4UCgIB/q0wMAGRDggyIGb+YmcgMgcPDwcyIGcBnmYhMgcO/dM5QzgIGhUQPCf1EBVLFg8PFksVELszHhwZCAQzAgoPEZx2JQyoDCYZGSZUNDT+wgEU0xcLAhLL2hwNFSI1bikOHx55/o4bHx8PLwcdBRQmMTksFRwcFSxgLBUdHg8PBQIZdScndSf+hINAIS4CDAwDLCI+AQhAIS4DCwsELCI+AkPfl5cqTTkvkydhLhQdHRUtYS0VHBwVLv7pHyMVDR3c4QwY1QAAAAEAAP+xAxwDUgAhACVAIhIFAAMAAQFHGgkCAUUEAQIARAIBAQABbwAAAGYcJxIDBRcrARMmIgcTLgInFjMyNxYfARYXNz4BPwEWMjcHBg8BBgcGAd8IIy8kCBeOZDMgHBklIyhdNRg9KDQgPB49ICESCh8VB1EBPP51BwcBiyf8pk0ICD5CmlgnY0FSOWoICDEbETYlCooAAf/9/7EDXwMLAAwAEUAOAAEAAW8AAABmFRMCBRYrARQOASIuAj4BMh4BA1lyxujIbgZ6vPS6fgFedcR0dMTqxHR0xAACAAD/sANZAwsALgBhAFlAVlkJAgQBAUcACQACAAkCYAALAAABCwBgAAoAAQQKAWAAAwUGA1QABQcGBVQABAAHBgQHYAAFBQZYCAEGBQZMVFNRT05MPDs5NzY0KignJiQjIRIrDAUXKwE0Ji8BLgE0PwE0JyMiDwEiJgciBg8BBgcOAgcUFhUUBhQWMjYXMhYzMjc+AjcUDgEHBiMiJiciBiciJjU0NjU0JjU0PgI3Njc2MzIWNzI2FzIWFRQGFRQWHwEWFx4BAxEIBgkDBAIDBQgKFiEigCIYOhIyTCU1SBoBDgwOGTYOIH4fZTpIdkRHTo5WRXEffiANNg4pOAwOFCpGMCxWbEQigCEKLAotKgYCAQQDAgkKAYUZTBAZCBgcGiUVCgIDHAEMBxMeHCmChEkWWhYNMhYSDgESFRl4mk1ctoogGRABEgE+KQ4wDRdaFz14cmYkISIsHAEGATgvDTINBw4CCwkCF1gABgAAAAAD6AI6AAsAFQAfACkANABGAFtAWC8BAgY0LSopJCMgHxoWFRALBQIPAQACRwAIBghvAAYCBm8EAQIJAm8AAAkBCQABbQAJAAEJVAAJCQFYCgcFAwQBCQFMNjVCQD07NUY2RSQUFBQUHhgLBRsrNxQjIi8BNzYzMhUfARQiNSc3NDIVHwEUIjUnNzQyFR8BFCI1Jzc0MhUfARQiLwETNjMyFRMXIjURNDc2MzIWFzYzMhYUBiMiCgYEDg4EBgoQVhgMDBgOWBwKChwMWiAICCAKXCICBgYEDhIIQA4MJDBYgggYGjRMTDSyBARGSAQESGwICGymCAimagoIbN4KCt5qCgpq4AoK4GgMDGgBAA4O/wB0DgGMCgQOdFQKSmZKAAYAAP+SA5gDKgARABsAIQAtADYAPwBtQGoiHxcUBAIDAUcABw4BCAQHCGAKAQAABAkABGAACQ0BBgUJBmAABQwBAwIFA2ALAQIBAQJUCwECAgFYAAECAUw4Ny8uHBwTEgEAPDs3Pzg/MzIuNi82LCspJxwhHCESGxMbCggAEQERDwUUKwEyFhUUBgcOASMiJjU0Njc+AQMyNy4BJwYVFBYTHgEXLgEXPgE1NCYjIgYHHgEBIiY0NjIWFAYnIgYUFjI2NCYCLJjUwIwinF5+smxWDNBudjholhZkdlgQbEoCdNxYcpZoWo4QfK7+Cio+PlY8PCwYICAwIiIDKtSWjtIKVm60fGCaIozA/M5kFpZoOHZUdgGUTGoQUHTEEoxcapR0WAKuARI8Vjw8VjygIi4iIi4iAAAAAAQAAP9qAuQDUgAYACIAKgAzACdAJDEqKRsaExIREA0MCwBFMwkIBwYFAEQBAQAAZgAAABgAGAIFFCslFgcOAS8BBycTBi8BExcWFxMXBxceAQcGAycHFAcXFj4BJgUWPgEmLwEHExY+ASYvAQ8BAiIwNCqSTkBsOM5EQni6ekIazjpsQEwsKjA8QHwCPjRgOBr+FjRgOBoyQIDcNGA4HDI+BHzwWlpGJCwkuCABZgomRgFERig8AWYiuiQslkRYASom2AIEJB4aYGLAHhpgZBwm3v7OHhpgYh4kBNgAAAAABAAAAAADhAKKAAYADAATABkAPUA6BggCAAcBAQIAAV4EAQIDAwJSBAECAgNYCQUCAwIDTA0NAQAZGBcVDRMNEg8ODAoJCAUEAAYBBgoFFCsBMhYdASE1ATUhFSEiITUhFRQGIwE0MyEVIQNSFB7+DP5wASz+/CgBkAH0HBb8rigBBP7UAooeFMj6/drI+vrIFhwCJjL6AAADAAD/nAMAAyAAPgBNAFMAXEBZUgEHBhABAgELAQMCA0cABgcGbwAHCgdvAAoFCm8ABQgFbwAICQhvAAkECW8ABAEEbwABAAIDAQJgAAMAAANSAAMDAFgAAAMATFFPSkkWJSU1LRMiJSYLBR0rARQeAQ4CIyInJjc+ATMXBwYjIgcGFzc2Jy4BLwEmJy4CIgYjIiYnLgE0FzMyNScmNTQzMhceAR8CMh4BAzYuASIOARcWPgEyHwEWARQrATcGAu4KCAocSjaaKBoIAkYiIgQMGhQEBCxWJgoCIBIxHxAcJBIEDBgsvhQiODp0TgEBKFoeEhYCBMoKHjBgBhAqOCIIBAgOJhoRHAv+IhyQsAQCfASKlsCWZhoUbigmAkYCGiYEBASEEBQDCAUECCgidB4UIuZGBEg0KBRSDggkEA4MBiD+uAY0NC4uBgYCCAYKBAE4FqyKAAAAAAEAAP+xA+gDDAAcACFAHhEBAAEBRwIBAQABbwMBAABmAQAXFQ0LABwBHAQFFCsFIicBJy4DNTQ2NzIeAhc+AxcyFhQHAQYB9A4L/qQPCioiGo59Ikg+LhMULEBGI32OgP6lCk8KAVAPCjY2UCV7igEYKiIVFCQoGgGM9YD+sQoAAgAA/7ED6AMMABwAOQA1QDIyAQEAGgEDAQJHAAEAAwABA20AAwNuBQEEAAAEVAUBBAQAWAIBAAQATCgqHxUVFQYFGisBNC4DDgMHBiInLgMOBAcUFwkBNjcUBwEGIicBJy4DNTQ2NzIeAhc+AxcyFgOhGCY2MjxAPCQQCiIKDig4RDg2MioUAmkBRAFEaUeA/qUKHgr+pA8KKiIajn0iSD4uExQsQEYjfY4CBS5EKhgMBBgwIBINDQ8mKh4CBh4kSitdaf7IAThpXXuA/rEKCgFQDwo2NlAle4oBGCoiFRQkKBoBjAAAAAMAAAAAA+gCdgAUAB0ALABDQEAiAQQFAUcGAQAAAwUAA2AABQAEAgUEYAcBAgEBAlQHAQICAVgAAQIBTBYVAQAqKCUkGhkVHRYdCwoAFAEUCAUUKwEyHgMUDgMiLgM0PgMTMjY0JiIGFBY3Fj4BFxQGIiY0NjMyDgEB9FyqcFYoKFZwqriqcFYoKFZwqlxcgoK4goJcCDoqBEJcQEAuDggQAnYySlA+HDxSSjIySlI8HD5QSjL+En6yfn6yftYIDAoOLD4+Wj4uMAAAAAIAAP9qA+gCwwAXAD0APkA7NAgCAQAmCwIDAgJHAAMCA3AABAUBAAEEAGAAAQICAVQAAQECWAACAQJMAQA7OiQiHRsSEAAXARcGBRQrASIOAQcUFh8BBwYHNj8BFxYzMj4CLgEBFA4BIyInBgcGByMiJic1JjYmPwE2PwE+Aj8BLgEnND4BIB4BAfRyxnQBUEkwDw0aVUUYICYicsZ0AnjCAYCG5ognKm6TGyQDCA4CAgQCAwwEDRQHFBAHD1hkAYbmARDmhgJ8ToRMPnIpHDUzLiQ8FQMFToSYhE7+4mGkYARhJggEDAkBAggEAw8FDhYIHBwTKjKSVGGkYGCkAAAB//MAAANvAlQADQAGswgDAS0rEwkBNhcWBwEGJwEmNzY/AXIBdBYaGhr+dBYa/nQaGhgCOv6cAWQaGhYa/ngWFgGIGhYYAAAB//T/ogHeAxwADQAGswkDAS0rBRYHBicBJjcBNhcWBwEBxBoaGhb+eBgYAYgWGhoa/poUGhYaGgGKGBoBihoaFhr+jAAAAAAB//P/ogHdAxwADQAGswsFAS0rFwkBJjc2FwEWBwEGJyYNAWb+mhoaGhYBiBgY/ngWGhoUAXIBdBoWGhr+dhoY/nYaGhYAAAAB//QAAANsAlQADAAGswcDAS0rJQkBBiY3ATYXARYHBgMk/oz+jhowGAGMGhYBjBgYGoIBZv6aFi4aAYYaGv56GhgWAAIAAP/YAwwC8AALABkAF0AUBAEARRkVDQcEAEQAAABmEhEBBRQrAR4BHQEHAQc3ATc2ATcmJy4BIycPARYXFhcCziAe/P7e7jIBIvw2/loYAjIWLgwOFhIcEhgMAqggQBAQ/P7gNPABIPwM/TgYLDIWGgIYUBASGBgAAAADAAD/zgPoAu4ACAAdADIAYkBfAAUGAAYFAG0AAAMGAANrAAEICggBCm0ACgsICgtrAAQABgUEBmAAAwACBwMCYAwBBwAIAQcIXgALCQkLVAALCwlYAAkLCUwfHi8tKyolIyEgHjIfMiIVIhEjExINBRsrATQ2MhYUBiImJwYrATUzPgEzMhcWFAcGIicmIyIGBTMVIw4BIyInJjQ3NjIXFjMyNjc2AVRehF5ehF5yDjSgdijShKR4EBASMhJOeGSYAlCgdijQhqR2EhIQMhJSdGSYFgwBXkRcXIZeXn48eHycdBIyEhAQUnyceHycdhIyEBISUn5ePAAAAAAE//r/mgPzAxoAKwA3AFYAXgAdQBpZWEA/BABEAgEBAAFvAAAAZh0cGxoREAMFFCsTDgEUIwcGBwYvASY3PgE3NjI+ATcyPgE3NjcyFzIHBgcGFxYXFg8BBicuARcBFg8BBicBJj8BNiUWBwYnJg8BJzc+ASY3Njc2FgcGBwYWFxY3PgE3NhYBNxcHBi8BJpsIBgIRDwQQDEYLDQIgBAYqHggGAg4mFoY0ehoMFHggUCwiBAgKTA4EKjr4AZoSFDAWEP5iCAhIDAIyECAyaDgsUkREGA4CBgyADAwEDCIOBCY6JgYoAgQS/Kj+TPYUEi4WAfoIHBYPDQQOEkwMDAIYBAYcMAYOHhBaBgIINBg4Oi4CCAZGCAQwGDL+JBYQKg4SAdgIDD4IwGg+WBoMLE5ORhg6SBY4OAYSBgxECjIcKD4MOgQKAv1E+FbyFBAuEgADAAD/nAOEAyAACAARACoAP0A8HQEEAUYACAYEBggEbQAHAAYIBwZeAAQABQAEBWACAQABAQBUAgEAAAFYAwEBAAFMEjITMiQTFBMSCQUdKzM0NjIWFAYiJiU0NjIWFAYiJgEGFjMhFRQjISI9AQMjNTQ7ATIdASERFAeWPFI6OlI8AfQ8Ujo6Ujz+viQEKgIyFP1yFGxiFJwUAsASKDw8Ujo6Kig8PFI6OgEWChpMFBRMAfRQFBRW/u4WBAAAAAABAAD/sQPoAy4AKwApQCYmAQQDAUcAAwQDbwAEAQRvAAECAW8AAgACbwAAAGYjFxM9FwUFGSslFAcOAgcGIiY1NDY3NjU0LgUrARUUBiInASY0NwE2MhYHFTMgFxYD6EcBCgQFBxEKAgEDFCI4PlZWN30UIAn+4wsLAR0LHBgCfQGOWh7hXZ8EEhAECgwIBRQDJh84WkAwHhIGjw4WCwEeCh4KAR4KFA+P4UsAAgAA/7ED6AM1ABQAOgArQCgmAAIAAyEBAQACRxABA0UAAwADbwIBAAEAbwABAWY4NywqHRwkBAUVKyUVFAcGIyInASY0NwE2Fh0BBwYUFwUUDgIPAQYjIicmNzYnLgEnFRQHBiMiJwEmNDcBNhcWHQEWFxYBZRYHBw8K/uMLCwEdESzdCwsDYBIaHAgLBQsDAg4BGFMkdlsVCAYPCv7iCwsBHhAXFeZpXvYnFwoDCwEeCh4KAR4RExcn3gscC/MgVEZGEBYKAQQP31woLAeMFwoDCwEeCh4KAR4RCQoXkw9sYAAAAQAA/7ED6AMvACwAHUAaAAMBA28AAQABbwAAAgBvAAICZiodMxQEBRgrARQHAQYiJj0BIyIOBRUUFxQWBxQGIicuAicmNTQ3NiEzNTQ2FhcBFgPoC/7jCxwWfTdWVj44IhQDBAEKEQYECAYDRx5aAY59FhwLAR0LAe0PCv7iCxYOjwYSHjBAWjgfJgQSBggMCgUOFAOfXW9L4Y8OFgIJ/uILAAAFAAD/bwPeA00AFQAZABwAKgAuAE1ASi4tAgECLBgCBQEeGhkXBAUDBQNHAAIBAm8AAQAFAwEFXgADAAQGAwRgBwEGAAAGUgcBBgYAWAAABgBMHR0dKh0qFSUXEiU3CAUaKwEWFA8BERQGByEiJicRNDYXITc2MhcJAScBBx8BBREHDgEHIzU0Nj8BIREBNycHA8YYGLkeFv1cFh4BIBUB1LkYPhj+iwFHcP64FQRYARWnFFYlnxYUpf7IAsBDckMCnxdAF7n+KxUeASAUAqUVIAG5GBj9hAFIcP65LFYEzQE4oBQaAZ8pUhSn/cICTkNyQwAAAgAA/yEDdQObABQARQBDQEAzLCghBAIFPDUfGAQBAj8VDQYEAAEDRyoBBUUABQIFbwMBAgECbwQBAQABbwAAAA0ASUNCOjgxLyUjHBoZBgUVKwEWEhUUAgcVFAYiJjc1JgI1NBI/ARM+ATcHBiMiJj8BJicHBiMiJj8BJicGBxcWBgciLwEGBxcWBiMiLwEeARcRND4BFhcBxbz02qwgKCIBrNr2vAk0fZ4DowgLEBANxAsicQgLEBANe2GjpGB6DRAQCwdyIgvEDRAQCwejBJx9ICoeAQOaI/7av7T+5C5AFR4eFUAuARy0vwEmIwH8ZivWhaQIHg7ETUFyCCILe4giIoh7DCABCHJBTcQOHgikhtQsAmAWHgIiFAADAAD/uQQWAroAFAAkADkAHkAbLhECAAEBRwMBAQABbwIBAABmNTQoJxcSBAUWKyUHBiInASY0NwE2Mh8BFhQPARcWFAEDDgEvAS4BNxM+AR8BHgEJAQYiLwEmND8BJyY0PwE2MhcBFhQBWBwFDgb+/AYGAQQFEAQcBgbb2wYBRNACDgYiCAYB0QIMByMHCAFs/vwGDgYcBQXb2wUFHAYOBgEEBUUcBQUBBQUOBgEEBgYcBRAE3NsGDgJO/S8HCAMJAwwIAtAIBgEKAg7+j/77BQUcBg4G29wFDgYcBgb+/AUQAAABAAD/tAMQAwgANgA9QDoAAgUGBQIGbQAGBAUGBGsAAQADBwEDYAAHAAUCBwVgAAQAAARUAAQEAFgAAAQATCYXJiUTFRUiCAUcKyUUBiMiJwEmND4BFwEWFAYiJwEmIgYWFwEWMzI2NzQnASYjIgYUHwEWFAYiLwEmNTQ2MzIXARYDEFpASzj+Tj98sEABUgUiEAX+rSx0UgEqAbEjLiQuASP+uw4TEBYO5QYkDgblI0AtMSMBRDhNQVg3AbJAsHoBP/6uBRAiBQFTK1R1K/5PJDAjLiMBRA4WIg/kBhAiBeUiMS5AI/67NgAAAAIAAP/5AoMDCwAHAB8AKkAnBQMCAAECAQACbQACAm4ABAEBBFQABAQBWAABBAFMIxMlNhMQBgUaKxMhNTQmDgEXBREUBgchIiYnETQ2FzM1NDYyFgcVMzIWswEdVHZUAQHQIBb96RceASAWEZTMlgISFx4BpWw7VAJQPaH+vhYeASAVAUIWIAFsZpSUZmweAAEAAP/5A6EDDAAlADBALQQBAgEAAQIAbQAAAwEAA2sAAwNuAAUBAQVUAAUFAVgAAQUBTBMlNSMVJAYFGisBFRQGByMiJj0BNCYOAQcVMzIWFxEUBgchIiYnETQ2FyE1ND4BFgOhFg4kDhZSeFIBNRceASAW/ekXHgEgFgF3ktCQAhGPDxQBFg6PO1QCUD1sHhf+vhYeASAVAUIWIAFsZ5IClgAAAgAA/2oCgwMLAAsALgA8QDkHAQIBAAFHAAMCA3AABwgGAgABBwBgCQUCAQICAVQJBQIBAQJYBAECAQJMLSwTMxEUIjMVFRMKBR0rATU0JiIGHQEUFjI2BRQGJyMDDgEHIyInAyMiJic0NjMRIi4BNjchMhYUBicRMhYBDAoQCgoQCgF3Fg7vHQEKBgEPAivhDxQBWDcdKgIuGwFlHSoqHTdYAXD6CAoKCPoICgq9DhYB/vIHCAEPAQ8UD0VuAR4qOioBLDgsAf7ibgAAAgAA//kDkgLFABAAMQAuQCsuJiUYFQ8ODQgBAwwBAAECRwQBAwEDbwABAAFvAgEAAGYqKCMiIREUBQUXKwERFAYHIzUjFSMiJicRCQEWNwcGByMiJwkBBiYvASY2NwE2Mh8BNTQ2OwEyFh0BFxYUAxIWDtaP1g8UAQFBAUEBfCIFBwIHBf5+/n4HDQUjBAIFAZESMBOICghrCAp6BgEo/vUPFAHW1hYOAQ8BCP74ASQpBQEDAUL+vgQCBSkGDgUBTg8PcWwICgoI42YEEAAAAAMAAP+6A5gDSQAcADsAXACmQBo6AQkFV0cCAAQTCwIBBwNHVisCCUYGAgcCRkuwClBYQDYABQMJBAVlAAEHAgABZQAIAAMFCANgAAkAAAcJAGAABAAHAQQHYQACBgYCVAACAgZYAAYCBkwbQDgABQMJAwUJbQABBwIHAQJtAAgAAwUIA2AACQAABwkAYAAEAAcBBAdhAAIGBgJUAAICBlgABgIGTFlADllYFxccKBcYGhgUCgUdKyU0LwEmIgcXHgEfARQGByIuAS8BBhQfARYyPwE2ATQvASYiDwEGFB8BFjI3Jy4CNTQ2FzIWHwEWHwE2ARQPAQYiLwEmNDcnBiIvASY0PwE2Mh8BFhQHFzYyHwEWAy0QdBAuEBYDDAECIBYIDg4EFhMQcw8tEFIQ/ncPcxAsEFIQEHQPLhEXAwoEHhcJDgcLBAgKEgH0MFIuhy5zLjExMIcvdC8vUi+GL3MuMTEwhy90L6sXD3QQEhYDEAYPFx4BBAoEFhEuD3QPD1EQAZ8WEHMQD1IPLBB0DxEXAw4OCRYgAQQFCAMJCxH+jkIvUS8wcy+HMDExL3Qvhi5SLi90LogwMTEvdC8AAAAIAAD/sQOhA1IACwAXACQAPQBVAGIAbgB6AJJAj2oBDwlkAQwISTkCBQouAQEEEwwCBwMSDQIGAAZHAA8JCAkPCG0ADgwLDA4LbQABBAMEAQNtAAAHBgcABm0ACQAIDAkIYAANAAwODQxgAAsACgULCmAABQAEAQUEYAADBwIDVAAHAAYCBwZgAAMDAlgAAgMCTHh3cnFtbGdmYF9aWFJRHxcXJCQVFhUSEAUdKzcHBiImND8BNjIWFBcVFAYiJic1NDYyFicUBisBIiY0NjsBMhYFFA8BBiIvASYnNxcWMj8BNjQvATcWHwEWAQcnJiIPAQYUHwEHJi8BJjQ/ATYyHwEWBRQGKwEiJjQ2NzMyFgEVFAYiJj0BNDYyFhcHBiImND8BNjIWFPWPBg4LBo4GDgtZChAIAQoODH4KCLIICgoIsggKAsIwUi6HLroMDIaYDy4PUhAQmQoUC7wv/qeFmBAsEFIQEJkKFAy7Ly9SL4YvugwBbQoIswgKCgizCAr+0AoQCgoQCuOPBg4KBY8FDguNjwULDgaOBQoOHbMICgoIswgKCnUICgoQCgpQQi9RLzC7DBMKmQ8PURAsD5qFCwy8MAFSCpkQD1IPLBCZhgwMuzCFLlIuL7sMQggKChAIAQoBKLIICgoIsggKClyPBQsOBo8FCw4AAAAAAgAA/2oDkANSAAYACgAzQDAGAQQAAUcAAQABbwIBAAQAbwUBBAMDBFIFAQQEA1YAAwQDSgcHBwoHChMRERAGBRgrASMRIREjAQUVITUDkOz+oOwBnP5kAzgB8QFh/p/+ZHV2dgAAAAAD////sQPoAsMAGQA5AEkAQEA9GxIBAwMCEwACAQACRwADAgACAwBtAAABAgABawAFAAIDBQJeAAEEBAFUAAEBBFgABAEETDU9LRkqKQYFGislEQYHBgcOAicjIi4BJyYnJicRFBY3ITI2EzUvASYGJyEiBgcUFxYXHgQ3MzI+Azc2Nz4BNxEUBgchIiY3ETQ2MyEyFgOhEhWVWRwkPBsCGj4iHViWFRIMBgM2BwoBAgMDBAb8ygcKAVNrdAQgEiAYDAILGh4UHgV0bB40RzQl/MokNgE0JQM2JTQLAawUEHNKGBoeAhoeFkpzEBT+VAcMAQoCUg4OBQUCAwwGXkFUXAMcDhQMAQoWDB4CXFQYUjX9oSU0ATYkAl8lNDQAAAABAAD/ygOhA0AAHwAdQBoSDwoEAwUAAgFHAAIAAm8BAQAAZh0UFwMFFysBFA8BExUUDgEvAQcGIiY1NDcTJyY1NDclNzYyHwEFFgOhD8owDBUM+/oMFgwBMMsOHwEYfgsgDH0BGCAB6QwPxf7pDAsQAQeEhAcSCgQIARfFDwwVBSj+Fxf+KAUAAgAA/8oDoQNAAAkAKQAnQCQcGRQODQkIBwYFAwEMAAIBRwACAAJvAQEAAGYlJBcWEhADBRQrATcvAQ8BFwc3FxMUDwETFRQjIi8BBwYiJjU0NxMnJjU0NyU3NjIfAQUWAnuq62pp7Ksp09P+D8owFwoM+/oMFgwBMMsOHwEYfgsgDH0BGCABIqYi1dUiputvbwGyDA/F/ukMHAeEhAcSCgQIARfFDwwVBSj+Fxf+KAUAAAAAAgAA/7ECygMMABUAHgAlQCIABQEFbwMBAQQBbwAEAgRvAAIAAm8AAABmExcRERcyBgUaKyUUBiMhIiY1ND4DFxYyNzIeAwMUBiIuATYeAQLKRjH+JDFGChgqPi1JykoqQiYcCI98tHoEgqyERTxYWDwwVFY8KAFISCY+VFYBwFh+frCAAnwAAAMAAP+xBHgDDAAIACwATwB3QHQsJQIKByAfDgMDAjITAgQIA0cAAQcBbwAHCgdvDgEACg0KAA1tAAsNAg0LAm0MAQoADQsKDWAGAQIFAQMIAgNgAAgEBAhUAAgIBFgJAQQIBEwBAE1LSkhFREE/NjMxLykoJCIcGxcVEhAKCQUEAAgBCA8FFCsBIiY+AR4CBgUzMhYHFRQGKwEVFAYHIyImPQEjIiYnNTQ2NzM1NDYXMzIWFwEUFjczFQYjISImNTQ+BRcyFx4BMjY3NjMyFyMiBhUBiVl+Anq2eAaEAcPEBwwBCgjEDAZrCArFBwoBDAbFCghrBwoB/mUqHY8mOf4YQ1IEDBIeJjohCwssVGRULAsLSTB9HSoBXn6wgAJ8tHpJDAZrCArFBwoBDAbFCghrBwoBxAcMAQoI/r8dLAGFHE5DHjhCNjgiGgIKIiIiIgo2Kh0AAAAAAwAA/7EEcgMMAAgALABOAFRAUUkBAAckGxIDAggyAQYCA0cAAQQBbwUBBAcEbwkBBwAHbwoBAAgAbwAIAghvAwECBgJvAAYGZgEASEZEQ0E/NjMnJiIhFRQQDwUEAAgBCAsFFCsBIiY+AR4CBgUXFhQPAQYiLwEHBiIvASY0PwEnJjQ/ATYyHwE3NjIfARYUBwUHBhQfAQYjISImNTQ+BRcyFxYyNzYzMhcOAQcUFwGJWX4CerZ4BoQCBIsFBUwFDwWLiwUPBUwFBYuLBQVMBQ8Fi4sFDwVMBQX+X2UVFS4LDf4YQ1IEDBIeJjohCwtWuFYLCw8QDw4BFQFefrCAAny0erWKBRAFTAUFi4sFBUwFEAWKiwUQBUsFBYuLBQVLBRAFi2UUPBUuAk5DHjhCNjgiGgIKREQKBA8YFB4VAAAG////agQvA1IAEQAyADsARABWAF8Ab0BsTw4CAwIBRxEBCQsJbwALCAtvEAEIAghvDwECAwJvBwEFAAEABQFtDAoCAQYAAQZrAAYEAAYEawAEBG4OAQMAAANUDgEDAwBYDQEAAwBMXl1aWVZUUlBLSklHQ0I/Pjo5GRUUGTcjEyEQEgUdKwEGByMiJjc0MzIeATcyNwYVFAEUBiMhIiYnND4FMzIeAj4BPwE2NzIeBBcBFAYiJjQ2MhYBFAYuAT4CFgUUBicjJic2NTQnFjMyPgEXMicUBiImNDYyFgFLWjpLLUABRQQqQiEmJQMCg1JD/hhEUAEEDBAgJjohBiQuSFBGGSkQCCI4JiAQDgH9xlR2VFR2VAGJfrCAAny0egFDPi5LOVotAyUlIUQoBEVHVHZUVHZUAV4DRCwsxRYaAQ0VEE7+W0JOTkIeOEI4NCYWGBwaAhYQGgoCFiY0OEIcAo87VFR2VFT+71l+Anq2eAaE0ysuAUQDQU4QFQ0YGAGPO1RUdlRUAAEAAAAAA6UCmAAVAB1AGg8BAAEBRwACAQJvAAEAAW8AAABmFBcUAwUXKwEUBwEGIicBJjQ/ATYyHwEBNjIfARYDpRD+IBAsEP7qDw9MECwQpAFuECwQTBACFhYQ/iAPDwEWECwQTBAQpQFvEBBMDwABAAD/7wLUAoYAJAAeQBsiGRAHBAACAUcDAQIAAm8BAQAAZhQcFBQEBRgrJRQPAQYiLwEHBiIvASY0PwEnJjQ/ATYyHwE3NjIfARYUDwEXFgLUD0wQLBCkpBAsEEwQEKSkEBBMECwQpKQQLBBMDw+kpA9wFhBMDw+lpQ8PTBAsEKSkECwQTBAQpKQQEEwPLg+kpA8AAQAA//kDEgMLACMAKUAmAAQDBG8AAQABcAUBAwAAA1QFAQMDAFgCAQADAEwjMyUjMyMGBRorARUUBicjFRQGByMiJjc1IyImJzU0NjczNTQ2OwEyFhcVMzIWAxIgFuggFmsWIAHoFx4BIBboHhdrFx4B6BceAbdrFiAB6RYeASAV6R4XaxceAegWICAW6CAAAQAAAAADEgHtAA8AGEAVAAEAAAFUAAEBAFgAAAEATDUzAgUWKwEVFAYnISImJzU0NjchMhYDEiAW/VoXHgEgFgKmFx4Bt2sWIAEeF2sXHgEgAAAAAv/9/7EDXwMLABUAIgAwQC0HAQIBAUcABAAEbwAAAQBvAAECAW8AAgMDAlQAAgIDWAADAgNMFRcXFBQFBRkrATQvASYiDwEnJiIPAQYUHwEWMjcBNhcUDgEiLgI+ATIeAQLNCjMLHAvkfgscCzMKCsoKHgsBLwqMcsboyG4Gerz0un4BuBAKMgsL434LCzIKHwrKCgoBLwpLdcR0dMTqxHR0xAAC//3/sQNfAwsAJAAxADBALR4VDAMEAgABRwAFAQEAAgUAYAMBAgQEAlQDAQICBFgABAIETBUXFBwUGQYFGislNC8BNzY0LwEmIg8BJyYiDwEGFB8BBwYUHwEWMj8BFxYyPwE2NxQOASIuAj4BMh4BAoEKZWUKCjMKHgplZQseCjILC2VlCwsyCh4LZWUKHgozCthyxujIbgZ6vPS6fuAOC2VlCx0LMgsLZWULCzILHQtlZQsdCzILC2VlCwsyC411xHR0xOrEdHTEAAAC//3/sQNfAwsAIwAwAEFAPg0BAAEfAQQDAkcCAQABAwEAA20FAQMEAQMEawAHAAEABwFgAAQGBgRUAAQEBlgABgQGTBUVIyQlIyQUCAUcKwE1NCYHIzU0JicjIgYHFSMiBhcVFBY3MxUUFhczMjY3NTMyNjcUDgEiLgI+ATIeAQKnFg6PFg5HDxQBjw4WARQPjxYORw8UAY8OFrJyxujIbgZ6vPS6fgE6SA4WAY8PFAEWDo8UD0gOFgGPDxQBFg6PFDN1xHR0xOrEdHTEAAAAAv/9/7EDXwMLAA8AHAAdQBoAAwADbwAAAQBvAAECAW8AAgJmFRU1JAQFGCsBNTQmByEiBhcVFBY3ITI2NxQOASIuAj4BMh4BAqcWDv5TDhYBFA8BrQ4WsnLG6MhuBnq89Lp+ATpIDhYBFA9IDhYBFDN1xHR0xOrEdHTEAAIAAP/5AjkCwwAPADsAa7UAAQABAUdLsA9QWEAmAAQDAgMEZQACAQMCAWsABQADBAUDYAABAAABVAABAQBYAAABAEwbQCcABAMCAwQCbQACAQMCAWsABQADBAUDYAABAAABVAABAQBYAAABAExZQAknFCseJiQGBRorJRUUBgcjIiY9ATQ2FzMyFhMUDgMHDgEVFAYHIyImPQE0Njc+ATQmJyIHBgcGIyIvAS4BNzYzMh4CAYkOCIYJDg4JhgkMsRAYJhoVFx4OCYYIDEoqIRw0IiQYFCgHCgcHWwgCBFmqLVpILpWGCQwBDgiGCQ4BDAFFHjQiIBIKDTANChABFgkaLlITECAyIgEQDjIJBEYGEAiUIjpWAAAD//3/sQNfAwsADwA3AEQASEBFKQEFAwkBAgEAAkcABAIDAgQDbQADBQIDBWsABwACBAcCYAAFAAABBQBgAAEGBgFUAAEBBlgABgEGTBUeKxMWJiYjCAUcKyU1NCYrASIGHQEUFjsBMjYTNC4BIyIHBh8BFjMyNz4BMhYVFAYHDgEXFRQWOwEyNjQ2PwE+AxcUDgEiLgI+ATIeAQH0CghrCAoKCGsICo8+XDGIRwkNSgQGCQUeJTgqFhsjPAEKCGsIChgSHAoeFAzXcsboyG4Gerz0un5SawgKCghrCAoKAX8xVC53DQs3BAcmGx4SFRoMD0IlFAgKChIiCxAGGhwoUnXEdHTE6sR0dMQAA//9/7EDXwMLAB4ALgA7AElARiggAgYFDgYCAgEYAQIEAANHAAgABQYIBWAABgABAgYBYAACAwEABAIAYAAEBwcEVAAEBAdYAAcEB0wVFiYmJhEmIyMJBR0rJTU0JisBETQmKwEiBh0BFBY7ARUjIgYdARQWOwEyNgM1NCYrASIGHQEUFjsBMjYFFA4BIi4CPgEyHgECOwoHNgoIsggKCgg1NQgKCgj6BwpHCghrCAoKCGsICgFlcsboyG4Gerz0un5SWQgKAR4ICgoIWQgKswoIWQgKCgH8WQgKCghZCAoK4HXEdHTE6sR0dMQAAAAAAgAA//kBZgMLAB4ALgA/QDwfAQUGGhICAgMIAAIAAQNHAAYABQMGBWAAAwACAQMCYAQBAQAAAVQEAQEBAFgAAAEATDUmIyYhFjMHBRsrJRUUBgchIiYnNTQ2NzM1IyImJzU0NjczMhYXETMyFgMVFAYHIyImPQE0NjsBMhYBZRQQ/uMPFAEWDiMjDxQBFg7WDxQBIw8WSBYOjw4WFg6PDxRkRw8UARYORw8UAdYWDkcPFAEWDv6/FgJ1aw8UARYOaw4WFgAAAAACAAD/+QEwAwsADwAfACxAKRkREAMCAwFHAAMCA28AAgECbwABAAABVAABAQBYAAABAEw1JiYkBAUYKyUVFAYHIyImPQE0NhczMhYTAw4BJyMiJicDJjY7ATIWAR4WDo8OFhYOjw8UEhABFg6PDhYBDwEWDbMOFpp9DxQBFg59DhYBFAI+/lMOFgEUDwGtDhYWAAAAA//9/7EDWQMLAAwAHAAuAERAQSgeAgUEFhUOAwMCAkcGAQAABAUABGAABQACAwUCYAADAQEDVAADAwFYAAEDAUwBACwqIyEaGBIQBwYADAEMBwUUKwEyHgEUDgEiLgI+ARM1NCYrASIGBxUUFhczMjYnEzQnJisBIgcGFRMUFjsBMjYBrXTGcnLG6MhuBnq8wQoHawgKAQwHawcKAQoGBQh7CAUGCgoJZwgKAwt0xOrEdHTE6sR0/UhqCAoKCGoICgEMxwFaBwMFBQMH/qYGCAgAAAAB//MAAAHfAfAADQAGswYBAS0rATYXFg8BBi8BJjc2HwEBlRYaGhrEFhrEGhoYGqoB1hoaFhrAFhbAGhYYGJwAAf/0AAABFgJUAA0ABrMJAwEtKzcWBwYvASY/ATYXFg8B/BoaGhbAGBjAFhoaGpy0GhYaGsIYGsIaGhYarAAAAAH/8wAAARUCVAANAAazCwUBLSs/AScmNzYfARYPAQYnJg2enhoaGhbAGBjAFhoatKqsGhYaGsIaGMIaGhYAAAAB//QAAAHcAfAACwAGswUBAS0rNwYmPwE2HwEWBi8BPhowGMQaFsQYMBqq5hYuGr4aGr4aLhaeAAMAAP/iAvgC2gAHAA8AGAA4QDUAAAACAwACYAADAAUGAwVgCAEGAQEGVAgBBgYBVgcEAgEGAUoREBUUEBgRGBISERISEAkFGisRIAARIxAAIRUyABUjNCYjFzIWFAYiJjQ2AToBvnb+iP722gEydu6oci5ERFxERALa/kL+xgEKAXZ2/s7Ypu6yQl5CQl5CAAIAAAAAAsUCoAACAAUACLUFAwIAAi0rCQInLQECxf4sAdRG/u0BEwKg/r7+voW9vQAAAAACAAAAAAMQAqAAAgAFAAi1BQMCAAItKyUJARcNAQE8AdT+LEYBE/7tHAFCAUKFvb0AAAAAAgAA/7EDWgMLAAgAagBFQEJlWUxBBAAEOwoCAQA0KBsQBAMBA0cABQQFbwYBBAAEbwAAAQBvAAEDAW8AAwIDbwACAmZcW1NRSUgrKiIgExIHBRYrATQmIg4BFjI2JRUUBg8BBgcWFxYUBw4BJyIvAQYHBgcGKwEiJjUnJicHBiInJicmNDc+ATcmLwEuASc1NDY/ATY3JicmNDc+ATMyHwE2NzY3NjsBMhYfARYXNzYyFxYXFhQHDgEHFh8BHgECO1J4UgJWdFYBHAgHaAoLEygGBQ9QDQcHTRkaCQcEEHwIDBAbF08GEAZGFgQFCCgKDwhmBwgBCgVoCA4XJQYFD1ANBwhNGBoJCAMRfAcMAQ8cF08FDwdIFAQECSgKDwhmBwoBXjtUVHZUVHh8BwwBEB4VGzIGDgYVUAEFPA0ITBwQCgdnCQw8BQZAHgUOBgwyDxwbDwEMB3wHDAEQGRogLQcMBxRQBTwNCEwcEAoHZwkLOwUFQxwFDgYMMg8cGhABDAAAAAMAAP9qA1oDUgACABcALAAsQCkCAQBEAAABAHAAAgADBAIDYAAEAQEEVAAEBAFYAAEEAUwZGhkXEAUFGSslIQcBFAcGBwYiJyYnJjQ3Njc2MhcWFxYHNCcmJyYiBwYHBhQXFhcWMjc2NzYBXAExmQFmMTBRU8JTUS8xMS9RU8JTUTAxRycmQUOcQ0EmJycmQUOcQ0EmJ0bcAoNhU1EwMTEwUVPCU1EvMTEvUVNhTkNBJicnJkFDnENBJycnJ0FDAAYAAP+DA+gDOQAjACcAKwAvADMAPACIQIUhAQcABQEBDRcBCQIPAQMIBEcQAQARAQcGAAdeAAYADA4GDF4TAQ4ADw0OD2ASAQ0LBQIBAg0BXgoEAgIACQgCCV4ACAMDCFIACAgDWAADCANMNTQwMCQkAQA5ODQ8NTwwMzAzMjEvLi0sKyopKCQnJCcmJR0cGxkTEQsKCQcAIwEjFAUUKwEhIgYVERQWMyEVIyIGHQEUFjMhMjY9ATQmKwE1ITI2NRE0JgcRIREBITUhJyM1MyU1IRUlIgYUFjI2NCYD1vw9CAsLCAGAbAcLCwcBrQgKCghyAXQICgob/GICnP55AYeEhYX96AOe/jgJDQ0SDQ0DOQoI/WwICnQKCGYHCwsHZggKdAsHApQICiT+KQHX/JJBJXQkdHRMDBINDRIMAAAABf/2/8wD6QLxAEAATABYAHMAfgB1QHJ7ZUgxEAUHBkIBCgd1ZkcDCQpyAQwJcwELDAVHegEKAUYAAAMAbwADAAgFAwhgAAIABQYCBWAAAQAGBwEGYAAHAAoJBwpgAAkADAsJDGAACwQEC1QACwsEWAAECwRMcG5dW1VUT04VKCQfLyUkFBENBR0rASYiBwYHBgcGJyMmBwYHBgcuASMiBg8BOAExBwYHBhYfAR4BMzI2PwE4ATE3Njc2Jic2NzY3NhczFjc2NzY3NjQFByYjIg8BJz4BMhYDBiImND8BNjIWFAcDDgEjIiYvAS4BNj8BFwcOARUUFx4BMzI/ARc3Jzc2NTQnNx4BBgPjBg8FHhkUFgwZAR0RHBwhJiVdNTtwKwKrORYVIDQUJF82OnAsqwM4FhUeMh8bFhYOGQIcEBsaICQF/pJSExQfGCR5JlxcUIcKIxcMSAwhFwtJJmI0LlMeFC0bJzGeeQoLDBcKHQ8hFQt5GnkkFgtSKhshAusFBR4NCwEBBAUBAQ0QIyMlMCsCqzlKSZA0EyUmLyusAjhJSI80HQ4KAQEFBAEBDhAjBRCGUgsWJHkhJB/+6gwXIwpIDBcgDf6RJiohHxQtfYAxnnkLCh0PIRULDBcKeRp5JBgeFRNSK3d6AAAAAv///2oD9ANSACgATQAyQC89NiMRBAECAUcAAgMBAwIBbQABAW4AAAMDAFQAAAADWAADAANMSkg7OhYVIQQFFSsBJiMiBgcGDwEnJgcGBwYHBhcHBhQWMj8BPgE3Njc2Nz4BLwE3Njc+AQMHDgEfAQYHBgcGBwYHATY0JiIHATY3NjcXFjY/AT4BMzIXFgYDxCRAV+pzAwIrOgsHPCEaCQYCpwUMDQemW71QaksoEgQBAhR7BQFJHYOEBgUCFyARR2VMWU07AVgFCw8F/qMDFR8/PgcMAi9r3k4xGSQgAy4kfm0DBYEJAglLZUxUNymnBQ8LBacINCk1TCgVBAoFN0YCBHW7/udLAw0HOyIRRzMnGRUHAVgFDwsF/qNTUHZTCgEHBoxleRklpAAABgAA/3IELwNJAAgAEgAbAHoAtgDxAJxAme7ZAgQOal0CBQjQvHADAAW+rKB1UkxFIx0JAQCznkADAgE6LQIGApWAAgsDB0fn2wIORYIBC0QKAQgJBQkIBW0ABgIHAgYHbQAOAAQJDgRgAAkIAAlUAAUNAQABBQBgAAIGAQJUDAEBAAcDAQdgAAMLCwNUAAMDC1gACwMLTOXjx8aqqIuKbWxkYlpZNDIrKhMUFBQTEg8FGisBNCYiBhQWMjYFNCYOARcUFjI2AzQmIgYeATI2BxUUBg8BBgcWFxYUBw4BIi8BBgcGBwYrASImNScmJwcGIicmNTQ3PgE3Ji8BLgE9ATQ2PwE2NyYnJjQ3PgEzMh8BNjc2NzY7ATIWHwEWFzc2MhcWFRQPAQYHFh8BHgEBFRQHBgcWFRQHBiMiLwEGIicOAQciJyY1NDcmJyY9ATQ3NjcmNTQ/ATYzMhYXNxc2PwEyFxYVFAcWFxYRFRQHBgcWFRQHBiMiJicGIicOASInJjU0NyYnJj0BNDc2NyY1ND8BNjMyFhc3FzY/ATIXFhUUBxYXFgH0VHZUVHZUAa0sOCwBKjosASw4LAEqOizYCARXBgwTHwQEDEQQBUAVFgYHBA1oBgoNExdCBA0GUAQFJAgNB1UFCAgFVgcLEx8EBAxECgYGQBMYBgcDDWgGCgENExdBBQ0FUQQYEQgNBlUGBgFmUwYKHAJEAQUVHQsMCwcsAwFEAx0KB1NTBwodAzQQAQQqCBERHBcEAkMCHAkHU1MGChwCRAEFKggLDAsHLAREAx0KB1NTBwodAzQQAQQqCBERHBcEAkMCHAkHUwFeO1RUdlRU4x0sAigfHSoqAlkdKio7KirNZwYKAQ4TFxslBgwEEUIEMgsGPBsNCAZVBgwyBARLDwUFCCwMGBYNAQgHaAUKAQ4TFxslBgwFEEIEMgoIPBoNCAZVBgsxBARLDwQGHhUNGxMMAgj+z04JCA8OPw4CAigbJQEBCzQBKAICDj8ODwgJTgkJEA0/DgICHgk0DAEBKBcBJwICDj8NEAkCM04JCQ8OPw4CAic0DAEBDDQnAgIOPw4PCQlOCQgQDT8OAgIeCTQLAQEnFwEnAgIOPw0QCAAACQAA/7EDWQLEAAMAEwAXABsAHwAvAD8AQwBHAJ9AnCsBCwY7AQ0EAkcaERUDBxABBgsHBl4XAQoACwwKC2AZDxQDBQ4BBA0FBF4YAQwADQIMDWATAQIBAwJUFgkSAwEIAQADAQBeEwECAgNYAAMCA0xEREBAMTAhIBwcGBgUFAUEAABER0RHRkVAQ0BDQkE5NjA/MT8pJiAvIS8cHxwfHh0YGxgbGhkUFxQXFhUNCgQTBRMAAwADERsFFSs3FSM1JTIWHQEUBisBIiY9ATQ2PwEVITUTFSM1ARUhNQMyFgcVFAYHIyImJzU0NhcBMhYHFRQGByMiJic1NDYXBRUjNRMVITXExAGJDhYWDo8OFhYO6P4efX0DWf5lfQ8WARQQjg8UARYOAfQOFgEUD48PFAEWDgFBfX3+HkBHR0gWDo8OFhYOjw8UAdZHRwEeSEj9xEdHAoMUEI4PFAEWDo4PFgH+4hQPjw8UARYOjw4WAUdHRwEeSEgAAAMAAP+xBDADUgAIACIAKwBQQE0ABQIFbwQJAgIHAm8ABwAHbwgBAAEAbwABBgFvCgEGAwMGVAoBBgYDWAADBgNMJCMKCQEAKCcjKyQrHxwZFxIPCSIKIgUEAAgBCAsFFCsBMhYUDgEmPgElMhYHERQGIyEiJjURNDY7ATc+ATMhMhYfAQEyPgEmDgEeAQIYQl5ehGACXAHNO1QBUjz87jtUVDt9HAs4HgEeHTgLHf70Z5IClsqYBowB216GXAJggmLmVDv+DDtUVDsB9DtUTBsoKBtM/X2UzJYEjtSMAAAADP/9/3AD6gNOACcAKwAwAGAAagB1AIMAkgCfAK0AuwDKAUhADGNDPgMJDhIBAQICR0uwCVBYQEwXARQNCA0UCG0TARIEBQQSBW0VAQAADRQADWAKAQgRAQ4JCA5gEBYPAwkLBwIEEgkEYAwGAgUAAwIFA14AAgEBAlIAAgIBWAABAgFMG0uwClBYQFIXARQNCA0UCG0AEgQTBBITbQATBQQTBWsVAQAADRQADWAKAQgRAQ4JCA5gEBYPAwkLBwIEEgkEYAwGAgUAAwIFA14AAgEBAlIAAgIBWAABAgFMG0BMFwEUDQgNFAhtEwESBAUEEgVtFQEAAA0UAA1gCgEIEQEOCQgOYBAWDwMJCwcCBBIJBGAMBgIFAAMCBQNeAAIBAQJSAAICAVgAAQIBTFlZQDm9vGFhBgC8yr3KuLWmpXJwbWthamFpZmRaWVBPTUtIRkFAOzo3NTQzLy4tLCsqKSgWFAAnBicYBRQrATA5ATAxIg4CFRQWFxYXFh0BFBYzITI2PQEwMTQ3Njc+ATU0LgITIzUzAzMDIzQXBgcjEzMyNjQmIgcGBwYVIyY1JicmIyIGFBY7ARYVIyYnLgE1ND4CMh4CFRQGJzQ1NjMyFhQGKwIiJjQ2MzIXFhcTFjI2PwE2LgEGDwEGFiUeATMyNz4BLwEuAQ4BFwEXFjI+ASYvASYOARYTBw4BFxYzMj8BPgEuAQUnJg4BFh8BFjMyNzYmAzI/AT4BLgEPAQ4BFx4BAfM7a1ItNjELBwoLBwEgCAoKBwsyNS1Sa0L6+qFIA0LHJQM4AygZJCQzExcGAUsBBREUIBklJRknAzgDJSsvJ0hdaF1JJi+GBx8KDg8JuyYKDw8KEgoHAs4CCgoCQAMGDg4DQAMG/uoCCgUDBAcGAzwDDg4GA/7vlQIKCgUGB5QHDgYFnJUHBwMFDQQClgcGBQ8DNJUHDgYGB5YEAQwFAwWjBAOVCAYGDgeWBwYDAQoCfitSazpCcykIFiA4hgcLCweHOCAXCClxQjprUiv9F2EBJ/7+lhQfYwECJjMlEBMlAw4ICR8UFyY0JmOfYR8iZjkzXUcmJkddMzljggYFKQ8VEBAWEA8LEAFFAQYFlAcPBgYHlAgOBwUHAgIPB5UIBgYOB/7dQAEGDA4DQAMGDg7+zDwCDggLATwDDg4GQT8DBg4OA0ABCwcPATIBPAMODgYDPAMNCAUGAAABAAAAAAI8Ae0ADgAXQBQAAQABAUcAAQABbwAAAGY1FAIFFisBFA8BBiIvASY0NjMhMhYCOwr6CxwL+gsWDgH0DhYByQ4L+gsL+gscFhYAAAb////BA+gC+wAYADYAPwBIAIMAwQCBQH5lAQMAs1YCCwMCRwANDwwMDWUACwMJAwsJbQAJBAMJBGsACAAPDQgPYA4BDAAKAAwKYQAAAAMLAANgEAEEAAcGBAdgAAYABQIGBWAAAgEBAlQAAgIBWAABAgFMODe7uaOioZ2cm4uJa2lcWk9NRkVCQTw7Nz84Pz0uODERBRgrASYrASIGBwYHBhUUFjMhMjY1NCcmJyYnJhMUBw4BJyEGJicmNTQ3Njc2Nz4BOwEyHgEXFhceASUiBhQWMjY0JhcGIiY0NjIWFAEmJy4BIyIHBgcGFwcVHgEXFjMyNz4BNzY3Nj0BNDc+ATMyFxYXHgEdARQXHgEXFhcWFxY3Njc2NzU0BxQHBgcGIycmJyYnJj0BNCYnJicmLwEmLwEmByMiBwYHDgIdARQOAQcGBwYnJic1NyY3PgEzMhcWFx4BFQJdMTcBUIUvJxQSKiUCBSUrFBYpHyImggQEDAT9+wUMBAQRDyYhLhtEJwEmRDUUEhAlIP7mRF9eiV9hCiBZQD9bPwFZLklLsGCSd3Q4MwEBAgwNGzYSBjU4CwcCAgYUhU1APzceDg4BAg8NDxgbIkUiDAgGATcCAwYNHBE9DwQBARsXFB8dHQ0dDy8HDwolEyQlLUspAQQGEzUuDQgEAQEiMtOKwoA2JBUYAgcVVVFAUkxBRlBQRUhMUkExICX+Yx0YFRcCARYVGB49Q0BENyUWGBgrFxYcP4nbX4leX4Zh8CA/Wz8/WwHdMBocHSAgOTM/EicQJw8cAQcdGBAQDRkLBgYUHAoJDggNBggbDBEiCgsJCQQIIgwXExE4OUofDxMHCwEGFAUOCBkJFiQNCwkIBQIDAQQBAQICBQUdKh0LEQ0SBhEFBA4KGSMUKSIyODQVHBAqFwAE////sQOhAwsAAwAMABUAPQBZQFYNAQECFwEGAQJHAAMECQQDCW0IAQYBAAEGAG0ACgAEAwoEXgsBCQAFAgkFYAACAAEGAgFeAAAHBwBSAAAAB1gABwAHTDw6MzAtKxMzKRMTIREREAwFHSsXITUhNSE1IyImPQEhATQuAQ4BFj4BNxUUBgcjFRQGIyEiJic1IyImNzU0NhczETQ2MyEyFh8BHgEHFTMyFtYB9P4MAfRZFiD+mwKDFCASAhYcGEYMBn0gFv3oFh4BfQcMAUArJCAVAXcXNg9VDxgBIy0+B4/W1iAWWf53DxQCGBoYBBAR6AcKAVkWICAWWQwG6CxAAQEwFiAYDlUQNhaPPgAAAAIAAP/5A6EDUgApAFcARUBCAAgBCG8ABAUGBQQGbQAGAwUGA2sAAQACBwECYAAHAAUEBwVgAAMAAANUAAMDAFgAAAMATFNRTUslJRw1KSUzCQUbKwEVFAYjISImNRE0NjczMhYHFAcGBwYrASIGBxEUFhchMjY9ATQ3Njc2FhMHBiMiJyY9ASMiBwYXFg8BIi8BLgMnND4HNzM1NDc2MzIfARYUAxJeQ/4wQ15eQ44HDAEPKx8FBD4lNAE2JAHQJTQKEA8IF4TWCg8HBxZZtUBCGQINBwkFDAYgGBIBBAwSJChATGY7WRYHBw4L1gsBKpBDXl5DAdBCXgEMBg8DDxMCNCX+MCU0ATYkdwsFBw4JCgEK1gsDCRhrSU27DQYBBxEJPDJOHRswNC4sKBwaCAJrGAkDC9YKHgAAAAACAAAAAAPoArkAIwA3AClAJhsSCQMFBAFHAQEABABvAAQFBG8ABQIFbwMBAgJmJScUHBQWBgUaKwE3NjQvASYiDwEnJiIPAQYUHwEHBhQfARYyPwEXFjI/ATY0JwEHIyIGHQEUFjsBFxY3NjURNCcmA1iBDw8jDykPgYEPKQ8jDw+BgQ8PIw8qDoGBDykPIw8P/aPgXSMcHSJd4BcPExMPAV6BDyoOJA4OgoIODiQOKg+BgQ8qDiQODoKCDg4kDioPAcyvHCK8IhyvEAQEIQJkIQQEAAMAAP/HA+gC9QAPAB8AMwAkQCEYEQIBAAFHAQEARRkJCAMBRAAAAQBvAAEBZiooIyECBRQrAQcWFxYUBwYHFzY3NjQnJgUHFhcWFAcGBxc2NzY0JyYlByMiBh0BFBY7ARcWNzY1ETQnJgMwdUUmKCgmRXVWMDIyMP7neSkaHBwaKXk5IiMjIv7W4F0jHB0iXeAXDxMTDwL1ZDlOUbZRTjlkTWhr7mtoWmgSJCZYJiMTaCs9QY5BPYavHCK8IhyvDwMFIQJjIQQEAAAAAAIAAP9qA+gDUgAcACkAPkA7AgEABBoZGAMCAAJHHBsCAkQAAQAEAAEEYAUDAgACAgBUBQMCAAACWAACAAJMHh0kIx0pHikpGRAGBRcrJSMnPgE1NCcmJyYiBwYHBhQXFhcWMzI2NxcVATcBIi4BND4BMh4BFA4BAsotEiwwMzFUV8pXVDEyMzFUVmVFfC8SAR1W/YtGdkVFdox2RkV33RIvfEVlVlQxMzMxVFbKV1QxMzAsEi3+4lYBHUV3jHZFRXaMdkYAAAAABAAA/6gD6AMUAAMAFwAbACQAVkBTAAABAG8AAQIBbwAICQcJCAdtAAcDCQcDawUBAwYJAwZrCgECAAkIAglgAAYEBAZSAAYGBFYABAYESgYEIyIfHhsaGRgSEA8ODQsEFwYXERALBRYrEyEVIQUhIgYVERQWOwEVITUzMjY1ETQmASERISUUBiImNDYyFvoB9P4MArD8lRolJRq7AfS8GiQk/uz+iQF3AQgbJhoaJhsDFH0/JBr+xxok+/slGQE5GiT9jwE52hMaGiYbGwAAAAIAAP/6A+kCwwAjACYAH0AcJiUkAwIAAUcAAQABbwAAAgBvAAICZj8hFQMFFysBJicmJyYnJiciBwYHDgEHBhQXFhcWFxYXFjMWNzY3PgE3NjQBEQUD4AMPEBkeJra1yaYiHhohAwkJAxARGh0jubfGpCIdGyIDCP2PATgCGyQgJRYZAQ0BDgQbGEgjaZVpIyMmGBwEDAENBhsZSCJpnv77AWe0AAAAAAEAAP+xA2QDCwA1AB1AGjUsIxoRCAYAAQFHAAEAAW8AAABmKSY7AgUVKwEeAQ8BDgEvARUUBgcjIiY3NQcGJi8BJjY/AScuAT8BPgEfATU0NjczMhYdATc2Fh8BFgYPAQM7Gg4OIw86GZUqHUcdLAGUGjoOJA4OG5SUGhAPJA84G5QqHkcdKpUaOBAjDxAZlAEIDjoaPRoODlWrHSoBLByrVQ8QGT0aOg5WVg46Gj0aDg5Vqx0qASwcq1UPEBk9GjoOVgACAAD/+QOgAwsALQBCAE5ASzsBBAYlAQUEAkcABwECAQcCbQAGAgQCBgRtAAQFAgQFawAFAwIFA2sAAQACBgECYAADAAADVAADAwBYAAADAEwUFxUnNTk1MwgFHCsBFRQGIyEiJjURNDY3ITIXHgEPAQYjJyYjISIGBxEUFhchMjY9ATQ/ATYzMhcWEwEGIi8BJjQ/ATYyHwEBNjIfARYUAxJeQ/4wQ15eQwHQIx4JAwcbBgcFDQz+MCU0ATYkAdAlNAUkBgcDBAuB/jkNJA7wDg49DiQOkwFpDSQOPg0BS7FDXl5DAdBCXgEOBBMGHAUBAzQl/jAlNAE2JI0IBSMGAgQBBf46Dg7wDSQOPg0NkwFpDQ09DiQAAv/9/7EDXwMLABAAHQArQCgAAwQBAAEDAGAAAQICAVQAAQECWAACAQJMAQAbGhUUCQgAEAEQBQUUKwEiDgMeAj4DNC4CARQOASIuAj4BMh4BAa1JhGA4AjxciI6GXjo6XoYBZXLG6MhuBnq89Lp+AsM4YISShF48BDRmfJp8aDD+n3XEdHTE6sR0dMQAAAAAAwAAAAADEgHtAA8AHwAvACJAHwUDAgEAAAFUBQMCAQEAWAQCAgABAEw1NTU1NTMGBRorExUUBicjIiYnNTQ2NzMyFgUVFAYnIyImNzU0NjczMhYFFRQGJyMiJj0BNDY3MzIW1h4XaxceASAWaxYgAR0gFmsWIAEeF2sXHgEfIBZrFiAgFmsXHgG3axYgAR4XaxceASAWaxYgAR4XaxceASAWaxYgAR4XaxceASAAAAADAAD/+QDXAwsADwAfAC8ALEApAAUABAMFBGAAAwACAQMCYAABAAABVAABAQBYAAABAEw1NTU1NTMGBRorNxUUBgcjIiYnNTQ2FzMyFgMVFAYnIyImJzU0NjczMhYDFRQGKwEiJic1NDY7ATIW1h4XaxceASAWaxYgAR4XaxceASAWaxYgAR4XaxceASAWaxYgmmwWHgEgFWwWIAEeAQZrFiABHhdrFx4BIAEIaxYgIBZrFiAgAAAAAv/9/7EDWQNSACgANAAnQCQAAwIDbwACAQJvAAEAAAFUAAEBAFgAAAEATDMyLSwaGRQEBRUrARQOAiIuAjc0Njc2FhcWBgcOARUUHgIyPgI3NCYnLgE+ARceAQERFAYiJjcRNDYyFgNZRHKgrKJuSgNaURg8EBIIGDY8LkxqdGhQKgE8NhcKJDwXUVr+myo6LAEqPCgBXleedEREdJ5XZrI+EggYFzwRKXhDOmpMLi5MajpEdioSOjAIEj20AUj+mh0qKh0BZh0qKgAAB//6/7ED6gLDAAgASgBYAGYAcwCAAIYAe0B4d3ZAPgQJCHhtbGhnQi0HBQmDeSoDAQCGgHonEgUKBIIVAgsKBUcABwYIBgcIbQACCwMLAgNtAAYACAkGCGAACQAFAAkFYAAAAAEEAAFgAAQACgsECmAACwIDC1QACwsDWAADCwNMZmRfXVhWKhooKCcrGhMQDAUdKwEyFg4BLgI2FwUWBg8BBiInJQcGIxYHDgEHBiMiJyY3PgE3NjMyFzY/AScmJwYjIicuAScmNjc2MzIXHgEXFgcfASU2Mh8BHgEHBTYmJyYjIgcGFhcWMzIDPgEnJiMiBw4BFxYzMhMXNTQ/AScHBg8BBiMfAQEnBRUHHwIWHwEFNyUHBgcCGA4WAhIgEgQaswEbEAUQSAcTB/5/PgQDCAIENi9KUEwwMwcENi5KUS4mBQhERAgFJi5RSi42BAMWGS9NUEouOAMCCAc+AYEHEwdIEAUQ/WkaHC00NyoVGhwtMzgpGS0cGhYpODMtHBoVKjeXNhIILA8BBAkBAXg2AZpH/lNZBQQGBAIPAeJH/t5jAQYBXhYcFgISIBIi3gsoCCQEBNgkAxwaK1AdLywvRSpQHS8SCAUoKQUHES8eTishPBYsLx1OLBsbAyXYBQQkCScMTRhKHCEUGEgeIf51HEoXFCEcShcUAXchBxQLBBoOAgQJAYISAUEk8EA1BQMHBQEPsiPkTQICAAAAAAQAAP9qA+gDUgAIABgAGwA3AE5ASxIKAgQDMgECBBsBBQIDRwAHAQABBwBtAAgAAwQIA2AABAACBQQCXgAFAAEHBQFgAAAGBgBSAAAABlgABgAGTDUjNRMXJBMhEAkFHSsFIREjIiYnNSM3NTQmJyEiBhcVFBY3ITI2EzMnBREUBgchIiYnNSEiJicRNDY3ITIWBxUWHwEeAQGtAfTpFh4B1o4KB/53BwwBCggBiQcKj6enAR4gFv3pFx4B/tEXHgEgFgJfFiABDAjkEBZPAWYeF+ihJAcKAQwGJAcMAQr+kafu/okXHgEgFlkgFQLuFx4BIBa3BwjkDzYAAAQAAP+xA1kDCwADACEAMQBFAFFATisqIyIECAQBRw0BBAYBCAJGAAoHAQQICgRgAAgAAwYIA2AABgABAAYBXgUCAgAJCQBSBQICAAAJWAAJAAlMQD04NRcmMxETOxEREAsFHSsXITUhBTMRNCYvAS4BBxUUBiMhIiYnNSMRMzU0NjMhMhYHAzU0JisBIgYXFRQWNzMyNgURFAYjISImJxE0NjMhMhYfAR4B1gGt/lMB9EgMBZ0FHAgeF/6+Fh4BSEggFQHRFiAB1goIawcMAQoIawcMAWQeF/0SFx4BIBYCBRc2D5wQFgfW1gH0CBoHnAYMAegWICAW6P026BYgIBYBHrIICgoIsgcMAQoK/foWICAWAu4WIBgOnQ82AAAAAAP/+f+xA6kDCwBRAGEAcQBUQFE4AQUBUAEEBQ8NDAMCBgNHAAYHAgcGAm0AAgMHAgNrAAEABQQBBV4ABAAHBgQHYAADAAADVAADAwBYAAADAExubGZkXl1WVUtIRUI9OjUIBRUrARYHAw4BByEiJicmPwE2NzQmNTY/AT4BNzYmNj8BPgE3NiY3Nj8BPgE3NCY+AT8CPgE/AT4CFxU2MyEyFgcDDgEHISIGFxYzITI2NxM2JxYFBhYXITI2PwE2JichIgYPAQYWFyEyNj8BNiYHISIGBwOTFgyaCkAl/f0rUA8ODQEBAgQBBBINGAUCBAQHCgwWAwEEAgIKDQoaAwQCCAYKCQUGBgsFFBQQFQcBqSkuDZkUKDT+Gw8MBQ5DAgMQHgWnBAEV/boCBggBUwgOAgwCBgn+rQcOAjoDCAcBUwcOAwsDCAf+rQcOAwJHHyn+ByQwATwsJSIPDQcFDgQGBhoVPBUGFgsJDRQ+FAUYBAcKDQ5CFQQUCQwHCxEKFAoSCAoCBAEFQCj+BkImAREPJxIOAiYNEwgRBwoBDAYkBwoBDAazBwoBDAYkBwwBCggAAAAD////9gR3AsMAEAAhADYAJ0AkAAUCAQABBQBgAwEBBAQBVAMBAQEEWAAEAQRMNzglKBcUBgUaKwE0LgIiDgIUHgIyPgIlNC4CKwEeAQ4BBzMyPgI3FA4CJyEiLgM+AjchMh4CAoMuTGp0akwuLkxqdGpMLgGsLE5oO9hDTgJKRdg6akwuRzpehkf+U0iEYDgCPFyIRgGtSIRgOAFeOmpMLi5ManRqTC4uTGo6OmpMLjKWrJYyLkxqOkiGXD4DOGKAloBkNAI4YIQAAAACAAD/9wR4AsMAFAAlACpAJwAAAAMCAANgBAECAQECVAQBAgIBWAABAgFMFhUeHRUlFiU3NAUFFisRND4CMyEyHgMOAichIi4CBTI+Ai4DIg4DHgI6XoZHAa1IhGA4AjxciEb+U0iEYDgDETpqTC4CKlBmeGZQKgQySG4BXkmEYDg4YISShF48AjhigNMuTGp0akwuLkxqdGpMLgAD////sQOhAwsABgANAB0AOUA2BAEAAQFHAAUCAQEABQFeAwYCAAQEAFQDBgIAAARYAAQABEwBABwZFBELCgkIAwIABgEGBwUUKxchESERFBYlESERITI2ExEUBgchIiY3ETQ2NyEyFlkBVP6aDAMG/psBUwgKSDYk/RIkNgE0JQLuJTQHAoP9jwcMEwJx/X0KAq79WiU0ATYkAqYlNAE2AAAAAAr////5A6EDCwAPAB8ALwA/AE8AXwBvAH8AjwCfAHpAd4mBaWE5ODEHBwZ5cUlBGREGAwJZUSkhCQgBBwEAA0cAExAMAgYHEwZgEQ0CBw4IAgIDBwJgDwkCAwoEAgABAwBgCwUCARISAVQLBQIBARJYABIBEkyem5aTjYuFg317dXNta2VjXVtVU01LJiYmJiYmJiYjFAUdKyU1NCYrASIGBxUUFjsBMjY9ATQmKwEiBgcVFBY7ATI2BTU0JisBIgYdARQWOwEyNgE1NCYrASIGBxUUFjsBMjYFNTQmKwEiBh0BFBY7ATI2BTU0JisBIgYdARQWOwEyNgE1NCYrASIGHQEUFjsBMjYFNTQmKwEiBh0BFBY7ATI2PQE0JisBIgYdARQWOwEyNjcRFAYjISImNxE0NjchMhYBHgoIswcKAQwGswgKCgizBwoBDAazCAoBHQoHswgKCgizBwr+4woIswcKAQwGswgKAR0KB7MICgoIswcKAR4KCLIICgoIsggK/uIKB7MICgoIswcKAR4KCLIICgoIsggKCgiyCAoKCLIICkg2JP0SJDYBNCUC7iU0UmsICgoIawgKCt5sBwoKB2wHCgrPawgKCghrCAoKAbVrCAoKCGsICgrPbAcKCgdsBwoKz2sICgoIawgKCgG1awgKCghrCAoKz2wHCgoHbAcKCt5rCAoKCGsICgq6/aElNDQlAl8lNAE2AAP//f+xA18DCwAIABUAIgA8QDkAAQIAAgEAbQAAAwIAA2sABQYBAgEFAmAAAwQEA1QAAwMEWAAEAwRMCgkgHxoZEA8JFQoVExIHBRYrARQGIi4BNjIWJyIOAh4BMj4BLgIBFA4BIi4CPgEyHgECO1J4UgJWdFaQU4xQAlSIqoZWBE6OAVtyxujIbgZ6vPS6fgFeO1RUdlRU9VKMpIxSUoykjFL+0HXEdHTE6sR0dMQABQAA/7EEdwMLAAMABwANABEAFQBmQGMABQoFbw8BCgMKbwwBAwgDbw4BCAEIbwsBAQABbwkHAgMABgBvDQEGBAQGUg0BBgYEVgAEBgRKEhIODggIBAQAABIVEhUUEw4RDhEQDwgNCA0MCwoJBAcEBwYFAAMAAxEQBRUrAREjEQERIxEBFSERMxEBESMRJREjEQFljwFljgLK+4lHAsuPAWWPAV7+4gEeAR79xAI8/X1IA1r87gH0/lMBrdb9fQKDAAAAAAIAAP+xBHcDCwAFAAsANEAxCwoJAwMBAUcAAQMBbwADAgNvBAECAAACUgQBAgIAVgAAAgBKAAAIBwAFAAUREQUFFisFFSERMxEBEyEREwEEd/uJRwNajvxg+gFBB0gDWvzuAjv+DAFCAUH+vwAAAAAD//7/sQPEA1IACwAQABYALkArAAECAxABAgACAkcABAEEbwABAwFvAAMCA28AAgACbwAAAGYRFBEVIwUFGSsJAQ4BByIuAj4BMxMhFAYHEyERMh4BAa0BMDueV3XGcAR4vnloAa9CPVz+U3XEdAFh/tA9QgF0xOrEdP5TWJ47AXgBrXLGAAAAAgAA/7EEdwMLAAUAHwBLQEgYCwIEBRcSEAMDBBEBAgMDRwABBQFvAAUEBW8ABAMEbwADAgNvBgECAAACUgYBAgIAVgAAAgBKAAAdGxUUDg0ABQAFEREHBRYrBRUhETMRARUUBi8BAQYiLwEHJwE2Mh8BAScmNjsBMhYEd/uJRwPoFApE/p8GDgaC6GsBRwUOBoIBA0MJCA3zBwoHSANa/O4CuPIMCglE/p8GBoLpbAFGBgaCAQNECBYKAAAB//v/rQNeAxAAQQAaQBc9ODMuKSQfGRMLBQsARQAAAGYREAEFFCsBFxYGDwEXFgcGLwEHBgcGIyIvAQcGJyYvAQcGJyY/AScuAT8BJyY2PwEnJjYfATc+AR8BNzYWHwE3NhYPARceAQcDAE0RDRZpHgYREBdoGwUXBwQRC0tMDxgXBRtoFxARBx1pFg0RTU0RDRZpHQchF2gbBS4QTEsQLgUbaBchBh5pFg0RAV5LEC4GG2cXEBIHHmkXBwENTU0RBQcXaR4HEhAXZxsGLhBLSxAuBhtnFyIHHWgXDRJNTREMF2gdByIXZxsGLhAAAAAEAAD/zgPUAu4ACAAQABgAIABbQFggHRwDBQQUAQIFGBUMAwMCEA0CAAMERwAGAAcEBgdgAAQABQIEBWAAAgADAAIDYAgBAAEBAFQIAQAAAVgAAQABTAEAHx4bGhcWExIPDgsKBQQACAEICQUUKyUyFhQGIiY0Nic2MhcHJiIHJzYgFwcmIAcnNiAXByYgBwHqKjo6Ujo6qlj0WEY6pDrSkgGakEZ0/rp20swCPspGrv4UrpY8Ujo6UjxwWFhIOjrUlJRGdnbUzs5GsLAAAAAAAgAA//kDEwMLAA8AHwArQCgAAwQBAAEDAGAAAQICAVQAAQECWAACAQJMAgAeGxYTCgcADwIPBQUUKwEhIgYHERQWFyEyNjURNCYXERQGIyEiJjURNDY3ITIWAnH+MCU0ATYkAdAlNDR8XkP+MENeXkMB0EJgAsM0Jf4wJTQBNiQB0CU0Wf4wQ15eQwHQQl4BYAAAAAQAAP/5A1kC5wAJABEAGgBFAGVAYjoBAgMuHAIGCQJHDAELBAEDAgsDYAUPAgIAAAJUDQoCAAkJAFQOAQkIAQYBCQZgAAEHBwFUAAEBB1gABwEHTAsKQ0JCQT48ODYzMjIwKikmIyAeGRcVFA4NChELETMREAUWKyURIxEUFhczMjYDMycmIgYeASU0JgYPATMyNhcVFAYrARUUBgchIiY9ASMiJj0BNDY7ASImNDY3Mh8BNzYzMh4BBiczMhYCBrMUEGsQFP9tRg8uIAIcAZgeLw9FbBYg0QoINSAW/aEWIDUICgoI9TNKSjM8IkhHIjw0SAJMMvUICl0BkP5wDg4BEAHkWhEeLh41FiABEVogebMHCukWHgEgFekKB7MICkhqRgIrXFwrSmZMAgoAAAAC////sQQvA1IADwAvADVAMgkBAgEAIAEDAgJHAAMCA3AABQAAAQUAXgABAgIBVAABAQJYBAECAQJMNSY2JiYUBgUaKwERNCYnISIGBxEUFjMhMjYTERQGByEUHgEXFAYjISImJzQ+ATUhIiY3ETQ2MyEyFgPoCgj8gwcKAQwGA30HDEY0Jf7REhABFA/+4g8UARIS/tAkNgE0JQN9JTQBKAHRBwoBDAb+LwcKCgHY/aElNAEULiIHDhYWDggiLBU2JAJfJTQ0AAT////5BC8CwwAPAB8AKgAyAFVAUhkRAgIDAUcAAQADAgEDXgACCAEABAIAYAkBBAAHBgQHYAoBBgUFBlQKAQYGBVgABQYFTCwrISABADAtKzIsMSckICohKh0cFRMJBgAPAQ4LBRQrNyImNRE0NjMhMhYXERQGIwERFBY3ITI2NRE0JichIgYBMxUUBgchIiY3NQUyNCsBIhQz6CU0NCUCXyU0ATYk/Y8MBgJfCAoKCP2hBwoC/1k0JfyDJDYBAkQJCVkJCYg0JQGJJTQ0Jf53JTQB4v53BwwBCggBiQcKAQz99DYWHgEgFTY2EhIAAAP////5AoQDCwAIABgAKABeQAwSEQoDAgEAAQMAAkdLsAxQWEAeAAMAAANkAAQAAQIEAWAAAgAAAlQAAgIAWAAAAgBMG0AdAAMAA3AABAABAgQBYAACAAACVAACAgBYAAACAExZtzU2JikSBQUZKyU0LgEOARY+ATcRNCYjISIGBxEUFjMhMjYTERQGIyEiJjcRNDY3ITIWAWUUIBICFhwY1AoH/i8HCgEMBgHRBwpINCX+LyQ2ATQlAdEkNkAPFAIYGhgEEGsCFwgKCgj96QgKCgIf/aElNDQlAl8lNAE2AAAAAAQAAP/5Aa0CwwAIABgAIQAxAEJAPxIKCQMDAgABAQACRwAHAAQFBwRgAAUAAgMFAmAAAwAAAQMAYAABBgYBVAABAQZYAAYBBkw1NDE0JiUTEggFHCslNCYiDgEeATY3ETQmIyEiBhURFBYzITI2AzQrASIUOwEyNxEUBiMhIiY1ETQ2MyEyFgEDGiYYAhwiHnIKCP7iBwoKBwEeBwxsCVkJCVkJoSwc/uIdKiodAR4dKkATGhomGAIcawGICAoKCP54CAoKAeEJEhL9xB0qKh0CPB0qKgAAAAEAAAAAANwBzAAIACBAHQIBAAEBAFQCAQAAAVgAAQABTAEABQQACAEIAwUUKxMyFhQGIiY0Nm4uQEBcQEABzEBaQkJaQAAAAAH//wAAAnEClwAIABhAFQIBAAEAbwABAWYBAAUEAAgBCAMFFCsBMhYQBiQmEjYBOYK2tv78uAK0Ape4/v64ArQBBrQAAgAAAAADjwKtAAoAFQAtQCoEAQADAG8HAQMCA28GAQIBAQJUBgECAgFYBQEBAgFMEhETERIRExAIBRwrEyERFAYnNTI2JyMBIREUBic1MjYnIxIBT8SLXIQB3wIuAU/Ei1yEAd8Crf6yjMQBb4JeAU7+sozEAW+CXgAAAAIAAAAAA48CrQAKABUAL0AsBwEDAgACAwBtBAEAAG4FAQECAgFUBQEBAQJYBgECAQJMEhETERIRExAIBRwrJSERNDY3FSIGFTMBIRE0NjcVIgYVMwOP/rHGiV2C3/3S/rHEi12C3xABT4vCAW+EW/6xAU+LwgFvhFsAAAAB/+D/YgLAA1YAMgAhQB4SAQABAUctJggGBAUARAABAAFvAAAAZhkYFxYCBRQrFwYnJjc2NyY3HgI2LgE3PgE3DgEWFzI2NzYWFxYGBw4BBwYXFjcOAgcGFjcOAwc8BhQSAgQuZDAKLCwSEAYcFnQuGBIKEAyQIi6IDgwYHCzMDBAcNno4oGgCBGowHkIqbh6KFAwIGmR+mqIgXEQInq5GLGQULmA8AvACBEIgGG4cLCQGChgwHFBECAYYPBA4OA4IBAAABAAA/28DQgNNAAsAFQAgACkAS0BIEQYCBUQHAQEGAQAEAQBgCQEECAECAwQCYAADBQUDVAADAwVYAAUDBUwiIRcWDQwBACYlISkiKRwbFiAXIAwVDRUACwELCgUUKwEiBwYUHwE3NhAnJicyFhIHCQEmEDYTIgYUFxYyNzY0JicyFhQOAS4BNgGggF1bW93fWlpdgq7yAnv+2f7be/aqNE4nJmwmJ042S2xslmoCbgLlWlj+WdvbWAEAV1po8P6seP7eASJ4AVTw/uJOaiclJSdqTjRqmGoCbpRuAAMAAAAAArwCWAALABcAIwBCQD8AAwcBAgADAmAGAQAAAQQAAWAIAQQFBQRUCAEEBAVYAAUEBUwZGA0MAQAfHBgjGSITEAwXDRYHBAALAQoJBRQrATIWFAYjISImNDYzNSImNDYzITIWFAYjETIWFAYjISImNDYzAooWHB4U/agUHhwWFB4cFgJYFhweFBYcHhT9qBQeHBYBkB4oHh4oHmQeKB4eKB7+1B4oHh4oHgAAAf/9AAACnwLAABMAFUASCQEARQEBAABmAQAAEwESAgUUKzMiLwEmPgEWHwEBPgEXHgEHAQYj+SIWtBAILDoSdgEoEDYaGAwO/qIUJBzsGDgkCBiaAdoYDA4QNhr90CAAAQAAAAAB1gJiAB0AHkAbHRYOBgQAAgFHAwECAAJvAQEAAGYUGhQTBAUYKyUWFAYiLwEHBiInJjQ/AScmNDc2Mh8BNzYyFhQPAQHEEiQyEoSEEjISEBCKihAQEjIShIQSMiQSisISMiIQmJgQEBIyEpyeEjISEBCYmBAiMhKeAAAB//H/ngLvAx4AKgAGsxgHAS0rNz4BNxYXNjceBBc+ASceBA4BBzYCJxYGBzYmLwEGBw4BFhcuAQcKUAQnBpQGCh5WPjwEDwgNDzQ8NAocdF5ATnMKKiwHBgkKDDAaGggah1zuKbQ4SEm49AYWRFBwPiRWJQw2YGaGeIY1gQEqUCvEND9OFBFGRiY+YjhMnAADAAD/agLBA1IAHwA5AGQAP0A8YF1bWFVKRUJAPTYyMC0rFRENCwUUA0UAAwIDbwACAQJvAAEAAAFUAAEBAFgAAAEATGRjT04kIh4cBAUUKzU0PgEmJxceAxc2NxceAQc3PgEnFhIHDgMHIiY3FBYXMj4DNzYnBgc0JicGBzQuAScWBwYXND8BFxYXPwEVFBc+Aj8BFxYHBiMiJyY3NicGDwEnJicPAScmJwYVFCIkHgQfFBNAQEIPPwIfHUABDxAiAWBOHQ4iTohlibA/inBKbDwmEAYnZz1UFA8XWhhAKwgpHzIpEBATLzEvFyc6HBYbBhUpBAkEAg4GGwg6YA8GGAQ6EAwrFRkgh0y2gtJ1Dg0+THY7XlwjJIxFFBVOJHf++HUzQkYeAqpzWIYBFh42IiCfuWdFXKgdOn8IVp46fbmPaZJ1Lyk4bEpLNUJFFCoeGR4gd2MKAgYNSV9CLwYQQi1UFRdiM1SFEAAACgAA/2kD6QNSACUAMwBBAFYAZAByAHoAjQCjAKgCTUuwClBYQCiAARcVkwEWCVABGBY8CgIUD187AhIUqG1rXgQAEi8uJyYjGgYEBQdHG0uwC1BYQCiAAQkVkwEWCVABChY8CgIUD187AhIUqG1rXgQAEi8uJyYjGgYEBQdHG0AogAEXFZMBFglQARgWPAoCFA9fOwISFKhta14EABIvLicmIxoGBAUHR1lZS7AKUFhAXgASFAAAEmUAFQAWGBUWYAAXABgKFxhgAAkACgEJCmAAAQAIBwEIYAAHAA0MBw1gAAwAEA8MEGAADwAUEg8UYBkTEQ4LBgIHAAAFBAAFYQAEAwMEVAAEBANYAAMEA0wbS7ALUFhAWAASFAAAEmUAFQAWChUWYBcBCRgBCgEJCmAAAQAIBwEIYAAHAA0MBw1gAAwAEA8MEGAADwAUEg8UYBkTEQ4LBgIHAAAFBAAFYQAEAwMEVAAEBANYAAMEA0wbS7AnUFhAXgASFAAAEmUAFQAWGBUWYAAXABgKFxhgAAkACgEJCmAAAQAIBwEIYAAHAA0MBw1gAAwAEA8MEGAADwAUEg8UYBkTEQ4LBgIHAAAFBAAFYQAEAwMEVAAEBANYAAMEA0wbQF8AEhQAFBIAbQAVABYYFRZgABcAGAoXGGAACQAKAQkKYAABAAgHAQhgAAcADQwHDWAADAAQDwwQYAAPABQSDxRgGRMRDgsGAgcAAAUEAAVhAAQDAwRUAAQEA1gAAwQDTFlZWUAupaSioJeVjYuDgnp5eHd2dXRzcW9paGZlY2FcWlhXVFJLSSUiETQ5OCsiIhoFHSs1NDY3Mz4BMzIWFzc2HgEGDwEWFzMyFgcUDwEVFAYnISImJzUnJjcXFRQzITI9ATc0IyEiNzM+ATMyFhc3LgEjIgY3Jjc2JyM1NDMyFxYHBhcVFCMiJzUTMz4BMzIWFzcuASMiBhczPgIWFzM3LgEHIgYXMzYyFzMmIhM1Jjc2JzU0MhcWBwYXFhUUIyIXNSY3Nic1NDMyFxYHBhcVFhUUIyInEzM0JjUuIFQWvn5mqCqPDBgKBg2WBAJUIS4BEG0sIv2uISwBbRA/fQ8CUg99D/y0D4IiFZhkVIoiGyWYXm+uIRAgGQwCEAoEER8ZDQ8KBAghFHJLQmwZHiB6S1aGLCESTl5OEgUYFlw6PV4wJR1SGycljCcQHRwOGgMSHxoMAhAJmhAgGQ4QCgQRHxoMAg8KBJ4SAnQhLAF5oG5ZRgYIGBYHTAsKLiAYEXsYIS4BLCIYexEYjS8QEC+NDz9ffFxKD1JkkLknSj0dBg8JKUk+HQQQCAL+3URYSDsOQlJoUysyAjYpCzNAAUY3Hx8+AW8CJ0s8HgUQCilIPx0CAg9/AidIPhwGDwkoSjweAgIBEAr+2QIEAgAAAAAFAAD/TwPFA1IAFQAvADYAQwBTACBAHVNMS0M+PTYxLwoCAQwARSMiCwMARAAAAGYYAQUVKxM3EwcGFxYXFhc3EwcGJyYnJicmNzYXBwYHBhcWFxYXFj8BJwcGJyYnJicmNzY/AR8BNiYnJic3HgIXFgcnNi4CJzcWFx4BFxYHJzYnLgEnJieWdqlyChkYJSYXcKt3XnBmXVoyMwwOrCs/AgEvLUlLTlVBKV8qJi8sKSgXGAQEJiroegcFDBkyJzFRNAUFD0sLCCQ5Iz5MPT9OCAcWTRIGBj8yMT0DGzf+tzgZQj42OQE3/rY7KkE8g3+SmHN/BRUhZl1+eWxwNjweFLcVEx4bOzlARDM4FRWIJBgyFi4Qgw9CXTUzMhYjSUIuC88WMTOPUU5MFz0+QXMpJxIAAAMAAP+cA9YDFQAhACoARABAQD1DQT89PDs6OTg3NTMxLy4tLBESAUQDAQACAG8AAgEBAlQAAgIBWAQBAQIBTCMiAQAnJiIqIyoAIQEhBQUUKwEiBgcGFRQXFhcWFxYXFhcWFzY3Njc2NzY3Njc2NTQnLgEDIiY0NjIWFAYBJQcnBRM3FhcPAT8BBxc3FzcnHwEvATY3FwH0OGMdHwwKFAweIhEcExYLCxYTHBEiHgwUCgwfHWM4IS4uQi8vAcH+89Xg/v6hnxsPjUVrPBmoFBOmGD9tRZARGaIDFTcvMDclIRsdEiMoGCkqNT4+NSopGCgjEh0bISU3MC83/u0vQi4uQi/9mmFhYWEBaUAmIDicKGx6SFFRTHp0KKA4IiRAAAH//wAAAjsByQAOABFADgABAAFvAAAAZhUyAgUWKyUUBichIi4BPwE2Mh8BFgI7FA/+DA8UAgz6Ch4K+gqrDhYBFB4L+goK+gsAAAABAAAAAAFnAnwADQAXQBQAAQABAUcAAQABbwAAAGYXEwIFFisBERQGIi8BJjQ/ATYyFgFlFCAJ+goK+gscGAJY/gwOFgv6CxwL+gsWAAAAAAEAAAAAAUECfQAOAAq3AAAAZhQBBRUrARQPAQYiJjURND4BHwEWAUEK+gscFhYcC/oKAV4OC/oLFg4B9A8UAgz6CgAADwAA/2oDoQNSAAMABwALAA8AEwAXABsAHwAjADMANwA7AD8ATwBzAJ5Am0ElAh0SSS0kAxMdAkcgAR4aARIdHhJgIR8CHRMJHVQbARMZFw0DCQgTCV8YFgwDCBURBwMFBAgFXhQQBgMEDwsDAwEABAFeDgoCAwAcHABSDgoCAwAAHFgAHAAcTHJwbWpnZmNgXVtWU01MRUQ/Pj08Ozo5ODc2NTQxLyknIyIhIB8eHRwbGhkYFxYVFBMSEREREREREREQIgUdKxczNSMXMzUjJzM1IxczNSMnMzUjATM1IyczNSMBMzUjJzM1IwM1NCYnIyIGBxUUFjczMjYBMzUjJzM1IxczNSM3NTQmJyMiBhcVFBY3MzI2NxEUBiMhIiY1ETQ2OwE1NDY7ATIWHQEzNTQ2OwEyFgcVMzIWR6GhxbKyxaGhxbKyxaGhAZuzs9aysgGsoaHWs7PEDAYkBwoBDAYkBwoBm6Gh1rOz1qGhEgoIIwcMAQoIIwgK1ywc/O4dKiodSDQlJCU01jYkIyU2AUcdKk+hoaEksrKyJKH9xKH6of3EoSSyATChBwoBDAahBwwBCv4msiShoaFroQcKAQwGoQcMAQos/TUdKiodAssdKjYlNDQlNjYlNDQlNioABf///7EELwMLAA8AGQAjACcAKwBqQGcWEwICAyAdAgUHAkcKAQALAQMCAANgAAIABAYCBF4IAQYOCQ0DBwUGB14MAQUBAQVUDAEFBQFYAAEFAUwoKCQkGhoQEAEAKCsoKyopJCckJyYlGiMaIh8eEBkQGBUUCQYADwEODwUUKwEyFhURFAYHISImNxE0NjcVIgYHFSE1NCYjETI2JxEhERQWPwE1MxUzNTMVA9YlNDQl/IMkNgE0JQcKAQOhCggHDAH8XwwGNo9H1gMLNiT9WiU0ATYkAqYlNAFICgh9fQgK/TYKCAFT/q0HDAFHSEhISAAAAAIAAAAAAjoBzAAIABEALUAqBQIEAwABAQBUBQIEAwAAAVgDAQEAAUwKCQEADg0JEQoRBQQACAEIBgUUKxMyFhQGIiY0NiEyFhQGIiY0Nm4uQEBcQEABjC5AQlpAQAHMQFpCQFxAQFpCQFxAAAMAAAAAA5gBzAAIABEAGgA6QDcIBAcCBgUAAQEAVAgEBwIGBQAAAVgFAwIBAAFMExIKCQEAFxYSGhMaDg0JEQoRBQQACAEICQUUKxMyFhQGIiY0NiEyFhQGIiY0NiEyFhQGIiY0Nm4uQEBcQEABjC5AQlhCQAGMLkBAXEBAAcxAWkJCWkBAWkJCWkBAWkJCWkAAAAACAAD/uQNSAwMAFwAwADBALSokGwMCAw8GAgABAkcABAMEbwADAgNvAAIBAm8AAQABbwAAAGYUFTk6GAUFGSsBFRQGJi8BBwYiLwEmND8BJyY0NjsBMhYBFA8BFxYUBisBIiY3NTQ2Fh8BNzYyHwEWAa0WHAtRuQUQBEAGBrlQCxYO+g4WAaUGuVALFg76DhYBFB4KUbkGDgY/BgE6+g4WAglRugUFQAYOBrlQCxwWFgFpBwW6UAscFhYO+g4WAglQuQUFQAUAAAEAAP9qAYoDUgAgACFAHgAFAAVvBAEAAQBvAwEBAgFvAAICZhUhJRUhEwYFGisBFAYnIxEzMh4BDwEGIi8BJjQ2OwERIyImNj8BNjIfARYBiRYOR0cPFAIMjwoeCo8KFA9ISA4WAgmPCxwLjwsCnw4WAf3EFB4KjwsLjwoeFAI8FB4LjgsLjgsAAAAAAQAAAAAD6AIRACAAKEAlBQEDBANvAgEAAQBwAAQBAQRSAAQEAVYAAQQBShMTFxMTFAYFGisBFA8BBiImPQEhFRQGIi8BJjQ/ATYyFh0BITU0NjIfARYD6AuOCx4U/cQUHgqPCwuPCh4UAjwUHguOCwFeDguPCxYOSEgOFguPCxwLjwsWDkhIDhYLjwoAAAAAAwAA/2oDrANQAA8AIAAwABRAEQEBAAIAbwACAmYrKh8WAwUWKxMeAhUUBiImNTQ+ATc2MgUeAhUUBiImNTQ+Ajc2MgE2MhUeAhUUBiImNTQ+AagKUEJghGBCUAoCCgJoClBCYIRgKjY0CAIK/sACCgpQQmCEYEJQA0xWimw6Ql5eQjpsilYEBFaKbDpCXl5CMFpCdkQE/kAEBFaKbDpCXl5COmyKAAAAAgAA/34CMAM+ABEAIwAkQCEAAQIBbwACAwJvAAMAAANUAAMDAFgAAAMATCgUGBcEBRgrAR4DFRQGIiY1ND4CNzYyAzYnJiIPAQ4CFRQWMzI1NDcBIg5cXEim5KZIXFwOAhIqAgQGEAQoICAkIhg6KgM2dsp0nFJypKRyUpx0ynYI/nAECgYGOi4wZjIYIkRemAAAAAP/7//sA5sC3AAZADYAVQA2QDMAAwECAQMCbQACBQECBWsABQQBBQRrAAQEbgAAAQEAVAAAAAFYAAEAAUwdLx0sJxoGBRorEwYuATY3PgIeAjY3NhcWBwYjIicuAQ4BBTYWBw4CIyInLgEOAQcGJicmPgMWFx4BPgEXNhcWBgcOAiMiJy4BDgEHBiYnJj4DFhceAT4BVRAoHAQQMD50jrCGQjgmICAmenBkekRmVC4CtCZAJigyXjJgfkRmVC4sDioOIEwsXlKARkRmVC4sJiAOBBAoMl4yYH5EZlQwKg4qDiBMLF5SgEZEZlQuAhYOBB4sDigoKCBkBiYwHiQoIG5GJhwcHpIgTiAiJiZGJhwcHiQOBBAoQiAsAiAoJhwcHtwgJg4sDiImJkYmHBogJA4EEChCICwCICgmHBweAAAAAgAA/5wD6AMgABsAKgA5QDYGAQAFAG8AAQIBcAADBAIDVAAFAAQCBQRgAAMDAlgAAgMCTAEAKCYlIxgWCwkHBAAbARoHBRQrATIVERQrASI1ESMiJyYvASY0PwE2NzY7ATU0MwUWFA8BBiMGIyEnITIWFwGqFBQuFLAQDAwOeAoKeA4MCBSwFAJiCgp2FgQODv7SKAFWEhQQAyAU/KQUFAG4BgIKUgYUBlIKAgS+FNAGFAZSDAbmCAgAAAACAAD/zgH0Au4ADgAXADBALQYBAUQEAQECAXADAQACAgBUAwEAAAJYAAIAAkwQDwEAFBMPFxAXAA4BDgUFFCsTMhYUAg8BLgQ1NDYTMjY0JiIGFBb6aJJ8QD4KIlZCNpJoOFBQcE5OAu6S0v7uVlQMLoSApkJokv58UHBOTnBQAAUAAP/KA+gC9AAbAB8AIwAnACsAIUAeKyopKCcmJSQjIiEgHx4dHBgNCRMARQAAAGYWAQUVKwEWFREUBwYiLwEHBi8BBwYmNRE0PwE2HwE3NhcBEQcRIREnESERBxEhEScRA9gQEAgQCtjYEhDa2BAiEOoSENjaEBD9/KgBkqgBkqoBkqgCWAoU/bgUCgYGiIgKCoiIChQUAkgUCpIKCoiICgr9rAH6aP4GAfpo/gYB+mj+BgH6aP4GAAAAAgAA/7ADXgMOABMAFgAItRYUEgoCLSsBHgEOAgcGAg8BAyUkNz4DFgcBFwNQCAYKChwKNrpAQjb+hAG6/hQ4FhwSVP7QHAMACBAcGDYWcP6kdnYBfDj2egoeCggGaP7o6gAAAAT//P98A8IDQAALABQAIwAsAEJAPyscAgQDAUcABAMCAwQCbQUBAAADBAADYAYBAgEBAlQGAQICAVgAAQIBTA0MAQAoJxEQDBQNFAcFAAsBCwcFFCsBNgAXFgAHBgAnJgATPgECJgQGEhYnPgQ/AQ4CBw4BBxMGFBYyNzY3BgHaxgEcBAL+7MjG/uICBAEW1JzcBOL+xtoE4EwEEEJYojw8BBBCLCqkPHgWKjoUNCSIAz4C/uzGyP7kBAIBFsbIARz8qALgATzaBOD+xNqcGlCwWEAKChpQsCwqQAoBCBQ4LBY0hiQAAAAD//3/sQNZAwsADAG9AfcCd0uwCVBYQTwAvQC7ALgAnwCWAIgABgADAAAAjwABAAIAAwDaANMAbQBZAFEAQgA+ADMAIAAZAAoABwACAZ4BmAGWAYwBiwF6AXUBZQFjAQMA4QDgAAwABgAHAVMBTQEoAAMACAAGAfQB2wHRAcsBwAG+ATgBMwAIAAEACAAGAEcbS7AKUFhBQwC7ALgAnwCIAAQABQAAAL0AAQADAAUAjwABAAIAAwDaANMAbQBZAFEAQgA+ADMAIAAZAAoABwACAZ4BmAGWAYwBiwF6AXUBZQFjAQMA4QDgAAwABgAHAVMBTQEoAAMACAAGAfQB2wHRAcsBwAG+ATgBMwAIAAEACAAHAEcAlgABAAUAAQBGG0E8AL0AuwC4AJ8AlgCIAAYAAwAAAI8AAQACAAMA2gDTAG0AWQBRAEIAPgAzACAAGQAKAAcAAgGeAZgBlgGMAYsBegF1AWUBYwEDAOEA4AAMAAYABwFTAU0BKAADAAgABgH0AdsB0QHLAcABvgE4ATMACAABAAgABgBHWVlLsAlQWEA1AAIDBwMCB20ABwYDBwZrAAYIAwYIawAIAQMIAWsAAQFuCQEAAwMAVAkBAAADWAUEAgMAA0wbS7AKUFhAOgQBAwUCBQNlAAIHBQIHawAHBgUHBmsABggFBghrAAgBBQgBawABAW4JAQAFBQBUCQEAAAVWAAUABUobQDUAAgMHAwIHbQAHBgMHBmsABggDBghrAAgBAwgBawABAW4JAQADAwBUCQEAAANYBQQCAwADTFlZQRkAAQAAAdgB1gG5AbcBVwFWAMcAxQC1ALQAsQCuAHkAdgAHAAYAAAAMAAEADAAKAAUAFCsBMh4BFA4BIi4CPgEBDgEHMj4BNT4BNzYXJjY/ATY/AQYmNRQHNCYGNS4ELwEmNC8BBwYUKgEUIgYiBzYnJiM2JiczLgInLgEHBhQfARYGHgEHBg8BBhYXFhQGIg8BBiYnJicmByYnJgcyJgc+ASM2PwE2JxY/ATY3NjIWMxY0JzInJicmBwYXIg8BBi8BJiciBzYmIzYnJiIPAQYeATIXFgciBiIGFgcuAScWJyMiBiInJjc0FycGBzI2PwE2FzcXJgcGBxYHJy4BJyIHBgceAhQ3FgcyFxYXFgcnJgYWMyIPAQYfAQYWNwYfAx4CFwYWByIGNR4CFBY3NicuAjUzMh8BBh4CMx4BBzIeBB8DFjI/ATYWFxY3Ih8BHgEVHgEXNjUGFjM2NQYvASY0JjYXMjYuAicGJicUBhUjNjQ/ATYvASYHIgcOAyYnLgE0PwE2JzY/ATY7ATI0NiYjFjYXFjcnJjcWNx4CHwEWNjcWFx4BPgEmNSc1LgE2NzQ2PwE2JzI3JyYiNzYnPgEzFjYnPgE3FjYmPgEVNzYjFjc2JzYmJzMyNTYnJgM2NyYiLwE2Ji8BJi8BJg8BIg8BFSYnIi4BDgEPASY2JgYPAQY2BhUOARUuATceARcWBwYHBhcUBhYBrXTGcnLG6MhuBnq8ARMCCAMBAgQDERUTCgEMAggGAwEHBgQECgUGBAEIAQIBAwMEBAQEBgEGAggJBQQGAgQDAQgMAQUcBAMCAgEIAQ4BAgcJAwQEAQQCAwEHCgIEBQ0DAxQOEwQIBgECAQIFCQIBEwkGBAIFBgoDCAQHBQIDBgkEBgEFCQQFAwMCBQQBDgcLDwQQAwMBCAQIAQgDAQgEAwICAwQCBBIFAwwMAQMDAgwZGwMGBQUTBQMLBA0LAQQCBgQIBAkEUTIEBQIGBQMBGAoBAgcFBAMEBAQBAgEBAQIKBwcSBAcJBAMIBAIOAQECAg4CBAICDwgDBAMCAwUBBAoKAQQIBAUMBwIDCAMJBxYGBgUICBAEFAoBAgQCBgMOAwQBCgUIEQoCAgICAQUCBAEKAgMMAwIIAQIIAwEDAgcLBAECAggUAwgKAQIBBAIDBQIBAwIBAwEEGAMJAwEBAQMNAg4EAgMBBAMFAgYIBAICAQgEBAcIBQcMBAQCAgIGAQUEAwIDBQwEAhIBBAICBQ4JAgIKCAUJAgYGBwUJDAppc1ABDAENAQQDFQEDBQIDAgIBBQwIAwYGBgYBAQQIBAoBBwYCCgIEAQwBAQICBAsPAQIJCgEDC3TE6sR0dMTqxHT+3QEIAgYGAQQIAwULAQwBAwICDAEKBwIDBAIEAQIGDAUGAwMCBAEBAwMEAgQBAwMCAggEAgYEAQMEAQQEBgcDCAcKBwQFBgUMAwECBAIBAwwJDgMEBQcIBQMRAgMOCAUMAwEDCQkGBAMGAQ4ECgQBAgUCAgYKBAcHBwEJBQgHCAMCBwMCBAIGAgQFCgMDDgIFAgIFBAcCAQoIDwIDAwcDAg4DAgMEBgQGBAQBAS1PBAEIBAMEBg8KAgYEBQQFDgkUCwIBBhoCARcFBAYDBRQDAxAFAgEECAUIBAELGA0FDAICBAQMCA4EDgEKCxQHCAEFAw0CAQIBEgMKBAQJBQYCAwoDAgMFDAIQCBIDAwQEBgIECgcOAQUCBAEEAgIQBQ8FAgUDAgsCCAQEAgIEGA4JDgUJAQQGAQIDAgEEAwYHBgUCDwoBBAECAwECAwgFFwQCCAgDBQ4CCgoFAQIDBAsJBQICAgIGAgoGCgQEBAMBBAoEBgEHAgEHBgUEAgMBBQQC/g0VVQICBQQGAg8BAQIBAgEBAwIKAwYCAgUGBwMOBgIBBQQCCAECCAICAgIFHAgRCQ4JDAIEEAcABQAA/4gDrAM0AEMATABVAF4AZwByQG88MwIFChoPAgEFKyIZEAkABggBA0cACgsFCwoFbQ8MAggBCQEICW0ABgALCgYLYAcBBQMBAQgFAWAQDg0DCQAACVQQDg0DCQkAWAQCAgAJAExgX2RjX2dgZ11cWVhUU1BPS0oVNhY3GDYWNhQRBR0rJRYVFAYiJjU0NzU0KwEiJxUWFRQGIiY1NDc1BisBIg4BHQEWFRQGIiY1NDc1NDY7ATI9ASY1NDYyFhUUBxUUOwEyFhUFNCYiBhQWMjYTFBYyNjQmIgYTNCYiBhQWMjYFMjY0JiIGFBYDZEhGZEZITGQsIkhGZEZIHi5kIiYGSEZkRkhWWGRMSEZkRkhOZFZW/VoqOCgoOCrUKDgqKjgoiio4KCg4KgEYHCoqOCgocCJOMkZGMk4ick4MzCJOMkZGMk4izAwmHAxyIk4yRkYyTiJyQGw0jCJMMkZGMkwijDRsQOIeKCg6KCgC2BwoKDooKP0mHigoOigoKCg6KCg6KAAC//r/cAMaA1YAGQAtABBADRIBAEQAAABmKyoBBRQrARYGBwYnDwIGDwEGJi8BJjcBJicmNjc2Fgc2LgEGBw4BHwEeAR8BHgIyPgEDBhRgZkJAdkZoDiBMDBQCEAgUAQIYDhKOcmqybB4SVGQeCAgDBQIWB0MQDhgOFBACZHTGEgwKwgymHAQOBBAOYh4aAYIyRmqiFBSCvCxqPhQsDBYJEAcUBTEMCBACDgAABwAA/1QDQgNoABIAGwAuADcAWQBiAGsAg0CAVCwnHAQJBSoOAgcJQxALAAQCBwNHCwEFBAkEBQltDQECBwEHAgFtCAEDEAoPAwQFAwRgAAkABwIJB2ARDA4DAQAAAVQRDA4DAQEAWAYBAAEATGRjW1owLxQTaGdja2RrX15aYltiWFZPTkdFPj00My83MDciIRgXExsUGxUSBRUrNx4BFxQOASYnNDY3NTQ3FhcGFQcyPgEmIgYeAQEuASc0NjIWFxQGBxUUByYnNjU3Ig4BFjI2LgETHgEVFA4BJjc0NjcuASciJicuATU0NjIWBxQGBx4BNzIWASIGHgEyPgEmATI2NCYiBhQW0S06AVyCWgE6LkwxLkI1Fh4CIigiBBoB7S06AVyCWgE8LU8sM0Y1Fh4CIiggAhwaMDxcgF4BOCwNdkp1sA8wPFyAXgE4LA10Snaw/dYVIAIcLhwEJAH3FR4eKiAghRBSMkFaAl4/MlIQI2FFKBQnQ+oeKiAgKh4CehBSMUFcXEEyUBESaUslFCtQ2R4sHh4sHv2GD1IzQVoCXj8xUBJHXgGadA9QNEFcXEEwUBJHYAGcAggeLB4eLB78vx4qICAqHgAAAAMAAP+cAu4DIAAlACkAQwBlQGIRAQgCAUchAQUBRgAEBQcFBAdtAAcGBQcGawAGCQUGCWsAAQMBcAoBAAAFBAAFXgAJAAIICQJgAAgDAwhSAAgIA1gAAwgDTAEAQ0E6OCsqKSgnJiAfFRQODAkGACUBJAsFFCsTIgYVERQWMyEyNj0BMzIXFh8BFRQyNRE0Jy4BJyY9ASMnNTQmIwUhFSElMxUUFx4BFxYdARQHBg8BJyYnJj0BNCYrATIVHR8TAcITHxkLBwQCAZYQCTIJEDIyHRX+cAFe/qIBwjIQCTIJEAYFCAYGCAUGHxMyAyAdFfzgEx8fE/oGBQgGZEtLARMRFQwyDRQRljIyFR1kyDJLERQNMgwVEfoLBwQCAQECBAcLfRMfAAAAAwAAAAADUgKjAAgAHwA1AJNLsAlQWEAyCgEEAAECBGUIAQYHBwZkCQEAAAECAAFgAAIAAwUCA2ELAQUHBwVUCwEFBQdWAAcFB0obQDIKAQQAAQAEAW0IAQYHBnAJAQAAAQIAAWAAAgADBQIDYQsBBQcHBVQLAQUFB1YABwUHSllAISEgCQkBAC8uKyonJiA1ITQJHwkeFhQPDAUEAAgBCAwFFCsTIgYUFjI2NCYXFA4BKwEiBwYdARQzITU0JyYnJicmIwEiBh0BFBYyNj0BIRUUFjI2PQE0JiNkKTs7Ujs7bShFKUsNBAgZAzkEBxQaMDlY/doTHx8mHwKKHyYfHxMCoztSOztSO2QpRSgDBREyGWQcERwVGg4Q/tQfE5YTHx8TZGQTHx8TlhMfAAAAAAX//f9qA1IDUgAMABUAHgA4AE4AgEB9EAEAAgBvFAwTAwsDDgMLDm0ADgYDDgZrCggCBgcDBgdrDw0JAwcBAwcBawABAW4SBBEDAgMDAlQSBBEDAgIDWAUBAwIDTDo5Hx8XFg4NAQBIR0RDQD85TjpNHzgfODUzMC8sKygnJCIbGhYeFx4SEQ0VDhUHBgAMAQwVBRQrASIGFREUFjI2NRE0JgUiBhQWMjY0JiEiBhQWMjY0JgUDBhY7ARUUFjI2PQEzFRQWMjY9ATMyNicDISIGFREUFjI2NREzERQWMjY1ETQmIwHbCg8PFQ4O/uIpOztSOzsB5Ck7O1I7O/1/fAQSC0oPFQ5kDxUOSwsSBH0BdxUdDxUOlg8VDh0VA1IOC/xKCg8PCgO2Cw4yO1I7O1I7O1I7O1I7+v6JCRDhCg8PCuHhCg8PCuEQCQF3HRX9wQoPDwoBE/7tCg8PCgI/FR0AAAAAAgAA/3ID4ANSABAAGQAXQBQKCQcGBABFEAEARAAAAGYUEwEFFCs1ASY+AhcHHwE3Fg4CJwEnFBY+ATQuAQYBzxkecphHoi1zpBkgcpZJ/jEvHCYcHCYcFQHPRJpyHhmidS2kRppwIBj+MaEUHAIYLBYGIgAGAAD/tgPoAwYAJwAwAFgAgACLAJYAuEC1RQ8OBwYFBQBWVVNRTEpJERAFBAsDBWhlZGNfXlRQT0sVFAEADgIDaWddJRgFCAKBbSQiGxkGBwZ+fXt5dHEjGggBBwZHYAECagEIAkZCQUA/PTw7ODc2NQsJRXx4d3NyBQFEAAkACW8ABQADAAUDbQAIAgYCCAZtAAYHAgYHawAHAQIHAWsEAQAAAwIAA2AAAggBAlQAAgIBVgABAgFKlZOKiG9uW1pHRjMyLy4rKh8eGgoFFSs9ATc2Nyc3FzY/ATMXFhc3FwcWHwEVBwYHFwcnBg8BIycmJwcnNyYnNxQWPgIuAQYlNxc2Nyc3FzY/ARcHFhc3FwcWHwEHIwYHFwcnBg8BJzUmJwcnNyYnAzczNjcnNxc2PwEXFRYXNxcHFh8BByMGBxcHJwYPASc1JicHJzcmJzcGHgE+ASYnIyIGEwYeAT4BJicjIgZeCA88REoaHQhhCh0aSkQ8EAdeXgcQPERKGh0KYQgdGkpEPA8IfzRMMgI2SDgBQAhGCAwlNjEUFQ5IAhYROS0xCgJECEQIDic4LxYVDkYUETstMQgEJQYxBggaJSQNEAowEAwpHyMGBC8GMQQKHCgjDRAKMQ0OKR8jBgJFBBgoHAYaEgYRHBIEJDYqBCAcBxok9WEIHhlKRT0QB15eBxA9RUoZHghhCh0aSEY8DwheXggPPEZIGh07JTYCMk4wBDjLSAIWETktMQoEQghECA4nNjEUFw5GFBE7LTEIBEIGRggMJTYxFBX+UTIQDCshJQgCMAUxBgobKSMNEAwzDwwrISUIAjEGMwQKHCkkDRAZFR4EFi4YBhgBsBsqCCY0LAIiAAAFAAAAAAPqArEAEwAcACUAKgAzAEZAQyspKCcdFAYBBAFHAAUCBAIFBG0HAQQBAgQBawgGAwMBAW4AAAICAFQAAAACWAACAAJMJiYuLSYqJioYFBQUFBIJBRorNTQABAAHFAcjNjU0JgQGFRQXIyYTNDYeAg4BJjc0PgEeAQYuARM1NxcVEzQ2HgIOASYBJgGcASgCH4kr2v7G2iuJH/omMiQCKC4qviQ0JAIoMCgPMTFMJjIkAiguKrzPASYC/t7RXFRSXpreAtqcXlJUARAZJgIiNiIEKlMaJAIoMCgEIP58Mfb2MQFkGSYCIjYiBCoAAAAAAgAA/2oD6ANSAAsADwA6QDcCAQABAG8IBQIDBANwAAEABwYBB14ABgQEBlIABgYEVgAEBgRKAAAPDg0MAAsACxERERERCQUZKxUTMwczJzMTIQMjAxMzAyPJ+ghyCPrJ/l4KkAoMjAt2lgPo5ub8GAEf/uEBdQFUAAAAAAEAAAAAAa0CsQATAB1AGgoBAAEBRwACAQJvAAEAAW8AAABmEhYmAwUXKwERFAYmLwEjIiYnNTQ2NzM3NjIWAa0WHAu6kg8UARYOkroKHhQCjv2gDhYCCboWDtYPFAG6ChQAAAACAAAAAAKDArEAEwAuACpAJycKAgMEAUcAAgECbwABBAFvAAQDBG8AAwADbwAAAGYvFxIWJgUFGSsBERQGJi8BIyImJzU0NjczNzYyFhMUBgcGIyImNzQ+Ay4ENzQ2FzIXHgEBrRYcC7qSDxQBFg6SugoeFNcwJwUJDhYBDBYQEAQIGA4UBBQPCQUnMAKO/aAOFgIJuhYO1g8UAboKFP7BKkoPAxQQDBAMDB4gIAgSCBAPFgEDD0oABAAA/9EDoQLrABMALgBLAGwASkBHJwoCAwQ3AQUAVAEHBQNHaAECRQACBgJvAAYBBm8AAQQBbwAEAwRvAAMAA28AAAUAbwAFBwVvAAcHZlJQR0YoLxcSFiYIBRorAREUBiYvASMiJic1NDY3Mzc2MhYTFAYHBiMiJjc0PgMuBDc0NhcyFx4BFxQGBwYjIiY3NDc2Nz4BNCYnJicmNTQ2MzIXHgEXFAYHBiMiJic0PwE2Nz4BLgEnJicuAScmNTQ2NzIXHgEBrRYcC7qSDxQBFg6SugoeFNcwJwUJDhYBDBYQEAQIGA4UBBQPCQUnMI9gTQcHDxYBFSALKS4uKQsgFRQPCAdOXpCOdgcHDxQBFhkZFUROAkpGFRkEEgMWFg4HB3aOAo79oA4WAgm6Fg7WDxQBugoU/sEqSg8DFBAMEAwMHiAgCBIIEA8WAQMPSipVkiADFg4WCxAJHlpoWh4JEAsWDhYDIZBWgNgyAxYOFA0MDg4zmKqYMw8NAwYDDRQPFAEDM9YAAAABAAD/qgMRAxMACwAGswcCAS0rCQEGJjURNDYXARYUAwT9Gw0SEg0C5Q0BTf5kBwoPAzYODAj+ZAcUAAACAAD/sQNaAwsADwAfAB5AGxgQCAAEAAEBRwMBAQABbwIBAABmNTU1MwQFGCsBERQGIyEiJicRNDYzITIWBREUBiMhIiYnETQ2MyEyFgNZFBD+4w8UARYOAR0PFv4LFBD+4w8UARYOAR0PFgLn/O4OFhYOAxIOFhYO/O4OFhYOAxIOFhYAAAAAAQAA/7EDWgMLAA8AGEAVCAACAAEBRwABAAFvAAAAZjUzAgUWKwERFAYjISImJxE0NjMhMhYDWRQQ/O8PFAEWDgMRDxYC5/zuDhYWDgMSDhYWAAAABAAA//kD6AMLAA8AHwAvAD8ASkBHMAEGBygBBAUYEAICAwgAAgABBEcABwAGBQcGYAAFAAQDBQRgAAMAAgEDAmAAAQAAAVQAAQEAWAAAAQBMNTUmNSYmJiQIBRwrJRUUBgchIiYnNTQ2NyEyFicVFAYHISImJzU0NjchMhY3FRQGIyEiJic1NDYXITIWJxUUBichIiYnNTQ2MyEyFgPoFg78YA8UARYOA6APFNUWDv02DxQBFg4Cyg8UkBYO/KcPFAEWDgNZDhbXFA/9fQ8UARYOAoMOFmRHDxQBFg5HDxQBFshHDxQBFg5HDxQBFslIDhYWDkgOFgEUx0gOFgEUD0gOFhYAAAAABAAA//kD6AMLAA8AHwAvAD8ARUBCMAEGBxABAgMIAAIAAQNHAAcABgUHBmAABQAEAwUEYAADAAIBAwJgAAEAAAFUAAEBAFgAAAEATDU1JjUmJiYkCAUcKyUVFAYHISImJzU0NjchMhYnFRQGByEiJj0BNDY3ITIWNxUUBiMhIiY9ATQ2FyEyFicVFAYnISImNzU0NjMhMhYD6BYO/GAPFAEWDgOgDxTVFg7+DA4WFg4B9A8UkBYO/O4OFhYOAxIOFtcUD/6aDhYBFA8BZg4WZEcPFAEWDkcPFAEWyEcPFAEWDkcPFAEWyUgOFhYOSA4WARTHSA4WARQPSA4WFgAAAAQAAP/5A+gDCwAPAB8ALwA/AEVAQjABBgcQAQIDCAACAAEDRwAHAAYFBwZgAAUABAMFBGAAAwACAQMCYAABAAABVAABAQBYAAABAEw1JiY1JiYmJAgFHCslFRQGByEiJic1NDY3ITIWNxUUBgchIiY9ATQ2NyEyFjcVFAYjISImPQE0NhchMhY3FRQGJyEiJjc1NDYzITIWA+gWDvxgDxQBFg4DoA8UARYO/TYOFhYOAsoPFAEWDvynDhYWDgNZDxQBFg79fQ4WARQPAoMPFGRHDxQBFg5HDxQBFshHDxQBFg5HDxQBFslIDhYWDkgOFgEUx0gOFgEUD0gOFhYAAAAEAAD/+QPoAwsADwAfAC8APwBKQEcwAQYHKAEEBRgQAgIDCAACAAEERwAHAAYFBwZgAAUABAMFBGAAAwACAQMCYAABAAABVAABAQBYAAABAEw1JiY1JiYmJAgFHCslFRQGByEiJic1NDY3ITIWNxUUBgchIiYnNTQ2NyEyFjcVFAYjISImJzU0NhchMhY3FRQGJyEiJic1NDYzITIWA+gWDvxgDxQBFg4DoA8UARYO/GAPFAEWDgOgDxQBFg78YA8UARYOA6APFAEWDvxgDxQBFg4DoA8UZEcPFAEWDkcPFAEWyEcPFAEWDkcPFAEWyUgOFhYOSA4WARTHSA4WARQPSA4WFgAAAAAI////+APpAwsADwAfAC8APwBPAF8AbwB/AHZAc3l4cUlIQQYICWlhYCkhIAYEBVlYUVAZGBEQCAIDOTgxCQgBBgABBEcPAQkOAQgFCQhgDQEFDAEEAwUEXgsBAwoBAgEDAl4HAQEAAAFUBwEBAQBWBgEAAQBKfXt1c21rZWRdW1VUTUwmJhcmFxcXFxQQBR0rNxUUBicjIiY3NTQ2NzMyFicVFAYnIyImNzU0NhczMhYnFRQGByMiJjc1NDY7ATIWARUUBichIiYnNTQ2NyEyFgEVFAYrASImNzU0NjczMhYBFRQGJyEiJic1NDYXITIWJxUUBgchIiYnNTQ2MyEyFicVFAYjISImJzU0NjchMhaPCghrBwwBCghrBwwBCghrBwwBCghrBwwBCghrBwwBCghrBwwDWAoI/RIHCgEMBgLuBwz8pgoIawcMAQoIawcMA1gKCP0SBwoBDAYC7gcMAQoI/RIHCgEMBgLuBwwBCgj9EgcKAQwGAu4HDHZrBwwBCghrBwoBDNBrBwwBCghrBwwBCs5rBwoBDAZrCAoK/kxrBwwBCghrBwoBDAJ9awgKCghrBwoBDP5NawcMAQoIawcMAQrOawcKAQwGawgKCs9rCAoKCGsHCgEMAAH//f+OAa8DUgAWAB9AHAwBAQIBRwACAQJvAwEBAAFvAAAAZiQjJBQEBRgrJRYPAQYiLwEmNjsBETQ2OwEyFhURMzIBqwQHwwYPBcYICgt9CghrCAp9C30KCdcFBdcJFQK4CAoKCP1IAAAAAAEAAAAAA+gCNwAVAB5AGwEBAAEBRwABAAABUgABAQBYAAABAEwdIwIFFisBFRQGIyEVFAYvASY0PwE2Fh0BITIWA+gKCP1IFgjXBQXXCRUCuAgKAZRsBwp9DAoIxAUPBsUICQx9CgAAAQAAAAADxAI4ABYAHkAbDAEAAQFHAAEAAAFUAAEBAFYAAAEASiYXAgUWKwEUDwEGJj0BISImPQE0NjMhNTQ2HwEWA8QF1wgW/UgICgoIArgWCNcFAWAIBsUICQx9CgdsBwp9DAoIwwYAAAAAAf/+/2oBrwMuABYAH0AcBAEBAAFHAAMAA28CAQABAG8AAQFmFCQjIQQFGCsBBisBERQGKwEiJjURIyImPwE2Mh8BFgGrBQt9CghrCAp9DAgHwwUPBsYHAj8L/UgICgoIArgWCNcFBdcIAAAAAgAA/7EDWgMLABgAMAAxQC4oHxkDAgQSDAMDAAECRwAEAgRvAAIDAm8AAwEDbwABAAFvAAAAZjoUFxo3BQUZKwEUDwEXFhQGByMiJic1ND4BHwE3NjIfARYBFRQOAS8BBwYiLwEmND8BJyY0NjczMhYBpQW5UAoUD/oPFAEWHAtQugUOBkAFAbQUIAlQuQYOBkAFBbpRChQP+g8WAQUHBrlRCh4UARYO+g8UAgxQuQYGPwYB2/oPFAIMULkGBkAFDga5UQoeFAEWAAAAAQAA/2oD6ANSAEQAUkBPAAoJCm8LAQkHCW8NAQcIB28GAQABAgEAAm0EAQIDAQIDawADA24MAQgBAQhSDAEICAFWBQEBCAFKQUA9PDs5NDMuLBMXExElFSETFA4FHSsBFA8BBiImPQEjFTMyFhQPAQYiLwEmNDY7ATUjFRQGIi8BJjQ/ATYyFh0BMzUjIiY0PwE2Mh8BFhQGKwEVMzU0NjIfARYD6AuOCx4U10gOFguPCh4KjwsWDkjXFB4KjwsLjwoeFNdIDhYLjwscC48LFg5I1xQeC44LAV4OC48LFg5I1xQeCo8LC48KHhTXSA4WC48LHAuPCxYOSNcUHguOCwuOCx4U10gOFguPCgAAAAAB//n/sQMYAsMAFAAYQBUOAwIAAQFHAAEAAW8AAABmOCcCBRYrARYHAREUBwYjIi8BJjURASY2MyEyAw8JEf7tFgcHDwqPCv7tEhMYAsoXAq0WEf7t/mIXCgMLjwsOAQ8BExEsAAAAAAEAAP+xA1oDCwBFADJALz41MyIEAgM0ISAbEhEQAgEJAAICRwQBAwIDbwUBAgACbwEBAABmJjo3Gzo5BgUaKwEHFzc2Fh0BFAYrASInJj8BJwcXFgcGKwEiJic1NDYfATcnBwYjIicmPQE0NjsBMhcWDwEXNycmNzY7ATIWBxUUBwYjIicCzMbGUBEsFBD6FwkKEVHGxlARCQoX+g8UASwRUMbGUAsOBwcWFg76FwoJEVDGxlERCgkX+g8WARYHBw4LAiTGxlASExj6DhYXFRFRxsZRERUXFg76GBMSUMbGUAsDCRj6DhYXFRFRxsZRERUXFg76GAkDCwAAAAYAAP/UA+kC5wAIABEAIQAqADoASgBfQFxEPDsDCgs0LAIICRsTAgQFA0cACwAKBgsKXgAHAAYDBwZgAAkACAIJCGAAAwACAQMCYAABBQABVAAFAAQABQReAAEBAFgAAAEATEhGQD84NiUTFRcWExQTEgwFHSs3FAYuATQ+ARY1FAYiJjQ2MhYBFRQGJyEiJj0BNDY3ITIWARQGIiY0NjIWARUUBiMhIiY9ATQ2MyEyFgMVFAYHISImPQE0NjMhMhbWPlo+Plo+Plo+Plo+AxIKCP1aCAoKCAKmBwz87T5aPj5aPgMSCgj9WggKCggCpgcMAQoI/VoICgoIAqYHDEAsQAI8XDwCQPItPj5aPj7+62sHDAEKCGsHCgEMAgAtPj5aPj7+62wHCgoHbAcKCgEWawcKAQwGawgKCgAGAAD/agPpA00AHwA9AE0AXQBtAH0CF0A3WllVAxQPd24CDhRvAQ0OMAEHCGcvKgMKEkccAgMFPx0OAwsEBgEBAgUBAAEJR18BChcTAgMCRkuwDFBYQGMADxQPbxUBChIRCQplAAQDCwMEZQACCwEDAmUAFA4NFFQWEAIOEwENCA4NXgAIAAcSCAdgABIAEQkSEWAACQAGBQkGXwADBAUDVAwBBQALAgULXgABAAABVAABAQBYAAABAEwbS7AlUFhAZAAPFA9vFQEKEhEJCmUABAMLAwRlAAILAQsCAW0AFA4NFFQWEAIOEwENCA4NXgAIAAcSCAdgABIAEQkSEWAACQAGBQkGXwADBAUDVAwBBQALAgULXgABAAABVAABAQBYAAABAEwbS7AqUFhAZQAPFA9vFQEKEhESChFtAAQDCwMEZQACCwELAgFtABQODRRUFhACDhMBDQgODV4ACAAHEggHYAASABEJEhFgAAkABgUJBl8AAwQFA1QMAQUACwIFC14AAQAAAVQAAQEAWAAAAQBMG0BmAA8UD28VAQoSERIKEW0ABAMLAwQLbQACCwELAgFtABQODRRUFhACDhMBDQgODV4ACAAHEggHYAASABEJEhFgAAkABgUJBl8AAwQFA1QMAQUACwIFC14AAQAAAVQAAQEAWAAAAQBMWVlZQCxOTiAge3lzcmtpY2FOXU5dXFtSUVBPS0lDQiA9ID08OyQbFhESGBMjIhcFHSsXFAYHIic3FjMyNjU0Byc2PwE2NzUiBicVIzUzFQceARMVIyY1ND4DNzQmByIHJz4BMzIWFRQOAgczNQUVFAYnISImPQE0NjMhMhYBFSM1MzU0NzUjBgcnNzMVBRUUBiMhIiY9ATQ2MyEyFgMVFAYHISImPQE0NjMhMhbVPiw8JB8cIBAYOw4EDhgKCgkkCTu6NRwiAcoEHCIoFgMSDRkULw02ICg4Ji4mAUcDTQoI/VoICgoIAqYHDPztuzwBAQUXKEw7A04KCP1aCAoKCAKmBwwBCgj9WggKCggCpgcMNi0yASUxGRAQIwQfBhIfDQgBAgEeVTFBBioBQlkUCh0uHhgYDQ4QASAhHCAuKBwuGh4PIrJrBwwBCghrCAoMAfA4OEMtFwcKFCpH4dhsBwoKB2wHCgoBFmsHCgEMBmsICgoAAv///9UCPALnAA4AHQAjQCAAAQABAUcAAwIDbwACAQJvAAEAAW8AAABmFTQmFAQFGCslFA8BBiIvASY0NjchMhYnFAYjISIuAT8BNjIfARYCOwr6CxwL+gsWDgH0DhYBFA/+DA8UAgz6Ch4K+grzDwr6Cwv6Ch4UARbIDhYWHAv6Cwv6CgAAAAEAAP/VAjwBFwAOABdAFAABAAEBRwABAAFvAAAAZiYUAgUWKyUUDwEGIi8BJjQ2NyEyFgI7CvoLHAv6CxYOAfQOFvMPCvoLC/oKHhQBFgAAAf//AAACOwLnAA4AEUAOAAEAAW8AAABmFTICBRYrARQGIyEiLgE/ATYyHwEWAjsUD/4MDxQCDPoKHgr6CgHJDhYWHAv6Cwv6CgAAAAcAAP+xA+gCwwAIABEAIwAsADUAPgBQAGRAYS0BAgY2CQIDByQAAgEAA0cIAQIGBwYCB20ABwMGBwNrCQEDAAYDAGsEAQABBgABawALAAYCCwZgBQEBCgoBVAUBAQEKWAAKAQpMTUxFQj08OTg0MzAvKyonJhMUExIMBRgrNzQmIgYeAjYTNCYiDgEeATYXNzYuAQYPAQ4BBwYeATY3NiYlNCYiDgEeATYBNCYiDgEeATYXNCYiDgEeATYXFAcGIyEiJyY1ND4CMh4C1io6LAIoPiZtKD4mBC42MOs5AxAaHAM4ITYICyxYSg0JGgFWKjwoAiw4Lv6YKD4mBC42MPYoPiYELjYwr08KFPzyFApPUIS8yLyEUM8eKio8KAIsARYeKio8KAIs8NUOGgYMENUDLCErTBguKyFAJR4qKjwoAiwBgR4qKjwoAixPHioqPCgCLN6RfBERe5JmuIhOToi4AAAAAQAA/7ED6AMLAFUATkBLAAwLDG8NAQsKC28PCQcFAwUBAgACAQBtCAQCAABuDgEKAgIKVA4BCgoCVgYBAgoCSlRST01MSkVCPTs6ODUzNSERJTUhESUzEAUdKyUVFAYrASImPQE0NhczNSEVMzIWFxUUBisBIiYnNTQ2FzM1IRUzMhYXFRQGKwEiJic1NDYXMzU0NhchNSMiJic1NDY7ATIWFxUUBgcjFSEyFgcVMzIWA+ggFrIWICAWNf7jNRceASAWshceASAWNf7jNRceASAWshceASAWNSoeAR01Fx4BIBayFx4BIBY1AR0dLAE1Fx6asxYgIBazFiABa2seF7MWICAWsxYgAWtrHhezFiAgFrMWIAFrHSwBayAVsxYgIBazFh4Bayoeax4AAgAA/2oDEgNTAC0AQgAxQC4uIhYABAEDDQQCBQECRwYBAwEDbwIBAQUBbwAFAAVvBAEAAGY2EzUVGx83BwUbKwERFAYHERQGKwEiJicRLgE1ETQ+ARYHFRQWMjY9ATQ+ARYHFRQWMjY9ATQ+ARYFERQGKwEiJicRIyImNRE0NhczMhYBZSgfKh5HHSoBHygWHBYBFhwWFhwWARYcFhQeFgGsKh5HHSoBfQcKaEqPDxQDLv6bIjgL/k0dKiodAbMLOCIBZQ8UAhgN6A4WFg7oDxQCGA3oDhYWDugPFAIYDfyDHSoqHQEeCggBvkpqARYAFAAA/2oDEgNSAA8AHwAvAD8ATwBfAG8AfwCPAJ8ArwC/AM8A3wDvAP8BDwEfAS0BPQIPQU4BLgABACUAKQEZARgBEQEQAQkBAQEAAOkA4QC5ALgAsQAMABYAFwD5APgA8QDwANkA0QDQAKkAoQB5AHgAcQAMAA4ADwDJAMgAwQCZAJEAaQBhADkAOAAxAAoABgAHAIkAiACBAFkAUQApACEAGQAYABEACgACAAMASQBBAAkAAQAEAAAAAQEtASYAAgAkACcBNgABACgAJAAIAEdLsAlQWEBjACcAJCQnZQApACUXKSVeIyEdAxciIBwDFg8XFmAfGxUDDx4aFAMOBw8OXhkTDQMHGBIMAwYDBwZeEQsFAwMQCgQDAgEDAl4JAQEIAQAnAQBeJgEkKCgkUiYBJCQoWQAoJChNG0BkACcAJAAnJG0AKQAlFyklXiMhHQMXIiAcAxYPFxZgHxsVAw8eGhQDDgcPDl4ZEw0DBxgSDAMGAwcGXhELBQMDEAoEAwIBAwJeCQEBCAEAJwEAXiYBJCgoJFImASQkKFkAKCQoTVlBTgE8AToBNAEyASoBKAElASQBIwEiASEBIAEdARsBFQETAQ0BCwEFAQMA/QD7APUA9ADtAOsA5QDjAN0A2wDVANQAzQDLAMUAxAC9ALsAtQCzAK0AqwClAKQAnQCbAJUAlACNAIsAhQCEAH0AewB1AHQAbQBrAGUAZABdAFsAVQBUAE0ASwAXACYAFwAXABcAFwAXABcAFAAqAAUAHSs3FRQGByMiJjc1NDY3MzIWNRUUBicjIiY3NTQ2NzMyFhcVFAYnIyImPQE0NjczMhYnFRQGJyMiJjc1NDY7ATIWARUUBgcjIiYnNTQ2NzMyFicVFAYnIyImPQE0NjczMhYnFRQGJyMiJj0BNDY7ATIWJxUUBicjIiY3NTQ2OwEyFgEVFAYnIyImJzU0NjczMhYnFRQGJyMiJj0BNDY7ATIWJxUUBicjIiY9ATQ2OwEyFicVFAYrASImNzU0NjsBMhYBFRQGJyMiJic1NDY7ATIWJxUUBicjIiY9ATQ2OwEyFicVFAYrASImPQE0NjsBMhYFFRQGJyMiJic1NDY7ATIWJxUUBisBIiY9ATQ2OwEyFhcVFAYrASImJzU0NjsBMhYDMxEhETM1NDY7ATIWBwERFAYHISImJxE0NjchMhbWCggjBwwBCggjCAoKCCMHDAEKCCMICo8KCCMICgoIIwgKjwoIIwcMAQoIIwgKAa0KCCQHCgEMBiQHDJAKCCQHCgoHJAcMkAoIIwgKCggjCAqPCggjBwwBCggjCAoBrQoIJAcKAQwGJAcMkAoIJAcKCgckBwyQCggjCAoKCCMICo8KCCMHDAEKCCMICgGtCggkBwoBDAYkBwyQCggkBwoKByQHDJAKCCMICgoIIwgKAR4KCCQHCgEMBiQHDJAKCCQHCgoHJAcMjgoIJAcKAQwGJAcMkNb9fdcKCLIHDAEBHhYO/TYPFAEWDgLKDxR2JAcKAQwGJAcKAQyJJAcMAQoIJAcKAQwGJAcMAQoIJAcKAQyJJAcMAQoIJAcKCv7bJAcKAQwGJAcKAQyJJAcMAQoIJAcKAQyJJAcMAQoIJAcKCocjBwwBCggjCAoK/tskBwwBCggkBwoBDIkkBwwBCggkBwoKhyMHDAEKCCMICgqHIwgKCggjCAoK/tskBwwBCggkBwoKhyMHDAEKCCMICgqHIwgKCggjCAoKlyMHDAEKCCMICgqHIwgKCggjCAoKCCMICgoIIwgKCvz4A1r8pn0ICgoIAwD8YA8UARYOA6APFAEWAAAC////sQKDA1MAJwAzAGdACxwBBAUTBAIAAwJHS7AJUFhAIgAFBAVvAAQDBG8AAwAAA2MCAQABAQBUAgEAAAFZAAEAAU0bQCEABQQFbwAEAwRvAAMAA28CAQABAQBUAgEAAAFZAAEAAU1ZQAkVGx0jMyUGBRorARUUBgcVMzIeAQYjISIuATY7ATUuATc1ND4BFgcVFBY+ASc1ND4BFicRFA4BJicRNDYeAQKDpHqPDxQCGA3+mw8UAhgNj3mmARYcFgGUzJYCFhwWj2iWZgFolGoByUd8tg1KFhwWFhwWSg22fEcPFAIYDUdnlAKQaUcPFAIYyf7jSmgCbEgBHUpqAmYAAAMAAP+xAwsDUwALAEMASwCUQBRFHxMNAQUABhQBAQA0MiMDAgEDR0uwCVBYQC8ABwYHbwAGAAZvAAABAG8AAQICAWMABQIDAgUDbQQBAgUDAlQEAQICA1kAAwIDTRtALgAHBgdvAAYABm8AAAEAbwABAgFvAAUCAwIFA20EAQIFAwJUBAECAgNZAAMCA01ZQBNKSD8+NzYxLywpJiQXFRIQCAUUKxMHJj0BND4BFh0BFAEHFRQGByInBxYzMjYnNTQ+ARYHFRQGBxUzMhYOASMhIiY+ATsBNSYnBwYiLwEmNDcBNjIfARYUJwERNDYXMhaXOBgWHBYCdspoSh8eNTY8Z5QBFhwWAaR5jg8WAhIR/psOFgISEI9GPY4FEAQuBgYCsQUOBi4G2v6lakk5XAFDOTo+Rw8UAhgNRx4BL8pHSmgBCzYckmhHDxQCGA1HfLYNShYcFhYcFkoHJo4GBi4FEAQCsQYGLgUQRf6mAR1KagFCAAQAAP9qA6EDUgADABMAIwBHAIdADBUFAgcCHQ0CAwcCR0uwClBYQCwLCQIHAgMDB2UKAQgEAQIHCAJgBQEDAAEAAwFfAAAGBgBSAAAABlgABgAGTBtALQsJAgcCAwIHA20KAQgEAQIHCAJgBQEDAAEAAwFfAAAGBgBSAAAABlgABgAGTFlAEkZEQT47OjMlNiYmJiQREAwFHSsXIREhNzU0JisBIgYdARQWOwEyNiU1NCYrASIGHQEUFjsBMjY3ERQGIyEiJjURNDY7ATU0NjsBMhYdATM1NDY7ATIWBxUzMhZHAxL87tcKCCQICgoIJAgKAawKCCMICgoIIwgK1ywc/O4dKiodSDQlJCU01jYkIyU2AUcdKk8CPGuhCAoKCKEICgoIoQgKCgihCAoKLP01HSoqHQLLHSo2JTQ0JTY2JTQ0JTYqAAAC//3/sQMSA0AACABNANlLsAlQWEAPOgECASUWAgUCIQEDBQNHG0uwClBYQA86AQQBJRYCBQIhAQMFA0cbQA86AQIBJRYCBQIhAQMFA0dZWUuwCVBYQCcABQIDAgUDbQADA24ABgAAAQYAYAcBAQICAVQHAQEBAlgEAQIBAkwbS7AKUFhAKAAFAgMCBQNtAAMDbgAGAAABBgBgBwEBAAQCAQRgBwEBAQJYAAIBAkwbQCcABQIDAgUDbQADA24ABgAAAQYAYAcBAQICAVQHAQEBAlgEAQIBAkxZWUALFB4mJzcsExIIBRwrATQmIgYUFjI2JRUUBwYjIi8BLgE1IxUeAQcRFAYjISImJxE0Njc1IyIOAwcGIyInLgE/AT4DNyY1NDYyFhUUBzM0Nj8BNjMyFxYBHhYcFhYcFgH0BwQHAgL6BgiPPlIBFg7+4w8UAUY3EiE+KCIMAQoWCQcNCgcIBSAkOiAONEo0B6gIBvoCAgcEBwLnDhYWHBYWILMJBQQBNQIKBjkNYkD+QQ4WFg4BvzteET4aIigUBBMEBxoPDgkqJCgJFxklNDQlExEGCgE2AQQFAAAAAAQAAP9qA58DUgAKACIAPgBOATFADxcBAAM0LAIGCCYBAQkDR0uwE1BYQEoRAQMAA28ABwYCBgdlBAECCgYCCmsTAQoJCQpjAAAADQwADV4UEhAOBAwPAQsIDAteAAgABgcIBl4ACQEBCVQACQkBWQUBAQkBTRtLsBRQWEBLEQEDAANvAAcGAgYHZQQBAgoGAgprEwEKCQYKCWsAAAANDAANXhQSEA4EDA8BCwgMC14ACAAGBwgGXgAJAQEJVAAJCQFZBQEBCQFNG0BMEQEDAANvAAcGAgYHAm0EAQIKBgIKaxMBCgkGCglrAAAADQwADV4UEhAOBAwPAQsIDAteAAgABgcIBl4ACQEBCVQACQkBWQUBAQkBTVlZQCg/PyMjP04/Tk1MS0pJSEdGRURDQkFAIz4jPj07EREZFBQjJB4QFQUdKwEzLwEmNSMPAQYHARQPAQYiLwEmNjsBETQ2OwEyFhURMzIWBRUhNRM2PwE1IwYrARUjNSEVAwYPARU3NjsBNRMVIzUzJyMHMxUjNTMTMxMCmWIoBgICAQICA/7aBrIFDgazCAgNawoIawgKawgKAdL+us4HBQYIBgqCQwE9zgQIBggFC4t1oSoaiBoqoCeAW4ACbnoaCQILCgoG/UYGB7IFBbMJFQMACAoKCP0ACkqCMgEnCwUFAQJAgDL+2AQKBwEBAkIB9Tw8UFA8PAFx/o8AAAAABAAA/2oDnwNSAAoAIgAyAE0BQ0AMRj4XAw4DNgENEQJHS7ATUFhAUQAPDhIOD2UUARIRERJjAAsNAg0LAm0EAQIADQIAaxABAwAODwMOXgARAA0LEQ1fAAAABwYAB14TDAoIBAYBAQZSEwwKCAQGBgFWCQUCAQYBShtLsBRQWEBSAA8OEg4PZRQBEhEOEhFrAAsNAg0LAm0EAQIADQIAaxABAwAODwMOXgARAA0LEQ1fAAAABwYAB14TDAoIBAYBAQZSEwwKCAQGBgFWCQUCAQYBShtAUwAPDhIODxJtFAESEQ4SEWsACw0CDQsCbQQBAgANAgBrEAEDAA4PAw5eABEADQsRDV8AAAAHBgAHXhMMCggEBgEBBlITDAoIBAYGAVYJBQIBBgFKWVlAKDMzIyMzTTNNTElFRENCQUA1NCMyIzIxMC8uLSwREREUFCMkHhAVBR0rJTMvASY1Iw8BBgcFFA8BBiIvASY2OwERNDY7ATIWFREzMhYFFSM1MycjBzMVIzUzEzMTAxUhNRM2PwE1IgYnBisBFSM1IRUDDwEVNzM1ApliKAYCAgECAgP+2gayBQ4GswgIDWsKCGsICmsICgIEoSoaiBoqoCeAW4AL/rrOBwUGAQQDBgqCQwE9zgwGCJszehoJAgsKCQd/BgeyBQWzCRUDAAgKCgj9AAqROztQUDs7AXL+jgKDgzMBJwoFBQICAQJAgDL+2Q8FAgJDAAAFAAD/agPoA1IAFwAnADcARwBXAF9AXFFJDAMKAkE5AggJMSkCBgchGQIABQRHAwEBBgUGAQVtCwECAAoJAgpgAAkACAcJCF4ABwAGAQcGYAAFAAAFVAAFBQBYBAEABQBMVVNNS0VDFyYmJiYUIyQUDAUdKyUUDwEGIi8BJjY7ARE0NjsBMhYVETMyFgUVFAYjISImPQE0NjMhMhYDFRQGIyEiJj0BNDYzITIWAxUUBgcjIiY9ATQ2OwEyFgMVFAYrASImPQE0NjsBMhYBmwayBQ4GswgIDWsKCGsICmsICgJNCgj+MAgKCggB0AgKawoI/psICgoIAWUICmsKCPoICgoI+ggKawoIjwgKCgiPCAouBgeyBQWzCRUDAAgKCgj9AApPawgKCghrCAoKARZrCAoKCGsICgoBFWsHCgEMBmsICgoBFmsICgoIawgKCgAFAAD/agPoA1IADwAnADcARwBXAF9AXFFJHAMKBEE5AggJMSkCBgcJAQIAAQRHBQEDBgEGAwFtCwEEAAoJBApgAAkACAcJCF4ABwAGAwcGYAABAAABVAABAQBYAgEAAQBMVVNNS0VDFyYmFCMkFyYjDAUdKwUVFAYrASImPQE0NjsBMhYlFA8BBiIvASY2OwERNDY7ATIWFREzMhYlFRQGKwEiJj0BNDY7ATIWExUUBgchIiY9ATQ2MyEyFhMVFAYjISImPQE0NjMhMhYCpwoIjwgKCgiPCAr+9AayBQ4GswgIDWsKCGsICmsICgF3Cgj6CAoKCPoICmsKCP6bCAoKCAFlCAprCgj+MAgKCggB0AgKGWsICgoIawgKCj8GB7IFBbMJFQMACAoKCP0ACs9rCAoKCGsICgoBFWsHCgEMBmsICgoBFmsICgoIawgKCgAEAAD/agM+A1IACgAiAEAAUgBnQGRPTklIRhcGCwQ1AQgBLgEHCC0BAgcERwwBBAsEbw4NAgsACgkLCl4ACQAAAQkAYAUDAgEACAcBCGAABwICB1QABwcCWAYBAgcCTEFBQVJBUlFQRURDQj89JScoFCMkFiMiDwUdKyU0JiciBhQWMzI2BRQPAQYiLwEmNjsBETQ2OwEyFhURMzIWJRQOAyMiJyYnNxYXFjMyNjcjDgEjIiY+ATMyFgMVITUzNTQ3NSMHBg8BJzczEQLvMCIdIigmHCj+qwayBQ4GswgIDWsKCGsICmsICgGiDiAsQiYjGQ4KFgkIFRUvOAkBCy4YO0wBUD1FXBH++l0BAgMFCiMta0R1JDoBKj4sHjAGB7IFBbMJFQMACAoKCP0ACh8jQj4sHAkEBD8EAgdCMA0QUHNSagE4QED8BwIJBwcKIDBn/pMABAAA/2oDPgNSAAoAIgA0AFIAdUByFwEABEYBDAE/AQsMPgEKCzEwKyooBQMIBUcACAoDCggDbQUBAwcKAwdrDQEEAAABBABgAAEADAsBDGAACwAKCAsKYA4JAgcCAgdSDgkCBwcCWAYBAgcCTCMjUU9LSURCPDojNCM0GxEUFCMkFiMiDwUdKwE0JgciBhQWNzI2ARQPAQYiLwEmNjsBETQ2OwEyFhURMzIWBRUhNTM1NDc1IwcGDwEnNzMRExQOAyciLwE3FhcWMzI2NyMOAQciJjc0NjcyFgLvMCIdIigmHCj+qwayBQ4GswgIDWsKCGsICmsICgGS/vpdAQIDBQojLWtEbQ4gLEImIxkYFgkIFRUvOAkBCy4YO0wBUD1FXAKxIzwBKj4sAR79lAYHsgUFswkVAwAICgoI/QAKjEBA+wYECQcHCiEwaP6TAuYiQj4sHgEJCT8EAghCMA0OAVA4O1ABagAABAAA/44EdwMLAAgAEgAbAEUAV0BUHQEGAQFHDQsCAgMAAwIAbQQBAAEDAAFrBQEBBgMBBmsKCAIGBwMGB2sJAQcHbgAMAwMMVAAMDANYAAMMA0xEQj88OTcxMC0sExMlExYjEhMSDgUdKyU0JiIOARYyNjchJy4BJyEiBhUBNCYiBh4BMjY3FRQGKwEVFAYiJj0BIRUUBiImJzUjIiY9ATQ2FzM3PgE3ITIWHwEzMhYBDDRKNAI4RjgSAjcyAQ4E/lMFDgLMNkg2AjJMMlsKCDY+Wj79xT5aPgE1CApKMxA6DVo3Aa02XAw6EDRI8yU0NEo0NNfIBAoBDAP+hiU0NEo0NFrWCApHLT4+LUdHLT4+LUcKCNY0SgHqNUYBSDTqSAAAAAcAAP+xBQcDCwAFAAwAFQAZADoARQBVAIFAfjoSBAMACSokDgMHACsBAgwDRwoFEAMEAQYJBgFlAAkABgkAawAABwYAB2sABwwGBwxrAAwCBgwCaw0LBAMCCAgCYwAPAAYBDwZgAAgODghUAAgIDlkADggOTQ0NVFFMSUVEQkFAPz07ODYuLCgmHRsZGBcWDRUNFRknEBEFFysBIzY/ARcFJyYrAQcWNwcnLgEnEzMTAzMTIwUmIyIGFQYXHgEXFAYjIi8BBxYzMjY3NCcuAT4BMzYfATcjIgcDMzczFhczExEUBgchIiY1ETQ2NyEyFgROTQgdDAf87yAGJJUCrpdaCg5CKEtikRRcOlwBciYtRFgBUhsUASIVMCcNDSo+SFgBThsaARwZJx4J+kgkDIphFHYDCFZIKh77iR0qKh0Edx0sASoUTyMfQ6QfCCw09TInQhH+4wFm/pkBZwkPQjU4KQwWChESEwZRE0I5OyYOEhkSAQ4FVx/+uDYMKgIZ/TYdKgEsHALKHSoBLAAAAAALAAD/sQUHAwsACwAXACMAOgBSAG0AhACdAKsAtgDGAX1AEIxCAgIJWgEACJZMAgcAA0dLsApQWEBkABwGHG8XEAIGAwZvFAEKAwkDCgltEw4NAwkCAwkCaxIBCAEAAQgAbRgWEQwEBwALAAcLbRUBCw8ACw9rAA8bAA8bawAbG24aAQMZAQIBAwJgBQEBCAABVAUBAQEAWAQBAAEATBtLsAtQWEBYABwGHG8XEAIGAwZvFBMODQoFCQMCAwkCbRIBCAEAAQgAbRgWFREMCwYHAA8ABw9tAA8bAA8bawAbG24aAQMZAQIBAwJgBQEBCAABVAUBAQEAWAQBAAEATBtAZAAcBhxvFxACBgMGbxQBCgMJAwoJbRMODQMJAgMJAmsSAQgBAAEIAG0YFhEMBAcACwAHC20VAQsPAAsPawAPGwAPG2sAGxtuGgEDGQECAQMCYAUBAQgAAVQFAQEBAFgEAQABAExZWUA0xcK9urWzsK6qp6KhnZqUko6NioiDgXl3c3BpZ15cV1VST0pIRENAPic0NCQlIyQkIh0FHSsBFAYjIiYnNDYzMhYlFAYHIzc2OwEyHgEXFAYjIiY1NDYzMhYlNCYHIyIPARQWOwEyPwE+AhY7ATI2Fzc0JgcjIgcmIgYVFBYXMjY3BhUUOwEyNzQmByMiDwEnJisBIgYUHgEXBhUUOwEyPwE2NzQmByMiDwEUFjsBMj8BPgIWOwEyNhc3NCYHIyIHJiIGFRQWFzI2NwcGFRQ7ATI3NTQrASIPARQWFzMyNyUOAQcjNzY7ATIWAREUBgchIiY1ETQ2NyEyFgGgHBUREgEcFQ8UAbcYGRIJAQcKDA4OxB4TEBQcFBAU/QUqI1oKASUEBCoLAQoBBgwGCAgwNq0XBAQqCAIPTjgmIQ8iCgIHJgv7BAMrBgQ7GQMJKgMEFhgBLQcrBgSOAdQqI1kLASUEBC0HAgoBBgwGCAgwNq0XBAQqCAIOTzgmIRAiCQEBByYLewcpBgElBAQkCwH8QQMYFRMKAQYLFhQEKCoe+4kdKiodBHcdLAFYFBwSEBUcEkMYEAE8BgIMXxQcEhAVHBJPIR4BCuQDBgs9BQQEAjZ+kQQGARIWPCkhJgEOCwcFCZ4CBgEFV1MJBAU+TAE/BAcFzgEeIR4BCuQDBgdBBQQEAjZ+kQQGARIWPCkhJgEOCwUEAwnvAQcG6QMEAQuZEwwBPAYOAQz9Nh0qASwcAsodKgEsAAAAAwAA//kEdwLEABIAGwAlAH+1BAECAAFHS7AkUFhALQAEBQRvAAUHBW8ABwYHbwkIAgYAAAZjAwEBAgFwAAACAgBUAAAAAlcAAgACSxtALAAEBQRvAAUHBW8ABwYHbwkIAgYABm8DAQECAXAAAAICAFQAAAACVwACAAJLWUARHBwcJRwlNRMVJBEREyAKBRwrEyEyFhcVIzUhFSMRNDYXMzIWFwU0JiIGHgEyNgU1NCYHISIGBxWPA8QPFAGP/KePFg5HDxQBAUFUdlQCUHpQAql+WP53DxQBARcWDvqPjwKmDxYBFBDWO1RUdlRUVCRZfgEUD9cAAAAG//7/agTAA1IAAgAFADUAPgBYAHEAckBvMiQCBQYcCQIMChcPAgMCA0diSAIAAUYABwYHbwAKBQwFCgxtDgEMAAUMAGsIAQYPCQIFCgYFYAEBAA0BCwIAC2AEAQIDAwJUBAECAgNYAAMCA0wGBmtqXl1RUERDNzYGNQY0EhImFCYmFRIREAUdKwEDIQEDIRMOAQcRITIWHQEUBiMhIiY9ATQ2MyERLgEnISImPQE0NjMhPgEyFhchMhYdARQGIwUyNjQuAQ4BFgEUDgMuAjc0PwE+Ajc2Mh8BFh8BHgEFFA4DLgI3ND8BPgI3NjIXHgQDxNYBrfxf1gGs9AgiFwFTCAoKCP0SCAoKCAFTFiIJ/u4ICgoIARIMNkY2DAESCAoKCP6JExoaJhgCHAJwNE5USFRMOAIUMx86OAMKKgsfHRw7Hyr9NDROVEhUTDgCFDMfOjgDCioKAzo2QiYCWP53AYn+dwH0FiQH/S8KByQICgoIJAcKAtEIIhcKCCQICh8oKB8KCCQICgkaJhgEIB4i/hkpQCYQBBgeSCUGJ2I7ZGoCExM3MzRtOVIEKUAmEAQYHkglBidiO2RqAhMTBGZoclIAAAIAAP9qA1kDUgAtAE0ARUBCKiICAwQaAwIAAxMLAgEAA0cABAYIBQMDAAQDXgcCAgABAQBSBwICAAABWAABAAFMAABEQzQzAC0ALCYWJiYWCQUZKwEUBgceARczMhYdARQGIyEiJj0BNDY7ATQ2Ny4BJyMiJj0BNDYzITIWHQEUBiMBPgMnIRQeAhceAgYHDgMXITQuAicuAjYDEnhYWXYBNQgKCgj8ywgKCgg1eFladgE1CAoKCAM1CAoKCP6hK1BAKAH9xSZCTiwLDAIQCSpSPioCAjsmQk4sCwwCEAMLkuA7O+CSCgckCAoKCCQHCpLgOzvgkgoHJAgKCggkBwr+dRBGZIZLSohiSA8EFBQUAxFGZIZLSohiSBADFBQUAAkAAP+xA1kDCwADAAcACwAPABMAKAArAC4APgCEQIEcGxoVBAMKIgEMBAJHABAODQsDCgMQCl4VCRIDAwgBAgEDAl4UBxEDAQYBAAUBAF4TAQUABAwFBF4ADA8PDFQADAwPWAAPDA9MEBAMDAgIBAQAAD06NTIuLSsqJiQeHRkXEBMQExIRDA8MDw4NCAsICwoJBAcEBwYFAAMAAxEWBRUrARUjNTcVIzUBFSM1NxUhNSUVITUBETQmByMHJwcnIyIGBxEUFjchMjYBNyMFNyMFERQGIyEiJjURNDYzITIWAR+MjIwCM76+/okBd/6JAcMIAxLTdXbTEQUGAQgEArQEBv4kZ+MBbHvjAZwwIv1MIzAwIwK0IjABVkhIjkdH/uNISI9ISI5HR/4gArQECAGPYGCPBgX9TAQIAQYCcFRUVAv9TCMwMCMCtCMwMAAAAAEAAAABAACXlclXXw889QALA+gAAAAA1jMMLwAAAADWMwww/+D/IQUHA5sAAAAIAAIAAAAAAAAAAQAAA1L/agAABQX/4P/uBQcAAQAAAAAAAAAAAAAAAAAAAQ8D6AAAA+j//QPoAAADIAAAA1n//QMRAAACygAAAxEAAAR2AAADEQAAA1n//wR2AAAD6AAABHYAAAPoAAADWQAAA1kAAAI7AAAEdgAAA1n//QPoAAADWQAAAjsAAANZAAADWQAAAsoAAAPoAAADoAAAA1n//wUFAAAD6AAAA1kAAAMRAAADWQAABHYAAANZAAAEdgAAA+gAAAR2AAADWQAAA1kAAAPoAAADWQAAA+gAAAMR//8DWQAABHEAAALKAAAD6AAAA+gAAANZAAAEdgAAA1kAAAR2AAAEdgAAA1kAAAOgAAAD6AAAA1kAAAPoAAAELwAAAsoAAANZAAACOwAAA+gAAAOgAAADWQAABC///wR2AAADWQAAA+j//gOgAAAD6P/+AxH//gNZAAADWQAAA1kAAANZ//0DWQAAA+gAAAOYAAAC1gAAA4QAAAL+AAAD6AAAA+gAAAPoAAAD6AAAA2L/8wHR//QB0f/zA2D/9AMMAAAD6AAAA+j/+gOEAAAD6AAAA+gAAAPoAAAD3gAAA3UAAAQvAAADEQAAAoIAAAOgAAACggAAA6AAAAOgAAADoAAAA+gAAAPo//8DoAAAA6AAAALKAAAEdgAABHYAAAQv//8D6AAAAxEAAAMRAAADEQAAA1n//QNZ//0DWf/9A1n//QI7AAADWf/9A1n//QFlAAABZQAAA1n//QHS//MBCf/0AQn/8wHQ//QC+AAAA+gAAAPoAAADWQAAA+gAAAPoAAAD6P/2A+j//wQvAAADWQAABC8AAAPo//0COwAAA+j//wOg//8DoAAAA+gAAAPoAAAD6AAAA+gAAAPoAAADoAAAA6AAAANZ//0DEQAAANYAAANZ//0D6P/6A+gAAANZAAADoP/5BHb//wR2AAADoP//A6D//wNZ//0EdgAABHYAAAPo//4EdgAAA1n/+wPUAAADEQAAA1kAAAQv//8EL///AoL//wGsAAAA3AAAAnH//wOgAAADoAAAArr/4ANBAAACvAAAApv//QHWAAAC7P/xArAAAAPoAAAD6AAAA+gAAAI7//8BZQAAAWUAAAOgAAAEL///AjoAAAOYAAADWQAAAawAAAPoAAADrAAAAjAAAAOJ/+8D6AAAAfQAAAPoAAADXAAAA8D//ANZ//0DrAAAAwz/+gNCAAAC7gAAA1IAAANS//0D1gAAA+gAAAPoAAAD6AAAAawAAAKCAAADoAAAAxEAAANZAAADWQAAA+gAAAPoAAAD6AAAA+gAAAPo//8BrP/9A+gAAAPoAAABrP/+A1kAAAPoAAADEf/5A1kAAAPoAAAD6AAAAjv//wI7AAACO///A+gAAAPoAAADEQAAAxEAAAKC//8DEQAAA6AAAAMR//0DoAAAA6AAAAPoAAAD6AAAA1kAAANZAAAEdgAABQUAAAUFAAAEdgAABQX//gNZAAADWQAAAAAAAACmAjICkALSA7YE5AVoBmYHGAdkCGQI0gpqCqQK7As4C3gMAA0sDXIOhA6+Dw4PaA/sEQoRsBICEnYS4BMoE3IUTBTkFbIWThbqF4AX5hw0HHIdIB1WHhwemiB+IQYhsCJwIq4jXiZMJqgnUigIKLApaCngKm4q1CtgK8osGCx6LOotXC48LvgvoDBsMKwxijHaMoo01jUiNUQ1+jaMNyg3mDfkOJA40DlEOao6KjpOOnI6ljq4OvY7dDwcPHw80j1EPZY+ED6ePxA/hj/OQCBAhkDuQc5CzEMAQ5BD1EQuRHJFHkW+RoJGukcER0xHdkfISC5IlkjUSWBJ5kpeSsJLDEt2S5ZLtkvWS/JMOkxUTG5NME2QTjBPJk+8UWBSHFKMVFJUelXSVlpW+FdiV8hYLFiUWOhZSlnWWh5adlrSWzhcSFzGXVZeMF6WXuRfNmBEYJxg/mE2YXph2GJQYrhjAmOaY/5kdmToZVRleGWaZdhmFmZ4ZuZnPmduZ65n9misasBrWmvqbBBsOGxabUptxG36bkRuqG7ubzZvim/UcHRw0nEScXBxonIWdhp23nc0eBp4rnlGefh6Mnt2e/B8LnxgfLx9gH2efeJ+DH6QfxB/kIAUgQKBOIFsgaKB2II+gsaC+oN4hBaFzoYShjqGYIcSh6iIIIrKi0yMBoyqjYaOko+kkEyQ9JGeklKS5JOslXyV+Jbal2qYEQABAAABDwH4ACcAAAAAAAIAugDKAHMAAAH6C3AAAAAAAAAAEgDeAAEAAAAAAAAANQAAAAEAAAAAAAEAEAA1AAEAAAAAAAIABwBFAAEAAAAAAAMAEABMAAEAAAAAAAQAEABcAAEAAAAAAAUACwBsAAEAAAAAAAYAEAB3AAEAAAAAAAoAKwCHAAEAAAAAAAsAEwCyAAMAAQQJAAAAagDFAAMAAQQJAAEAIAEvAAMAAQQJAAIADgFPAAMAAQQJAAMAIAFdAAMAAQQJAAQAIAF9AAMAAQQJAAUAFgGdAAMAAQQJAAYAIAGzAAMAAQQJAAoAVgHTAAMAAQQJAAsAJgIpQ29weXJpZ2h0IChDKSAyMDE3IGJ5IG9yaWdpbmFsIGF1dGhvcnMgQCBmb250ZWxsby5jb210cnhfYWRkb25zX2ljb25zUmVndWxhcnRyeF9hZGRvbnNfaWNvbnN0cnhfYWRkb25zX2ljb25zVmVyc2lvbiAxLjB0cnhfYWRkb25zX2ljb25zR2VuZXJhdGVkIGJ5IHN2ZzJ0dGYgZnJvbSBGb250ZWxsbyBwcm9qZWN0Lmh0dHA6Ly9mb250ZWxsby5jb20AQwBvAHAAeQByAGkAZwBoAHQAIAAoAEMAKQAgADIAMAAxADcAIABiAHkAIABvAHIAaQBnAGkAbgBhAGwAIABhAHUAdABoAG8AcgBzACAAQAAgAGYAbwBuAHQAZQBsAGwAbwAuAGMAbwBtAHQAcgB4AF8AYQBkAGQAbwBuAHMAXwBpAGMAbwBuAHMAUgBlAGcAdQBsAGEAcgB0AHIAeABfAGEAZABkAG8AbgBzAF8AaQBjAG8AbgBzAHQAcgB4AF8AYQBkAGQAbwBuAHMAXwBpAGMAbwBuAHMAVgBlAHIAcwBpAG8AbgAgADEALgAwAHQAcgB4AF8AYQBkAGQAbwBuAHMAXwBpAGMAbwBuAHMARwBlAG4AZQByAGEAdABlAGQAIABiAHkAIABzAHYAZwAyAHQAdABmACAAZgByAG8AbQAgAEYAbwBuAHQAZQBsAGwAbwAgAHAAcgBvAGoAZQBjAHQALgBoAHQAdABwADoALwAvAGYAbwBuAHQAZQBsAGwAbwAuAGMAbwBtAAAAAAIAAAAAAAAACgAAAAAAAAAAAAAAAAAAAAAAAAAAAAABDwECAQMBBAEFAQYBBwEIAQkBCgELAQwBDQEOAQ8BEAERARIBEwEUARUBFgEXARgBGQEaARsBHAEdAR4BHwEgASEBIgEjASQBJQEmAScBKAEpASoBKwEsAS0BLgEvATABMQEyATMBNAE1ATYBNwE4ATkBOgE7ATwBPQE+AT8BQAFBAUIBQwFEAUUBRgFHAUgBSQFKAUsBTAFNAU4BTwFQAVEBUgFTAVQBVQFWAVcBWAFZAVoBWwFcAV0BXgFfAWABYQFiAWMBZAFlAWYBZwFoAWkBagFrAWwBbQFuAW8BcAFxAXIBcwF0AXUBdgF3AXgBeQF6AXsBfAF9AX4BfwGAAYEBggGDAYQBhQGGAYcBiAGJAYoBiwGMAY0BjgGPAZABkQGSAZMBlAGVAZYBlwGYAZkBmgGbAZwBnQGeAZ8BoAGhAaIBowGkAaUBpgGnAagBqQGqAasBrAGtAa4BrwGwAbEBsgGzAbQBtQG2AbcBuAG5AboBuwG8Ab0BvgG/AcABwQHCAcMBxAHFAcYBxwHIAckBygHLAcwBzQHOAc8B0AHRAdIB0wHUAdUB1gHXAdgB2QHaAdsB3AHdAd4B3wHgAeEB4gHjAeQB5QHmAecB6AHpAeoB6wHsAe0B7gHvAfAB8QHyAfMB9AH1AfYB9wH4AfkB+gH7AfwB/QH+Af8CAAIBAgICAwIEAgUCBgIHAggCCQIKAgsCDAINAg4CDwIQAAVzcGluMwVzcGluNQVzaGFyZQNhZG4HYW5kcm9pZAlhbmdlbGxpc3QFYXBwbGUHYmVoYW5jZQliaXRidWNrZXQKYnV5c2VsbGFkcwJjYwhjb2Rlb3Blbg5jb25uZWN0ZGV2ZWxvcARjc3MzCGRhc2hjdWJlCWRlbGljaW91cwpkZXZpYW50YXJ0BGRpZ2cIZHJpYmJibGUHZHJvcGJveAZkcnVwYWwIZmFjZWJvb2sGZmxpY2tyCGZvcnVtYmVlCmZvdXJzcXVhcmUDZ2l0BmdpdGh1YgZnb29nbGUFZ3BsdXMHZ3dhbGxldAtoYWNrZXItbmV3cwVodG1sNQlpbnN0YWdyYW0HaW94aG9zdAZqb29tbGEIanNmaWRkbGUGbGFzdGZtB2xlYW5wdWIIbGlua2VkaW4FbGludXgGbWF4Y2RuCG1lYW5wYXRoBm9wZW5pZAlwYWdlbGluZXMGcGF5cGFsDnBpZWQtcGlwZXItYWx0CXBpbnRlcmVzdAJxcQZyZWRkaXQGcmVucmVuBnNlbGxzeQxzaGlydHNpbmJ1bGsLc2ltcGx5YnVpbHQIc2t5YXRsYXMFc2t5cGUFc2xhY2sKc2xpZGVzaGFyZQ1zdGFja292ZXJmbG93BXN0ZWFtC3N0dW1ibGV1cG9uDXRlbmNlbnQtd2VpYm8GdHJlbGxvBnR1bWJscgZ0d2l0Y2gHdHdpdHRlcgR2aW5lCXZrb250YWt0ZQZ3ZWNoYXQId2hhdHNhcHAFd2VpYm8Hd2luZG93cwl3b3JkcHJlc3MEeGluZwR5ZWxwB3lvdXR1YmUFeWFob28GY2lyY2xlBWxlbW9uCnNvdW5kY2xvdWQOZ29vZ2xlLWNpcmNsZXMHbG9nby1kYgZzd2VkZW4IZXZlcm5vdGUFaGVhcnQLaGVhcnQtZW1wdHkDZXllB2NvbW1lbnQEZG93bgRsZWZ0BXJpZ2h0AnVwBnBlbmNpbAlzaGFyZWFibGUFdG9vbHMGYmFza2V0BXJlcGx5CXJlcGx5LWFsbAdmb3J3YXJkBGVkaXQIZmVhdGhlcjMEY29kZQZhdHRhY2gEbG9jawlsb2NrLW9wZW4DcGluBGhvbWUEbGluawZ1bmxpbmsIZG93bmxvYWQEbWFpbARzdGFyCnN0YXItZW1wdHkIdXNlci1hbHQJdXNlci1wbHVzCnVzZXItdGltZXMLdXNlcnMtZ3JvdXACb2sGZGVsZXRlBHBsdXMFbWludXMKb2stY2lyY2xlZA5kZWxldGUtY2lyY2xlZAxwbHVzLWNpcmNsZWQNbWludXMtY2lyY2xlZARoZWxwDGhlbHAtY2lyY2xlZAxpbmZvLWNpcmNsZWQEaW5mbwlhdHRlbnRpb24RYXR0ZW50aW9uLWNpcmNsZWQJZG93bi1taW5pCWxlZnQtbWluaQpyaWdodC1taW5pB3VwLW1pbmkDcnNzC3NsaWRlci1sZWZ0DHNsaWRlci1yaWdodANjb2cDZ3BzB21vbml0b3IFbW91c2UHZmVhdGhlcgRjb2dzB3NsaWRlcnMGY2FtZXJhBGxhbXAIZG93bi1kaXIJdGVsZXBob25lBXByaW50BmV4cG9ydARtdXRlBnZvbHVtZQZzZWFyY2gGcHJpbnQyCHlvdXR1YmUyCGFzdGVyaXNrCGNoZWNrYm94C2NpcmNsZS10aGluCGVsbGlwc2lzDWVsbGlwc2lzLXZlcnQDb2ZmCHNjaXNzb3JzBXBhc3RlBmZsb3BweQRib29rCnRvZ2dsZS1vZmYJdG9nZ2xlLW9uB2NvbHVtbnMFdGFibGUKY2lyY2xlLWRvdAljaGFydC1iYXIKY2hhcnQtYXJlYQljaGFydC1waWUKY2hhcnQtbGluZQtjZXJ0aWZpY2F0ZQZzaWduYWwOY2hlY2tib3gtZW1wdHkEZ2lmdAdkZXNrdG9wBmxhcHRvcAZ0YWJsZXQGbW9iaWxlA2RvdAZyZWNvcmQLcXVvdGUtcmlnaHQKcXVvdGUtbGVmdAhmZWF0aGVyMhBsb2NhdGlvbi1vdXRsaW5lBG1lbnUFY2hlY2sGY2FuY2VsBGZpcmUKZmlyZS1saWdodApmb29kLWxpZ2h0B3Bob25lLTIDbWFwBnVwLWRpcghsZWZ0LWRpcglyaWdodC1kaXIIY2FsZW5kYXILY3JlZGl0LWNhcmQEZG90MgRkb3QzDHJlc2l6ZS1zbWFsbA9yZXNpemUtdmVydGljYWwRcmVzaXplLWhvcml6b250YWwFd2F0ZXIHZHJvcGxldANhaXIHYWRkcmVzcwhsb2NhdGlvbgVtYXAtMglkaXJlY3Rpb24HY29tcGFzcwVnbG9iZQlmbG93LXRyZWUDa2V5CmZsb3ctY3Jvc3MEZnVlbAdsb2RnaW5nBnRvaWxldAZ3cmVuY2gGY29ncy0xB2dhdWdlLTEEcm9hZAp2b2x1bWUtb2ZmC3ZvbHVtZS1kb3duCXZvbHVtZS11cARwbGF5BXBhdXNlBHN0b3AKYWxpZ24tbGVmdAxhbGlnbi1jZW50ZXILYWxpZ24tcmlnaHQNYWxpZ24tanVzdGlmeQRsaXN0CmFycm93LWRvd24KYXJyb3ctbGVmdAthcnJvdy1yaWdodAhhcnJvdy11cAtyZXNpemUtZnVsbARtb3ZlBmZpbHRlcg9yZXNpemUtZnVsbC1hbHQLbGlzdC1idWxsZXQNbGlzdC1udW1iZXJlZARzb3J0CXNvcnQtZG93bgdzb3J0LXVwBWdhdWdlB3NpdGVtYXAEZm9vZAhidWlsZGluZwNtaWMGbXV0ZS0xDmNhbGVuZGFyLWVtcHR5DGV4dGluZ3Vpc2hlcgxzb3J0LW5hbWUtdXAOc29ydC1uYW1lLWRvd24Lc29ydC1hbHQtdXANc29ydC1hbHQtZG93bg5zb3J0LW51bWJlci11cBBzb3J0LW51bWJlci1kb3duA2NhcgdjYy12aXNhCWNjLXBheXBhbANiZWQNYmFsYW5jZS1zY2FsZQlob3VyZ2xhc3MHd3Bmb3JtcwAAAAEAAf//AA8AAAAAAAAAAAAAAAAAAAAAABgAGAAYABgDm/8hA5v/IbAALCCwAFVYRVkgIEu4AA5RS7AGU1pYsDQbsChZYGYgilVYsAIlYbkIAAgAY2MjYhshIbAAWbAAQyNEsgABAENgQi2wASywIGBmLbACLCBkILDAULAEJlqyKAEKQ0VjRVJbWCEjIRuKWCCwUFBYIbBAWRsgsDhQWCGwOFlZILEBCkNFY0VhZLAoUFghsQEKQ0VjRSCwMFBYIbAwWRsgsMBQWCBmIIqKYSCwClBYYBsgsCBQWCGwCmAbILA2UFghsDZgG2BZWVkbsAErWVkjsABQWGVZWS2wAywgRSCwBCVhZCCwBUNQWLAFI0KwBiNCGyEhWbABYC2wBCwjISMhIGSxBWJCILAGI0KxAQpDRWOxAQpDsAFgRWOwAyohILAGQyCKIIqwASuxMAUlsAQmUVhgUBthUllYI1khILBAU1iwASsbIbBAWSOwAFBYZVktsAUssAdDK7IAAgBDYEItsAYssAcjQiMgsAAjQmGwAmJmsAFjsAFgsAUqLbAHLCAgRSCwC0NjuAQAYiCwAFBYsEBgWWawAWNgRLABYC2wCCyyBwsAQ0VCKiGyAAEAQ2BCLbAJLLAAQyNEsgABAENgQi2wCiwgIEUgsAErI7AAQ7AEJWAgRYojYSBkILAgUFghsAAbsDBQWLAgG7BAWVkjsABQWGVZsAMlI2FERLABYC2wCywgIEUgsAErI7AAQ7AEJWAgRYojYSBksCRQWLAAG7BAWSOwAFBYZVmwAyUjYUREsAFgLbAMLCCwACNCsgsKA0VYIRsjIVkqIS2wDSyxAgJFsGRhRC2wDiywAWAgILAMQ0qwAFBYILAMI0JZsA1DSrAAUlggsA0jQlktsA8sILAQYmawAWMguAQAY4ojYbAOQ2AgimAgsA4jQiMtsBAsS1RYsQRkRFkksA1lI3gtsBEsS1FYS1NYsQRkRFkbIVkksBNlI3gtsBIssQAPQ1VYsQ8PQ7ABYUKwDytZsABDsAIlQrEMAiVCsQ0CJUKwARYjILADJVBYsQEAQ2CwBCVCioogiiNhsA4qISOwAWEgiiNhsA4qIRuxAQBDYLACJUKwAiVhsA4qIVmwDENHsA1DR2CwAmIgsABQWLBAYFlmsAFjILALQ2O4BABiILAAUFiwQGBZZrABY2CxAAATI0SwAUOwAD6yAQEBQ2BCLbATLACxAAJFVFiwDyNCIEWwCyNCsAojsAFgQiBgsAFhtRAQAQAOAEJCimCxEgYrsHIrGyJZLbAULLEAEystsBUssQETKy2wFiyxAhMrLbAXLLEDEystsBgssQQTKy2wGSyxBRMrLbAaLLEGEystsBsssQcTKy2wHCyxCBMrLbAdLLEJEystsB4sALANK7EAAkVUWLAPI0IgRbALI0KwCiOwAWBCIGCwAWG1EBABAA4AQkKKYLESBiuwcisbIlktsB8ssQAeKy2wICyxAR4rLbAhLLECHistsCIssQMeKy2wIyyxBB4rLbAkLLEFHistsCUssQYeKy2wJiyxBx4rLbAnLLEIHistsCgssQkeKy2wKSwgPLABYC2wKiwgYLAQYCBDI7ABYEOwAiVhsAFgsCkqIS2wKyywKiuwKiotsCwsICBHICCwC0NjuAQAYiCwAFBYsEBgWWawAWNgI2E4IyCKVVggRyAgsAtDY7gEAGIgsABQWLBAYFlmsAFjYCNhOBshWS2wLSwAsQACRVRYsAEWsCwqsAEVMBsiWS2wLiwAsA0rsQACRVRYsAEWsCwqsAEVMBsiWS2wLywgNbABYC2wMCwAsAFFY7gEAGIgsABQWLBAYFlmsAFjsAErsAtDY7gEAGIgsABQWLBAYFlmsAFjsAErsAAWtAAAAAAARD4jOLEvARUqLbAxLCA8IEcgsAtDY7gEAGIgsABQWLBAYFlmsAFjYLAAQ2E4LbAyLC4XPC2wMywgPCBHILALQ2O4BABiILAAUFiwQGBZZrABY2CwAENhsAFDYzgtsDQssQIAFiUgLiBHsAAjQrACJUmKikcjRyNhIFhiGyFZsAEjQrIzAQEVFCotsDUssAAWsAQlsAQlRyNHI2GwCUMrZYouIyAgPIo4LbA2LLAAFrAEJbAEJSAuRyNHI2EgsAQjQrAJQysgsGBQWCCwQFFYswIgAyAbswImAxpZQkIjILAIQyCKI0cjRyNhI0ZgsARDsAJiILAAUFiwQGBZZrABY2AgsAErIIqKYSCwAkNgZCOwA0NhZFBYsAJDYRuwA0NgWbADJbACYiCwAFBYsEBgWWawAWNhIyAgsAQmI0ZhOBsjsAhDRrACJbAIQ0cjRyNhYCCwBEOwAmIgsABQWLBAYFlmsAFjYCMgsAErI7AEQ2CwASuwBSVhsAUlsAJiILAAUFiwQGBZZrABY7AEJmEgsAQlYGQjsAMlYGRQWCEbIyFZIyAgsAQmI0ZhOFktsDcssAAWICAgsAUmIC5HI0cjYSM8OC2wOCywABYgsAgjQiAgIEYjR7ABKyNhOC2wOSywABawAyWwAiVHI0cjYbAAVFguIDwjIRuwAiWwAiVHI0cjYSCwBSWwBCVHI0cjYbAGJbAFJUmwAiVhuQgACABjYyMgWGIbIVljuAQAYiCwAFBYsEBgWWawAWNgIy4jICA8ijgjIVktsDossAAWILAIQyAuRyNHI2EgYLAgYGawAmIgsABQWLBAYFlmsAFjIyAgPIo4LbA7LCMgLkawAiVGUlggPFkusSsBFCstsDwsIyAuRrACJUZQWCA8WS6xKwEUKy2wPSwjIC5GsAIlRlJYIDxZIyAuRrACJUZQWCA8WS6xKwEUKy2wPiywNSsjIC5GsAIlRlJYIDxZLrErARQrLbA/LLA2K4ogIDywBCNCijgjIC5GsAIlRlJYIDxZLrErARQrsARDLrArKy2wQCywABawBCWwBCYgLkcjRyNhsAlDKyMgPCAuIzixKwEUKy2wQSyxCAQlQrAAFrAEJbAEJSAuRyNHI2EgsAQjQrAJQysgsGBQWCCwQFFYswIgAyAbswImAxpZQkIjIEewBEOwAmIgsABQWLBAYFlmsAFjYCCwASsgiophILACQ2BkI7ADQ2FkUFiwAkNhG7ADQ2BZsAMlsAJiILAAUFiwQGBZZrABY2GwAiVGYTgjIDwjOBshICBGI0ewASsjYTghWbErARQrLbBCLLA1Ky6xKwEUKy2wQyywNishIyAgPLAEI0IjOLErARQrsARDLrArKy2wRCywABUgR7AAI0KyAAEBFRQTLrAxKi2wRSywABUgR7AAI0KyAAEBFRQTLrAxKi2wRiyxAAEUE7AyKi2wRyywNCotsEgssAAWRSMgLiBGiiNhOLErARQrLbBJLLAII0KwSCstsEossgAAQSstsEsssgABQSstsEwssgEAQSstsE0ssgEBQSstsE4ssgAAQistsE8ssgABQistsFAssgEAQistsFEssgEBQistsFIssgAAPistsFMssgABPistsFQssgEAPistsFUssgEBPistsFYssgAAQCstsFcssgABQCstsFgssgEAQCstsFkssgEBQCstsFossgAAQystsFsssgABQystsFwssgEAQystsF0ssgEBQystsF4ssgAAPystsF8ssgABPystsGAssgEAPystsGEssgEBPystsGIssDcrLrErARQrLbBjLLA3K7A7Ky2wZCywNyuwPCstsGUssAAWsDcrsD0rLbBmLLA4Ky6xKwEUKy2wZyywOCuwOystsGgssDgrsDwrLbBpLLA4K7A9Ky2waiywOSsusSsBFCstsGsssDkrsDsrLbBsLLA5K7A8Ky2wbSywOSuwPSstsG4ssDorLrErARQrLbBvLLA6K7A7Ky2wcCywOiuwPCstsHEssDorsD0rLbByLLMJBAIDRVghGyMhWUIrsAhlsAMkUHiwARUwLQBLuADIUlixAQGOWbABuQgACABjcLEABUKyAAEAKrEABUKzCgIBCCqxAAVCsw4AAQgqsQAGQroCwAABAAkqsQAHQroAQAABAAkqsQMARLEkAYhRWLBAiFixA2REsSYBiFFYugiAAAEEQIhjVFixAwBEWVlZWbMMAgEMKrgB/4WwBI2xAgBEAAA=1
data:application/octet-stream;base64,d09GRgABAAAAAOA8AA8AAAABZAAAAQAAAAAAAAAAAAAAAAAAAAAAAAAAAABHU1VCAAABWAAAADsAAABUIIslek9TLzIAAAGUAAAAQwAAAFY+aVPdY21hcAAAAdgAAAYdAAAQ1u8/BMhjdnQgAAAH+AAAABQAAAAgB2f+cmZwZ20AAAgMAAAFkAAAC3CKkZBZZ2FzcAAADZwAAAAIAAAACAAAABBnbHlmAAANpAAAxRIAATAibgJS72hlYWQAANK4AAAANAAAADYQbFwAaGhlYQAA0uwAAAAhAAAAJAg8BW1obXR4AADTEAAAAaIAAAQ8oJv+y2xvY2EAANS0AAACIAAAAiDq6zphbWF4cAAA1tQAAAAgAAAAIAReDjRuYW1lAADW9AAAAZcAAAMtsK8W43Bvc3QAANiMAAAHNAAACzQFxGuMcHJlcAAA38AAAAB6AAAAhuVBK7x4nGNgZGBg4GIwYLBjYHJx8wlh4MtJLMljkGJgYYAAkDwymzEnMz2RgQPGA8qxgGkOIGaDiAIAJjsFSAB4nGNgZM5lnMDAysDAVMW0h4GBoQdCMz5gMGRkAooysDIzYAUBaa4pDA4vGD7NYA76n8UQxTyb4T5QmBEkBwD0QQzOAHic3ddnkJ1lGcbx/3Oy2VSWZIlxbRFQBBRwQ2JQ7LRYMEYBqQmBCCqIBRUVCypIryoYBQWxUpQQAROUak+wgogSYiHitVJ832NC7PE6+1yz44yf+Go2v8zsTs7M7pl97/t/A+OBcbaT9fnvLAq9Lw35q2X06+OYPPr1vs5D/nyYrf3/punBkcGRoWZ+s7xZ0axp1jXrGzUbm03t7HZuu7hd2q5qm3ZDd153QXdhd9nmzSBGthx7xepm7dgrhts57aJ2yf++4jH9KQx3+jtTxz4GOoNjHzM6MztDnVn//TH6io5/tj6/A/1MYCKT/HNOYSpbMMCWTGM6g2zFDB7HTB7PEE/giTyJJ/MUZvFUvwvbsC1P4+lsxzPYnh3YkWfyLL9fO7MLz/b7NJtdmcNcnsM8duO5PI/deT4v4IW8iBfzEl7KHuzJXuzNPsznZbycV/BK9uVVLODVLOQ1vJb92J8DeB0HchAHcwiHchiLWMzhLOEIjmQpr+cojuYNvJE3cQzH8maO4y28lbfxdo7nHbyTd3EC7+Y9vJcTeR/v5wN8kJP4EB/mI5zMKXyUUzmN0zmDMzmLszmHczmP87mAj/FxPsGFXMQnWcan+DQXcwmf4bNcymV8jsv5PF/gi3yJL/MVruBKruJqvsrXuIblXMsKvs51XM8NfIOVrOJGvsm3uImbuYVbuY3b+Tbf4bt8j+/zA37IatZwBz/ix/yEn/Izfs6d3MUvuJtfcg+/4tfcy1ruYx2/4bf8jt9zP+v5Aw/wx96vF3/iQR7iYR7hzzS0dPkLG9jIo2zir/yNv/MP/sm/+DebC6WUThlX+sr40l8mlIllUplcppSpZYsy4F+O/sf4+/f/+Gfq6D8r6ye9d0VUvcmg8FOEojdJFL1pouhNGYWfNhR+7lD4CUThZxFFb/oo/Hyi6H13Cj+zKOh9n+HnGIWfaBR+tlH4KUfh5x2Fn3wUngEoPA1QeC6g8IRA4VmBwlMDhecHCk8SFJ4pKDxdUHjOoPDEQeHZg8JTCIXnEQpPJhSeUSg8rVB4bqHwBEPhWYbCUw2F5xuK3sZQeOah8PRD4TmIwhMRhWcjCk9JFJ6XKDw5UXiGovA0ReG5isITFoVnLQpPXRSevyg8iVF4JqPwdEbhOY3CExuFZzcKT3EUnucoPNlReMaj8LRH4bmPwhsAhXcBCm8FFN4PKLwpUHhnoPD2QOE9gsIbBYV3CwpvGRTeNyi8eVB4B6HwNkLhvYTCGwqFdxUKby0U3l8ovMlQeKeh8HZD4T2HwhsPhXcfCm9BFN6HKLwZUXhHovC2ROG9icIbFIV3KQpvVRTeryi8aVF456Lw9kXhPYzCGxmFdzMKb2kU3tcovLlReIej8DZH4b2OwhsehXc9Cm99FN7/KFwCKNwEKFwHKNwJKFwMKNwOKFwRKNwTKFwWKNwYKFwbKNwdKFwgKNwiKFwlKNwnKFwqKNwsKFwvKNwxKFw0KNw2KFw5KNw7KFw+KNxAKFxDKNxFKFxIKNxKKFxNKNxPKFxSKNxUKFxXKNxZKFxcKNxeKFxhKNxjKFxmKNxoKFxrKNxtKFxwKNxyKFx1KNx3KFx6KNx8KFx/KNyBKFyEKNyGKFyJKNyLKFyOKNyQKFyTKNyVKFyYKNyaKFydKNyfKFyiKNykKFynKNypKFysKNyuKFyxKNyzKFy2KNy4KFy7KNy9KFzAKNzCKFzFKNzHKFzKKNzMKFzPKNzRKFzUKNzWKFzZKNzbKFzeKNzgKFzjKNzlKFzoKNzqKFztKNzvKFzyKNz0KFz3KNz5KFz8KNz+KHwFoPA9gMKXAQrfCCh8LaDw3YCiF7YK3xIofFWg8H2BwpeGL9rKNwcj0ypfH4xMr3yHMDJY+SJhZKjybUIzv/KVQrO88r1Cs6Ly5UKzuvINQ7Om8jVDs7byXUNzX+ULh2Zd5VuHZn3lq4dGle8fmo2VLyGaTZVvItrhytcR7ewKX+HtnKqX+u3cqviTdlFV3P3t4qq4+9slVXH3t0dUxd3fHln1Lqt2aVXc/e2qqrj726Yq7v52Q1Xc/d15VXH3dxdUxd3fXVgVd393WVUG/gOYTjQGAAAAeJxjYEADEhDIPPu/IggDABOQA914nK1WaXfTRhQdeUmchCwlCy1qYcTEabBGJmzBgAlBsmMgXZytlaCLFDvpvvGJ3+Bf82Tac+g3flrvGy8kkLTncJqTo3fnzdXM22USWpLYC+uRlJsvxdTWJo3sPAnphk3LUXwoO3shZYrJ3wVREK2W2rcdh0REIlC1rrBEEPseWZpkfOhRRsu2pFdNyi096S5b40G9Vd9+GjrKsTuhpGYzdGg9siVVGFWiSKY9UtKmZaj6K0krvL/CzFfNUMKITiJpvBnG0EjeG2e0ymg1tuMoimyy3ChSJJrhQRR5lNUS5+SKCQzKB82Q8sqnEeXD/Iis2KOcVrBLttP8vi95p3c5P7Ffb1G25EAfyI7s4Ox0JV+EW1th3LST7ShUEXbXd0Js2exU/2aP8ppGA7crMr3QjGCpfIUQKz+hzP4hWS2cT/mSR6NaspETQetlTuxLPoHW44gpcc0YWdDd0QkR1P2SMwz2mD4e/PHeKZYLEwJ4HMt6RyWcCBMpYXM0SdowcmAlZYsqqfWumDjldVrEW8J+7drRl85o41B3YjxbDx1bOVHJ8WhSp5lMndpJzaMpDaKUdCZ4zK8DKD+iSV5tYzWJlUfTOGbGhEQiAi3cS1NBLDuxpCkEzaMZvbkbprl2LVqkyQP13KP39OZWuLnTU9oO9LNGf1anYjrYC9PpaeQv8Wna5SJF6frpGX5M4kHWAjKRLTbDlIMHb/0O0svXlhyF1wbY7u3zK6h91kTwpAH7G9AeT9UpCUyFmFWIVkBirWtZlsnVrBapyNR3Q5pWvqzTBIpyHBfHvoxx/V8zM5aYEr7fidOzIy49c+1LCNMcfJt1PZrXqcVyAXFmeU6nWZbv6zTH8gOd5lme1+kIS1unoyw/1GmB5Uc6HWN5QQuadN/BkIsw5AIOkDCEpQNDWF6CISwVDGG5CENYFmEIyyUYwvJjGMJyGYawvKxl1dRTSePamVgGbEJgYo4eucxF5WoquVRCu2hUakOeEm6VVBTPqn9loF488oY5sBZIl8iaXzHOlY9G5fjWFS1vGjtXwLHqbx+O9jnxUtaLhT8F/9XWVCW9Ys3Dk6vwG4aebCeqNql4dE2Xz1U9uv5fVFRYC/QbSIVYKMqybHBnIoSPOp2GaqCVQ8xszDy063XLmp/D/TcxQhZQ/fg3FBoL3INOWUlZ7eCs1dfbstw7g3I4EyxJMTfz+lb4IiOz0n6RWcqej3wecAWMSmXYagOtFbzZJzEPmd4kzwRxW1E2SNrYzgSJDRzzgHnznQQmYeqqDeRO4YYN+AVhbsF5J1yieqMsh+5F7PMopPxbp+JE9qhojMCz2Rthr+9Cym9xDCQ0+aV+DFQVoakYNRXQNFJuqAZfxtm6bULGDvQjKnbDsqziw8cW95WSbRmEfKSI1aOjn9Zeok6q3H5mFJfvnb4FwSA1MX9733RxkMq7WskyR20DU7calVPXmkPjVYfq5lH1vePsEzlrmm66Jx56X9Oq28HFXCyw9m0O0lImF9T1YYUNosvFpVDqZTRJ77gHGBYY0O9Qio3/q/rYfJ4rVYXRcSTfTtS30edgDPwP2H9H9QPQ92Pocg0uz/eaE59u9OFsma6iF+un6Dcwa625WboG3NB0A+IhR62OuMoNfKcGcXqkuRzpIeBj3RXiAcAmgMXgE921jOZTAKP5jDk+wOfMYdBkDoMt5jDYZs4awA5zGOwyh8Eecxh8wZx1gC+ZwyBkDoOIOQyeMCcAeMocBl8xh8HXzGHwDXPuA3zLHAYxcxgkzGGwr+nWMMwtXtBdoLZBVaADU09Y3MPiUFNlyP6OF4b9vUHM/sEgpv6o6faQ+hMvDPVng5j6i0FM/VXTnSH1N14Y6u8GMfUPg5j6TL8Yy2UGv4x8lwoHlF1sPufvifcP28VAuQABAAH//wAPeJzUvAl8G9d1L3zPnX0wGAwGgwEIgiAIgABIQiAIYqFIioQoiqQoSqIoiiIpiqI2RpZESZFoW7ZlWXEcx1Fk13Fsx3Fc242XOHbsOotjN3HiNHEcZ2mS9n1f0yxNmqVt2qZJmuWliwl/5w4oW07a976vfe/7/R5BYO7cmbkzc5dz/v9zzr2Evrry6hHuH7gJkiLjZHtla8IWOaBjAwWO5+gwAcpR4JYk4HjK8UdFIIQCoQuEFwR+kvC8ME0EXhhrSQMZ3tjRnh5vGbdMTSUpSMmC1QYxScSPZTdCZ75YKuOnM28HJBEz7D5ohyx4IJlKQszPzhPjsVQyVS4l2yGpQyNEoB/sgN2ZZxeWC5gNP33rm5c2bMS785M+odi5Y9eBbbcVuhWq/cZlqXw3NZX1g7Nz0OkcnDowPrKx2CNT1z+vHlUrg7N7Fm988/EBpwxuotJ39PhbZIWCuX/H9vaOvq61io/Lc4pt/FB2ib1DyXSVrx2KRn73GLv6RlnGOiFEIwTr8sdYlx7SRIpkE5kjS+QcuZ08TJ4jXyLfIk9UHtOAQpinhO7cQnly3ekj+3lOfCfIwovgkr7xPFVcXwNVkYfdeB7WPlky8JgkyNISkVyC5DpKFJfqUtQlDfCePJAFHXjCCTy34AGRCLIoLHgBT3BN4salThPVpY59+cuPPnL8+J498RghX/7Wl7/53/70s5955LlHn3vH24+fO3791VfuWdpzbPFgrBgv4rPrSVPwY8uJDWDZPZAvrYNCMh5IYvnYan671A9OAwkxD7BGynWwZmKNWXTych2Xmq6TZTp5TnvjhbmO2qUdv1X672bgRfFLV712u/ilknMdrxXNsvyXniDX8YbbsQtzHYHfKhu+yksSPyRIkvAxkd/NUaGXV+luSvl1UB3HX57iniI4W44e4unv42CIcwr/+4BZce6Vr8lcHE+/Hy+rbekXeEkUnhVEUXilnRX8cZakWyUuBpefSFde4mitFKryTrEifI2ntVuqtVtz1QsS5zwOr9A5HHe9v8eKHGJFchN4m9V7tYPICq7dQVBoHC4r1nla8SF47UVY6ZIosjJff+V/EIWh1bIF59epl/eKr1UIewIQ4LVnY6WJ18LrlcHuJ1LxtTdkz9HlPJ7E4w+OC+ynr97HRbkoypjByvomEHjLRSmXlLCLc8MoSvgTROCEE4Sj3AmCY+MEyhkgJwjAIpBopD7k8+qawDOhIqFQac7blhhLFgulYjNKjGQBZUqgucAy2BGUIYJtSUKJXuibnj47TauvtOYx1VdK4hNjxnRfIVn9V0pBTLw8dQ53RYO/L4oHIvfxBt83jXnR++SYfF+EcCgfP8zt5Vz4WAqxSVslLQARYJgIBB+YcPiUHHAnKAAPJ1AeLvotr+n1ikKoDQJxoVOBznJTs6VDLEv7IB8BePLk96G3+CqpvlrshjjUn3rpxy8fF699/lefOAe/eeJ6uLF6bqZ05YvLyy/+PfshBOvw1Ss4k3MTmXhJhHSRLWSGfPLZTUMVjrhgePPTyvh0pUJchLgOuHVKVUWlypIHFE5VuKMaym4VZbcsUl5QeeGoBIJwHKWHqpJJJkTUXUQl6ub6Sj8W4Trxny9hptLc2Ogzp3dNbB8ZXtfb2NXYVezMtWfa0qlErC5oRnyRoGEIdhsOxCzo1A7kSwWU8xEQ8rbkZ22K47MkeC2xDfxYZ8lUMe5s2wGbOeVtjoC/qVAqp5LlUiOU8oFyyZZ8ly7sAxt8ik5VW+aNXyqaZmK6OhSIQTQXi9E3Jepao/kobIl2RAFaQjGAG3pGVl4ZWpfiRZlPF68qpnmd/2GsPYb/dKNzuS3T1e0VscDPg7FY8OeBmKt6ayhxQzBKE/YNuIFY4IZECE7/IHJ8YOB4ZJPMc9JoMDgqSXL1A7Vr2ElOOx6hL6J+kIib1JFWcpzcSx6tPPQWHQeChXpWh4vXUFE/NeLi3NIBhXLu3aCpE6C4JFTFRCegLxFR53WRX5JB4t285F4ibo53c0wvCC5FWEIBTokHNbSBI88gC3gVL+n8AnZVVePUeVRTLkVzLRDB6xUmiSB4p4lX8I69565b3n7D9WeuWjq6eGjvnpldU5MxO50M+eOtzabQ0AZSoFQsxGNcgFU/ZwXYmEsl4zGRsyJQzqN2TmU5KYa6PuDsM0mbykIKAYAVoXm7zPQ+0/E6IBzwS6I/mRLjNjaexIZymWl5vAMrUcImZoMZ70CdjS9Q7uMCeTxZinABS6dSDIumVmVgzm78uun3pe0HZhRTaRpsqXepa7pHLFkDU7IjaV0LT+tNF6ZveEJXG5+qWJIUTObyWcPt9nJGMmYmcmABNyYIJmQas/NmrK1RMvYbwUglVzAG40Zgd7Zt0zEh7UrGsr50diaWsUUoLFzY1de341p6w7PaK83RKtcR0CUefl3+ici9eK1ZHbPmxsGQ3BlvtpDmIi8F4tvn4FO3N7szSjgMIpcIGxpP/Zbh0dyhsaRZ8Yo4ok4DL0XSML3GZ7Z2y7LvbL5x7aCn1YgPygA9a7qqz7uPN06UMrQr3fsbOVbKN++440gvBKJ3o4yl2Lc+zCnYt6IkR05X1DTwXAiFEkXxoKJ4qFuVsDxKWB5Q4KKEPcFgy2L95qddeIJfgH/v4P/gwpmZitLUlGgy40zaNa+itxj+1lqNNSg2odPqfsvmLAfhSX1QjgDqY07xt4+M1HfmhmYbdj5ybiG97Ks7mR4oNjRkrMTYA02JSMRK0h37gX5oaONx00xC/O03vD+WTFiJ5oZC/8aT9C2xyXhElbgdZwJUpiJParLyn/kz9EXs7gppJEmSJeuh65kyqJRJSh++6TghbnATWCKgSXAAMZPCC4dwSGqSW1sgkgeoKtF9KAxVzqWygSMLnDxvABt3k1isLir6Au7y4gwReXEL1qCF5W7/3XJlQVn6rxRcmbisTDdoR/8XFIrNlnKpAr++v6M9m2lJJROxaEM44Pd6dLfa6GqUJV4RFK/hZYK6yd/ExnRnksMR3smUbZk1bQTHsNRk2c0I6gttUOxk478NUk35CGWDFHCQcqkmXqr+EBoudvZxP1Tn4gPKdeVnr74Nbl/ecqoboPquysrkI6dOPHZfJg9H3vU+GMuNDcQWKhUIZytD6eoT9K6NH+zuXKp+IhF54o5rlu8dO7tF8fYNNuw5eKS1dfyMkRjJH8p65ze0DGWjBnZIAdv+btSTnaiM/KSFDJCDJFZpnOrvjaLG3shwCEwipiDTDJOM9a3Ld1BGUWwRhQnyC3zqLKB4QvnVB74sw5cSipoI4kuboUufzklMJ2U55CjIS6LYj0WfyOE5IuZkaTtFedfH9bPCsNvbFnyBrzT6Dd22WiN98vFyvBW4icXBG1xpLf3+e4OhmMsoeDpuuC7vyXfwKh/25ZaP9dSlswmX7uXUs9B3VqPyIU87Fwz6Lr78zu2yJoPYKOoCNcyYXD90xX97dCqmwOl4xqdks4pLjqq9lTrPYLJzRJmCfR6LSqF6XjQ9hkVFwyNRa+WrelcyrdWHEMepVsRXWlKEHTtQhFPffPXn3rApD/k9/aIRlFqfjO1P6SHD5NSQ6u+oa3Mhd0A89CrKmdlVPFRHuipFxgcVrFVki8gNKeurAh4V6DyH8oeHCdwAP82Ex1ix6PWahiMu4vXQycW5zjKgupeasGN5Uew35W149eGJG5985tfPPPV/w8z8hpW/G1iA+Q00MLDwKyhUg7R35cWn4dqVHw/Mw8J6GmQbJEJM/vFX43PVIfPaRXaTn2x+2sBB2augWCM8dwghpSCQAwZ4iEY92oKM4wZlJOUXXCBIAG4B9hG3rrsnidutTxHdrY/iwPZiGesuL4MnwtH/b4VU+lavJ0v/qQJwwEamp6d3T++endm+rX9dIZ9pZYjKi/orHsNxitq5E7UqA8JlVLJx7MVMD0doZ765dqB8+ZGAc4TR6RTjVU1RxqEkBsciFPt+Z5R1YOzu3iYvfHxZnt80e/jw1h3z0pu5WEM0BqIesYtw12mJHYDDWyfmpVM0Fo4mgDfCgfrol806jvfnqk9UH2pXJZWrM8AM8qrGB791L0x2+EUIGcf+7R0QnTkIN37nRtg/k0jD4PpQOmltZVknlt6Q17p4+mRM4PREQuRlvunkj082IcnlTTOh80LTSdrwyqPcLCLjS9ybQx2gIugxUQbUkTVkTaW1LhjwW6bX0N0aUmvkTljh4EdJMOwoM+zWi60t0UYmDMpCMSWVU9CcklJl9i26IVCUys1+RKUSiLEUJIveQpmBT7CvgfFP/NGxY/BF2P6eT7Tdc889Wz5RfZo+eeyP3lP9Q/iir1rWglq17PPBFzGBGS99/4tnrZGRav/3D54dXVxcLJz94vfvGbndOvj9LwarXw+4q1+TJOhwByAXcEOHJFW/5saHC7B3w749QYbIVkT+C+QQOYK84ypyHTlPbiG3kjvI3Ygkf588SB4hT5KnyUfJx8kL5HuV7/RkqUd8AryeP3zqrnfd/nu3vuOWOVX1fur5Tz795Icee+j9v3/fve+95+6L77zw9recu+7aa644/KaDu6Z2Tm5bn46baqOI0PeZjy5zulanUWAQVEVqo5oIPcWgQT1e0TOvSFQgXlXwLtQF7AZfWDSRrfktQdNNbZ7oLqJPusGFEgCJCu7rZBo5I7bO2Mc+tri4b9/HPv6xj3/kww8+cOe7rz975urTp44vLR5ZPLLv0L5DC3vn9+ye3bplbPPoppHh/r61XWVEh535jpwX/yKNQl0bWKIHGIB0fnVIxbF58JtMFcoo0YvOb6HUj6l+cMhhoLP2tQOWVIOT2N+hMxWXMBPCIDVCuZgSpeZ4oBkLAixBiuO3EfohHhA6y3F/wE51llMe6CxKtjeHMEYKFMv+QLkdJH851RwXAn4pUG5O+QWpsxzwpeIppCbtwAWgKPmwWKmfJovlFMJo/mpdO0V17SiY9cpfKRHlu2q9CfSoptPTLt1QT/iWqRVyfQePfM85ctpt8odd+sq3vvnCthe+qNor/wLL8hWHJQWu+4sjULxPCcFbaFz1um99JP6nSvPPPlGV6Qtfp7L6V4kPTR/bvYfye707Hz17PT11BH6iVB+5+tGnHqneMwaeQPvDb9sEoAlnpF89WW3fjX90vn6TfRro3pE2Cns1k74kCJrBPS/wbhNUl8tl6rz0SWq6BOElzrRN+hnOUr4k8tjsGiNenPSy6ZbkZ6hZ7fr85xV4nrq4L3InPntMgH89cUJZOcRxyUzPnU8k/sTz5Avi5z/JcX/W/NE9112xX4AvASjSgbvFJ6effutZ/s7Wk8L11wef/sgTytb7r6v79kWY4zR85T/jqtVnIXj9/VXv/fefO5f6ksApj1Qfz9KaveE27vuoCzykvZJBPMPxMEiAwkkcTSiG+XnCUcpkBUenCOXoqNdrWYaAfcrXxAnN5U4p0FxuYp97ueE7q/3V61KPGv8ARnJlTxN9v70yz7lWgnfd9dLEzMynHzlKVvH3EcQeEwjM6klnJecBlDHDApCN7ChH6AIPOAy4SdxwME1wZ0zX9Xo9VC7EBCHQhtqvs6mMujCOurDYnEIqhFpR9HstO7C4Ce7//OKm6timRfr0gURd9RehRDII39h05OVXvjJ65MiodfAfQ0lI1Fd/GkoAeY0PzGAduEkDex7C3p/QJXwWoMgWBcLMGAgXeZ6bxIpgCppjCrrJ1+RYL5pR/OP9A2yTL/lWlXRxVUlzxeqZ6q8KowDvAFdhNM709IZ5pqY3zE+ABu8Y7az+qnr1KN38RkXN2ubDtAfrycewAwFeUPHBEDsIPLIMTJ1EXY5NxM0TBtUmmP1oionpUZ/X5/OajmGFC3T6mzw0XsTxVWzqp52054P6+6p/U7fN+9gH3fdBPSY+QD9Y/aT3x8Z7vY/DRu/feu/xsnqR2Q9/NX0GK0DBuvGijmggzYgWL1TeHgCZyKgOJBSuAqBCdi0RyQYR8d28R6HU56bMDD5fZwV1v8CbKBUFHua94FJV14Rjbp0ycHSoo8lkKKTrqiqKyZZkSzrVnIjHmqKNkVBDqCFcj/oIZY/P1L261/CobtWtuURFVEyv1wgJwTZfJ1Z6p7cY9/twk/J3FgPYCMXOYrzM8i5LP3uq+o1nN/71qVOnstCCyWdx51KCPrPybXhb9Rtf/SrmXAdve/DUqQdXfrE7O8cyVhNEfs2+pTtsaQ2yx14ySfZBqmZWCgz3l4sxgXJe5JLr2loCLioSiRuur9HKyw4Lbzj8H144M1MrOC8KlMf25hEvSti+ElnCFuGowi1g7wWJMlgny/gsuJnGhpPHVu/ZR9iVAr9EeJHy4lEiAhXh6P/rUv4zt0YM5t87PzO9Y2L7+LYtY6OFfLLZyqhIkZqTqD5QGKaQ7nLMpIFUN8BIQB8gKUBglReSEuYAxHJCMh5jaa7sS6Yk1FtIHZBcMDMWEqd8I1xmJ6Q9gTJKwsjEyKilvOmtm2Iu86kv5daEJ7YO+v1UXbthaMsR3wdp6soTHXbfZBVH4uibLrRlNlVSg+mocBPdDoIYNDMDLXUc5Vr86WQ0apvC4GXWRvfNtwOntea3tomTcLI+XtA2nuvomM6nEYTQM1fPJW6ZfFuT921vaT0Pf799t7r3ak8yEhOr//aWgyCJdb5Iq6eIzBP1OU9FTrjcYlnjYh/mXuQMHMs+RDD12Ls8FS0SDgVtC4kIEda0+QSpWfAL/qJUbC4GysVA0R+AgJAS8MuO/RVYL1R/Rn9Y/SlUfzbxAnymev6F6k+epz96vvqzF14A7/PVn8DLTzzwkft7H0aGAQ/3lh5g2wfoxx744N133/ORB+CXH7n7gzVucApl4QixkRvsRsz0REWfAokrAJHo8DKIG2smkF7Gj0+s2qNlxx4tUY55XrBTHGASlGA3k1GEyhRFmaI4dFKZIQooyNXX/ceXU4kc/Z9cP1Ox9i1MbN+yeeOG/nU93dk1rXUJFfUC9h4G4VNJZkhDuJIv99FyCbsW60uiJAZsBtbzpXzJLgWw3zDrG2L7LI0hIhJrJjnRMcn1Ibrnys7pZUunSGMLfQLrpywDwT9eKtJ3cqq30jIS51wyz/t6S+FALshLQZfLHQm5jbAuibJOZV6URVWWPaaMbyu4/1jUQvGREcvT2lrobqrMAbQayVR0YnDA52lNJjUrZHrM8OBV93zovjNDSJxzybzt7nFFvVaIG4nWLQQ1K5vORK24S0Z4EaYSpwmmTqmlieJoSFZEKai7eN4FsixiX5NlWaUgfVALBY1sDiAYidkwXe5vcKmQaE1SiKUTQM1QYPDU7vsPV/je5Xt35+dGejMxU4iItu7Jr5myjYwua+n0wNACWfVRfJgGUC9ZjrYEFCrDzB9xkpmUQCQLAgClMIEboFM801mjcQZFfU2SUN8G/jhzMnVKcS9+UDwzKwkN7MrFHrZve+K225b3TXCb351OH3mkOg2PPXLt4VPMd3BJR3tIkDSRTKUF+SElJ3jmdT0hAHMsrPpAGsP1AdtnKiJBocF8IIDw9XKd7CskdRqBUjMzqFuYoM8xfVzTyn89tH+QjsyPQtfgwUH851wL6y/Xy9UdHUN0YHGADnVcSpDauPkoPp+KfMoiEdSRgYqVTsabgqbh5hQyyIhTGpivECU7Auw+CDjmPtxJlQhXItirsO8mBRSLzOwnSjZVPlz97xtcp146nX2pkP5m9TPrCrE+6P3cekh+wZYf+teBbho9tm/zVO9zp1xrErS6ofqLj+RzKFtgS6Kzv/qZb7XkvwF9K7u+AK3rO7s3/OsjsiucaNdOPde3c9N+UqvTp+kfcTtInPSRDaS7UpaBIxXAOh1WgB9kkokTCLOTUYRoOAx53hmGqxaKnrZiqivhoIxyKZlyEJDFBgnzHjIvdFJirghs3wDj0CjAdZ75SjkcbU5LBBAdSRwOKZr1c4ZWRdQO3PvdpvdmxM9uiRruhw0LbM8fq9Z5pRVJM9X1sO89kvp3WqsYac3Cz4oJbdrnzdCFY3ippa68l+df9MiGMhLTbLCNgGGDfnPLXzylalpQV13VXyAR1lo5X2MJerurw/um/7xmBz3CfRb7M/YY0kOGUf4sA6kEZyZ8Xp5TRzqoh9uUoZKHGzZAgKHNT+soAWeJ5jVk7RARZYpDbYlwqkflPCjCPIpHUpYIE1XMwuMlhuA1FpilRxXogttFZR1UTlb34e0U4lF+p2LrK7tZ4V7NWPrfUPpMJX761InjR69404H9+/bO756d3jU2umFgXW9P99pyMhGLNzWZiKyaC/GYhXq6kEzF/Jjw+bFPMheEDn4rIgSsOKpfJI5F5pEoZiGF7ZkP5H3xEjZtqpOh8Wa/iCdx65ABxmOpmMTGOjvS6Y8lmdeqM4+8lOlwG8bmphcmm2LRjRsH7raCysRG2w4l89lWm345OdiXWEzG0wU4srWULf36LKVnOZhIr43nwwaPZJvT/CX+Bm6vHJXbc7HqtzKVDGQGWoWu0/D9WAa2bwY4KYnBwNBBt2AFvLauWnau8XE92tsy18TZuXUezj2f3XIYQtX2ug6YLPp8+eoHOw4ct4OR7kziRez8R1ojVmDjEfqVTTQezUNuIAd5sjruP8z9Af0c0RAdd5JZsrkyMjOxdZinshvlE8dGkiRLJwg246qwwuHEnUC8LjDoLIqOY0mcJqIgju2cjDdsLsfMtrBPFRramC80y/WhrBJeSwUKjjKLOf4kyUIt1ZlHkGQxXBXL8inWGuyLxJ15FJi6Qu5uwyE9lk1o1IjmIyYcuGxneuv6wFR6IbUzODAGidLEaHY+OzrRFTsXs0cnj0zl20bmto51++JjnvC62XUTsztGu+d6GjxjT9jZNE3k04UY35oJvmFnwzwqI21+Q8dIxtaoHEqP3bG8sa0vZmH3U4OxrsTG5Ztm1uQrazPtlplthbWVjjUzBBx76QjK+DgpVTpRFFAfsBpk9YhAgCkfZhGcx14MTkAN44Y8jPmb46lmx1IKTY51g3W6PopvL2ElOSLeqaM4PAl3SovPXzN9/zKK7ZPvn/rAmSsHF0euHcH/3EQhbQi/hPc1x6759LHBUw8+9eCpwTef3DB67d3XjoaTpYz/Eld8URDpb/AZ28meyqwHtRvyGIpPqVIBhyCOUCSHEreEepEiX1uQQeQFcUJzKShLeUlgjBrlKiOSzLrOkbFEItGeaM+uybShivSyt4m7maGS2WlwjBX+vVcpNtnN/rg/XmQKtNPPxfZ/5Mod9xyvVI7fs+PBUyfW79+4PDi4vDG7NZ80+B/DjRL86Er2Bzuv/NhhwLMexZOPHu0fPHPxzGAomcuatyYSVy0v4/+lfl2zEarExJ6dJusrfV5sDY8bqXEYX5oFI3D8CRFYbxZWYxAoIC+liz5st+aYr85XF7CxxVRQmRr2MYUXRzBWKgsiU3tlu2ybgThVwELwxw6g4rAD9n/3qXcV/2X4ZlFFYVbfljkQoFdd/9bHfK8Eqj+kV3YlH9LXUFV9WTP5Cnxb/8qP/vuHFBO+cOLYk/dfd/7T3/1Ydf57cBo+W33hH/8CuiDx2P2Krms/upznuxBjI4JQBOxdBLELz0zyPJnHTsbRCXwDbprhmbFiwfR7makDfHHEj+0Q9/k74bfoPbx4Z/8u3RXYteHda+Guy8k9xMB+qj7Y+VT1H5+Bf/0tK3zteW7jTHweg/jJ2krJcokcdbQuL5B5kcUqASP3DpgiDEsx0j9KiIlCnxh+y+uVUFBDucnX5AF8ukboLPuaUhwzzNCrlaoZgint+HFpn/Yl+nK4+l75Vc4cqX66+gIV9lf//HxDw9b3lcuQOwTiK385O/s6F2F1xOInQkjrlsiBygKORRbHoVJJUg8Rt0unouAWmdLB8ej4ywn2g4VLXV6RqaRp0iTbStoM0SRtS7T+yKH5mYnt63q7Hftk/WR0h8/Cj+lhA7eQxN5tI0pAhQB91MZtLAulvN0cQ8jAbO6O2V3Ej8XCmhi6txHG2zVI3keTJfwUWJBcKguxpIh9Ci8RmfM7lTTYOaUow+027Zk4M0Gnlqc2n//4jfTcJ872RzJhGk3Hqn/Dp3qswaw33KqJMnI1/BNVrTVs5AZax9TRTKXgDmfU1w+5WhuM7FByHB7nhPOn89X88nmBw+RyB5CO5XMiB/M9k5NXTU727GY3OkdvvOCPRFojkUXkBC5W7mByXBxPDgbT4VaXqPLsT6bqv3uo+v7zHU754rkrnfIvpR0c91H+am4r6qAM2Ua2VEYxxXMav+AGToZV7IaNC4S5TlQQJQEbT1IUaZJIkjJNFEkZ2zo2OjJQWdeDGCAWbzbjic687kghx8rGLG44Ngup1XSWNUrAYggO5W2TI5ZomQWjMAlMU4j7nGijHmZNxiN4bWfe5nIhu3qNFQ5b8HZ/+Gr3ynec9L91PPziY/tBowl/GPAMsePhfaM37+/+WtjapIycfXzPO35QPsLOHFVHr318HveusMJwI+akMTPXHk6Fx+f3P7YfU+nwtvnuhVv+whfOte/50Jmt3J3XYF57bs/jZ0fg7jPhVdn2tNPH60mJTJDjZFNl6IpCA474A/t3z06Nbx4daEs2R+qZ1Qno+nUCh717WAIWciUyNoPyjjlDeObZXzq6sLcu1R6MpGRmCWT+oRST28kUi8wo9UMAuaid76dcQEqxTt4IEuulZWZ1dwI8SzarY7xATLZDOYCDoNBOy6yTSxFgkQC26IFUuYRDBLf9CJeYVs/bdOfMocT+rFJJtw9APqmFEtKk6G/p9h+aPSLtlPzdaWp/enL2UDKop/KD7a0VqX0e/nYg11KRc4eT4qRkdbf6vU/tfMpIhLS2Luhq00PNIl7Y2m29sHN2p9F8uF2sZNoH/21mMR7SUgUYbG/pU3L749JO0d/dYi3OQFpyzvd/eufMYvPhnIzPMtiVdoVWbmkfLKWMYBKPW+ley8DbeOP7s+IAHW0bEHKLzewA3v+FnTM7vc0hT2sXDK7KxH/hz3ASts02sqMybhEqIZ8QpN4E5YUm4Hh+mElBVDYSnFBBEqQTMghIVzgUREwboWrFzSXdunVs44Z4IhlvTsZbii7Wn5k/Hru0U/1O6EyZoSRmDkAlxcJnU8wyxYRPZx5hbr6UYghYYmjKlpyGaqdZKiGN+cd1W+GmPStb9t7U1ynNrS+2tT58cM99c7ASnN+4ZW3IKze3NbZCpiGYTSTS2Up8cB7mB8fLhebWhiy0NgYzZnPKyvax/IfqTg7uvlE8v2fd4YgdrMxC09QRmL1392OD412NlpxI9iSDiVwmbdHxgcGtUOqNJxqiSdtqzQZjYbrV4eT/wv2YLqIQLlQ6ZpLNhKcAw6hEJGDWO+TkWLd0EjeUTHOMO49l2ltS6eZMmyyEcZgHIhwztbJXF7CDcgxu+K1aPHFAlDqcOkk5YCQirkYgZUWGN0tMrnZEKGKUVAeDpfRPRcEMBX3PXLWjqTvTGo4aumXGcoNrivu7rpo+sKbR0y4bm35v4sIo5CaO93SMd+eiMTumF7esqdixbC6fjvF0f19bLiTqOj/i8bhb65PwRc4ybEOU8m/ffsyK5nOD2ebimu683XewOHNzMdGw02ftnL59e8/JyYIdK3WPDIw3niytCUYtQ0fM2aIofbNAtaBoBLlyvaYlyCoH/jB/Nf00i1dE7neysuQDiW9vpJq6ttCaCAkgsqFPBl0IYjTUfgiAGLg9wDHIc1IAXgZJ5aUFBXUigDjJtiLMYOWLsCWTCQYyPZnurlI+l13TkopFI+FAW7AtFjdjMa/BFJ/PQfKSA+pxj2F2/HIoF7hL+RyTn4FSmRNXd4GdFOCjuzYNnzh2bsfEuWMnhzdyu66//cadUzfe/p6R5V0bF45fP7nj+uMLG3sGFwonFxZuabxqx+TZ/bP9G5cHlucW3kyvXumOdu7Y0RmlLw339Ky8O9pMuzPbtmVWXgqGTFi3zoR/4yZ3Na/8Mhxe28tdqquvcDP0VUzppJWMVoZjSIdhWFIoyAKOwiWRp4gJTjK4LjOlg3nyJJFlFvkuC2OEtKSaouF62/Iabk0RGRPyqoK/zeeNex3lwVQGQircrUW3IYuMl9ZBqtMfR9Sbtz/33IvdWch2dc910Xc+m83Fs27xOYDnwBVM9sb2LsOvV75BW55oKZUmSqVqpfo5SPcMJBu84eqXv3fhkfpxMxQ14BySZ3yXw9wUt4NI+C5N2JZuCEMLrIPvcxnHdL6+DRpAJVeSozikZogbQaOEl+EzQ4jcx4I2UJF8hnSQBKsY3Ithf5ARB30bTuJRA9O/Id/GFLvB9/AYu14iw7UQsv+gdP6/XPr/rse+5Io4QhQPeBRYwgJRzIpLROSR4BxFyAq84PjKBGa/lbHUo0Q2QDaOEkMHQz9KdAl06SiRXCC5jmrg8uL/UeLBocJ5EBJ7VdU7SbxeddoNqle95MI4+dodEcgggcY7sxsf/a/fGIH1f3BfZuE+eNmb8qh3llCW/q9/x/8/K3RmZmZ9Cr4KfwKfhk/BB+EDcCUsw26YhV0wBTthArbAGOSgnayQV8ivyC/JB8gj5A/Ig+Qd5BZyDTlDriCHyV7kSWUETiY+mtWGcCcuspBUMSmVArYUYxFeARYxUyrkU8VUUiikaui8FuKK9I5Z4h2UXgPrfImFiZVYeLJol3GwZ2k7iAErngUsOOkYORjGlxxI5ehpnfpZ6BnqK8yvhZBFENSKDvhKWqicnGzUZh5wMpn3CPkli63UKbOzipYTh5Ysl+LMLdAINsNbooRKrOQ8GSICu+w8FJ7JyiuWELOVOguI1krJeNKPClASUQ5nRTEu2g5MyDrzK+yA5TgVgMV3Iji2bPaEhXyJ3QBvHxNTDp1hsXEozbHCnJqgjBeXsk44keNkYA8oieyxLCQ97BkjlNVkOzhvgoq3j2LJzuuXHVZd6iwx1wR7IYfpsNtwcVadyXISK4xV8GrxTv2XyhEBTqG24tQyJ4s6T7/AUcrzgkBVJDjMQfSXjatkh6dCq8/ty5mi7ZWpIGiCwosgm4YqarKlRGVe0/2GiHxJ4vDr6VVBsA2z0aC8hmRRZLxGV7FYTbUlpD+aaLjqIxCUvCoVRLyr7LLq6hoigqoHVEvtqLm6BY7nRE8mGghoFAxDVt0ZNhQ1k3EajlohzuV2tRcUahp8UETqQGVEO6oY2jBa59bALfAatolMdcVKtlafYr431MsUB9rfA68JPHs5yXYJ4kFRFHjmaxKwlmUqI+Hi8J1FXlBFWId815RDchj8JY/S7Vc10TIO+111aSscnYuvVYMaL5hYsEgFKad6NdAiZtgnIC7geDCpT4t3ubsS7mAQH821oT5Zh9QQVEPQVXx9V58sUQivsRORbn80STmfryuSlwVeFQVDj5qqrmGTgmbLssslRAr+plhLJITN4DMRGsuyrup0CVTgJHx5FTEC93O8lDWOSNkLArys6h7JkA0RG4+r73O5ErPrbaDBoTp/TNbxNeNZww4kTIEaNBwGmvCoqkBNv9fWsIQhRcDmaUxGvXLQBOoCw6WZELSogg8ms/ZVEWoqiJNYu3JUlIFT8El5hEZuEIUQQnZgER6UORbkmO6OewXK67Fw0uDmo2qXoGvehMdQuUSXpLjcyVaFtWM0EnQnBZlDkis0KEraL4fcSbehDni17ryu+k0RXlQMEPBex/A1eZGKVIlw6vVIllnXoR7KwVuBNaqMooEXsDNh9oqNkFI1eNOkrrSh8CrWMVJkw9QhJqlUliUtLyhhM4jNz6uW2WK6OJDkoCqJmifpFXjJxZky5YKRhMs60tDqE9yKZoRCrnTYE7fUbQ39xzsHgxp21sB0qjjQ39O0nAunLQ5M28Auh90fLDnbmBpKpKkvbHpUy9IksTUpm2ETK/KSf+1fuG/Rz7HI3AoOXIAhFgmGcBMpPDj2YkAIj9hrLOb1IlaqBXrEfaWks4njN8XYOtLHr8594oDc2Lj31CdOPYjfnfTlrv2xpiA8VJ2Crzc2r/yEWuz78Uxr+thr9uyan62P7CAHyHRlZwCYN5bAVmaRGiZu6j6hoKBAEuaSRY4nKuHVJUmgq5PsiKpp6iRRVW2aaKo2tn/v7K6JbWObNg4UmvGTLyYTjmEBuQazEbBpLGzCg4DCns2BTK5Op+uB/KVD/95ec+10MeCvHXOmrPkuxQR5a/YK+h3D/Wa3gT+6Xv1ZIjKa9BjJTQ0JV6NmuItuw9mW3IYW0WBTsuHdDUnQGl1m/EgkMTxWXHm8NDZWolPFMTjbrxuge/p1VLy3vjOSaGhIRN6paefZvvv864n1U5FEIvIjTTsYSMCVlwrA39fijJhN1UR2Kz9TZ1FC17SBV0LhX0Cx7HcIV8ArBJpRoBftAJ2/54avXwUnXzxzzX0feit1+6vfnhiYvfcUN/HKB0a02dvHt16Y0xf857btPO+lv/m3b/a3p4wFH4uiYrb0I5yO91oik5Xt0+PbertzzRLHH4r7sZeJdLgBheDQIPAbHTMu4QSOeSOEE8wdRkVsRRQcdJJgM08zu+7YsaP7FnZNpVPxlCUJgbZmnYsxzeKEzDJCwvx7qNH6gKnQMnJH1Gk82xUaoVRkar4c4UVHH/vLfbwd0BGjiEk2MU9CJcZcG5zuzRe6uwqZmKz2v3ilalBN2/foWiuNyjOX9VVOjg5EjQYPr6V92fpMPhbiUkNduViYub9RCyWjYTVY39Ibs3AX5Q8vcOFIrjSSBDuWCeTqkklJcYc5KezPDAxs/Yc1lYSh6oYgnr8DdFs/cxiFvhhKj6ypV81Ma92mGdQNAmeFM31pQ5ZDkWQ0IimDLbKQTlf6xpv1dDZXyFhxj6wMqmIiEjWpu20kk5B0CWUOnRjjxYAXJX5wNd5tFtsiSQaZ3fm3JvCxUXdpvggsVtZ1lToyXaVOEWsZUGU3IQ/yUB0YOWL1VC71gANN2CePmAsbxJk3HGfzhzg2jzhZ9mF3WpUA46o7V/11ULcp18jZ+kUNVaKimSLn37R57f6+tRG3iNKSZnaG1lxX2ZLvLKs0Kz2smdyNNGTAFt9IqLcP/r59wz+bHtcXPaahzfdVrm3yU7fdU5xMxfFlmw72jtyYtVFOlfjqX4qmmysaFuiuwByKBvLqCZ69+43kefIl8lXkFj8gf0N+TH5CfgpNld7nHqKq687rz546viSKyne/g+jxL2/cxRHpKwBk7/oAKuyv/kk8ysvCN0DT/+avdZVH5jj89H3UtXHz02nE6dPEpbpOEFVRTxBFVE54GBI8wVgLi0xjDBSZA8+C0RBi6zynH8WRrGn6ATZMEF0jSyU8lfkFornd2iTRNDfyJs29pb4y858qmte1o/+zsmcqiR/98Ad/9e1vfvELn3nhwQfefftVpw/un53euWNwoLd7TVtri98yvCxaoIQoF0cUouqsEPcguIzwCDEtFv5EpaQziwjRdx+iR8nxFrFAKt6xXpWbkyygt5Qv52tmxk424RNHn7hqu6HlQjmFiVTN0FXWOamc5dppks3xYKJZYgCTTUGiPeAPsEEq9QPz/7J6iKCsciwR+IDsMbhyQArYFhaSYuAbN2z6uq8zIEGxAaRiP9DHW8e6upIBXz6WDA1O+euiphnJZ1AtC1xQRByCMBBQ6YI14rMRTkEsAm6XNRnTuyo676r+0lQ0UCXw8CIOb4NyGi/r/G5EjKq8CHPu0HgoEkaREuSysbpIUFNlVakHO2RCjKo8thaDCXiJkB7qVOy0EVITomSamui+sDHstkxd13REBNRec/FQp6bS4AX7cAPCA0QmGzbG4u+u703/mFqRaAhRZcaM/XOR97lF9SqvGICfM6w8BqHkYKG1sTec8EYSsjW9cHiyhIQVhQhv8qpHCLpMTyzYqoAmKt4WtxSNuUCPFGBoSuX0Ps2rQ4+syZRBFlP1a6ZGbcWzOFtvmbzsUVRXsEU3FSqqppnw6AGb8uoZTpUdrwFF8UEh6MXhifBCEEJ6KxSLtmprITWitSpCJDd3vI5dHKXSyq/0oBENxqBOhD+WDtQ/LvMqq/wgMGfBXpfCc9X3ZiVuGTUA+38t5udL3A4ySjZWBuIgUB8DdcNhgEEcAwiehSWUayhzWd/nKWFeIRbDS14L4d042LO2wzE5ioLd5i2waYqsF+kcs5ZLuuABx5pYC0Av5x1XLvbVPr7sGIP8FpswJcaROLWOLhzvnr5n3spVFrqTo16PKuuGGTMlQQnWNZjda2LJHOQTjYVEyBDh2gMn7taxHd1KQyaoUaH3yHh3BEZvmyktLgxlaaKxvyXYZefSYU6c9nae3/fmRHf7OGRjzReGs+Fcd6U3tHDs9hN12VCI9+RByfR1O/VxhPseyrVF5qveOxOSEfrsKOXxbdnkHscbysElKc9TZ77zyMaB9b3dqWRGYDYv5y2TjCmzkRKIINdj9leEN3mpZqSO4ZiXHFLKKCsb1YwySzUHN7vOoblFh7DGmLuLeRGw2PcIGlIBeXF4y5s2j9ZnYyFb1wVoRGDclkfhgUd1HGbANbVoWaSAlEu8raGSjbvlBB9YyFrJgSziIK8YxVKgfgAxvaCmA0xJuOF2l+mKyVpM2vporLnRFYm1pkvZKG1vliPYg2jlZG+wImtY2ZROpVxWKEh1rqRqLkZE6hDW61FfwDJBYwOGiocTVAskkCQ11t3r+B4PIz6aXI3x2kzmyNHK4c7WFk5W1iIxEjdVKOUQgeqKjgJZVpj9XxZlSVwisgsJiCwusJmZr3u8NAZHXxO900z0js1Mbx/HrtjdVc7nLJN5IO2Az8OiLWwnrAKVasDO42+KzaYulJwJerUE9kPmuC4HLNuh0DEpxVZ6kJJsopAdYD0UmEB1ggY5x3Mf4egBRYndG1MUTuXrb67n1cci6Qj+f6e2uZjs9o0cip8Mt0ZoKBDRz6p88tCIb20acNjf/+37eK/18vhNz7/8/E3jq5svKHI8LiscFw5z+/3MdRmhYT9LJKM0lKlHYpHn7w/haAm3hgFP0p7i81YybEVlw9h2Ek5tNXU5yi0+d8sYP3n+My9+5vwkP3bLc6/F2HGotEwSJlbFW+d3KyInOoH5i14WviZgFTmzUjnmBncC2cCSsC68EUrP7P32wpbjpu/4y7e9+dD8++nMoVMX4eDDc6FiMXdx2/gF+pPqP138cfnMfYc/flX12H1nyj++CB7vmY/V/M4v8VfT32DbN5J20o9tv6cyux2wmZF8BFG65aIGYZYxFg7C45BiIc2EhTQjxqAqtrNCRFDEBUnAMSjLMOkkgAUlgzy2c8f41kIymSzit5P5gZq9Nf4geS0237qUwn0pftn+Kr9gq2Fc2pfir+83rzKN1+df15xIzpRObqOhFVwGmGrBZT5gqmudNP6+3/k1XG9McoGb5lY2zd001CPO9q/N1D16ZMfFCWnzwk54r2YYWvVNLhMMDdLOpvoXzuZn7MjPnOSXXv/dM3fTTXPrj4d9dv9scvEmmLg42dxoXktSWL+3YttOYNXVYvn9TjR/kxPPv4Z0kCJZS9aR9djUm8gWsp3sJDNkD9lH3kSOoiw7Ta4m15EbyNvIO8it5F3kLvJe8hD5OndVpfwSVKQXseL/8Anqkj8Mfev641TrFobXV9b19qztKhcLnR259jWZNie2X5HZjLKwNrj5aQ3B2yen2mkkKkQjh0iPwFd6DjGe5CF0fmvDlvqxus2BUf8m34h32ONxoqFNQ0LaoM+vB45AIwfz2Z2ZydYd6Ynk9sR4zN24pq0l1Rxv2iZHI43R+dwAFXZ1UCfmJr+BStOdVFQkcZ5USH9vpX9fYZAqM0UquxR5nvSSdX296xZKG6lrtkxVt0ud7xqi7m7NPUH65qBb6+teYBlubWr3Wqq5NTbjsQFf4fk3vILQgx3z/6B3qHzq0uOj/v4/7/lnZiq/eN+9d999xx233Xbhws03nz9/9uyZM8vLJ08eO3b48P798/Ozs1NTExNbt46ODg0NDEQioZBtmyabcPLZP37+kx/7yFMf+uAHHrz/3ofe99Dd7737vfe854677rjrznff9q7b3nX771249cKtF9958ztufsctbz//tvNvu+mtN77l7A1nbzh3/Znrzlx37TXLVy9ffdWVJ0+fPH3qzcdOHDtxfOnw0cNHj1yx/03737R46OCB+X3z+xb2zu6Z3TO3e2pmamZ618TOiZ2TO7Zu37p9fNvoltEtY5uHNg1tGhke2DiwcXBDpCnSFG2sTXyx6+y6YMD0m37L9/rkF8tv7GEToJq8whpgv1Bs8gf88eLvfBkcv+zL4hAu/wKe0/k/+ArOtvwfHA2wsDO/9O98mxn1CDCmkXKWsmBhoqm4xGAcZRbymENKWDRI2ZlRy+zf3Ex1W3Waa1oJwJvhzEpgjf/SX0LuUbxKt+zFrSl3y5lupWdDj9yNX2e78neVe9mn/97V7cp9/vWzl+Xc3FZ5rTB/9YGRRTg8vGlx8RE7lkhY0F/ygJksGpGoBZFsazSoBnytEvUi6ArKghENW9zEK795/vlmyq+88gj9/smTj1YqOyqVifXrdziJbb56U/aFfBL7miGfL2TWF0O+UIF9630h+rT1W3+fzlTemFHJWJUJp7Ad69fXEtbi7Ydh8V2L/5dli1TV6sPxoKiFDISffFAH7PdRnUMATjHzkl/2cf5qznRittrYPD4JaqYcti6WSBZqk8snL5tc3ukrFlnsleP6Z04WqxYPX0tcmsGW8l6yuDUVayn4wezZ6emzs/B9/MHkxxLBV6AuBongPwUT8AhucMfsn54+N8XP9/ZNT18/TecoWTGcc+jPnc3sLNswu4gzv+xJ3EyTvZW5XRUqsXA8BHQI65ZQsSuCqiysTpFfcCGgk2QiLRCRA3HyMnrB7MswRmHH9uGNfet61hY717Qlm4O2acgiTNNpjU0CCLDOKEqxLNPiARbYwBgt1Oa2srlELIK5jEy4fGltlVoQj5Nmy6gkkWcj32Wnl7jIu3Ysw7XT7VODle7uvqHxjqnjsDzTdSbnUgwe8XHXnXecG4X7T2+4anbr1qH97WtHR4pGt6IZoJ6ZifbGwoKs6U37i0duo1HqPnV8YtcyRPODI2MDhcjizunDrTFV1kCT9IZ878BVm0/fDbmtcwtjeRhcWxyxUd2rGdf0soXkVrU8yfTFI5Yhv2Eu4zrU3ouVAzuAKmz5szHgYQ6x8QaQBAGrWGGT91aXIGDUkTkcOcoje+MEpKxHiSiJJxEqUKIglGbLXjGzszRNJEEam5psjSUTifbm5jUsTBkKWY5FjKQKWDvMYVWzL4DjDEQpwHxiTCDEWFAJW94kwObXOItPMVKDcuEShGKWCLxEsunv2dF8a3iHbGsijAeTLr8a0kPRynwpOdKXACuTSWzv1MxsvCETsaJ6OHzLfMtoJfaVc9ObutvS42yxF2WNs9Oy7Y4jfSBnAMLZSFAXLSqrutKmqT5FT9Q15sJgxvpaYoWoLVma7MpEwAwFzViwMAJWurJt5twape/I7dtb2rpHLku/Pm/0DxBTTZApZmWd2rltY093TiLCeJLyZLK53muIIvDIWERBPIGDkggnZHjN3MfBpYBZIJuGByrlYmu6sSFou11kAiaU2syVgOWB1bgclJfSZUm2cehy6rJkrSKxFcqXJUtOrxWxoHJJKKckbhx7e2Ghkc9FQxmp8clGPhurb5Ubd3pdsWw0uKtnl+5uykbqpiN4AM+IPFlLyA27Xe6mXCw43bPbXZ14sudJ+INsU8nXtAf7ci5SN9ezGy/MRUK7I0ImHmpVGv4wImSbWAnT7EA0ONMz42Zn1M02cpmmurQS+XCUv6P76d5V38Ne7m+4HdjtfKSM2HNDpTK/s8Hi2fIDWwY3dK8RhEFJpFiNJ5lhDWSeiTa2VAkTbWSaiTsytnva211XRNFqKk5gE1uHhEWVCK+lAt7ahGHJ63hVS3bJz2KT7UCJLYXH4qtFyXFTIxvEirZXfcXMycr8sJdmrnjLJRv+dujgEIzsH4GAkzgwdC6RWbmzPQrB0BpfIZzX80kPRz0+vm/IZycj6Vjr8cGL7b2Jge62HIUQ0FymeyDRnb04qAf9HC8WkvRTzSXQ/EF4JjtAhzLtAwPt2QEYXIOJd8NyrhWSndVb3IohiSLlZc7Dg+7ppBzwKm9qxo61Dxzq95mhcOXj4vOVcMi0+g/dv3aHP2IwZvzWdDd0tVSvlz3h1XkvO5w1tpi/pzb38MqKz4WyAoaxp/lMttCNosLG2pSXGLe6dJvAAr+RswkHcBhQZ+Yx3cWM2ZvrK02/dRJb+u2N58xUPMFgsD5YH6rzer0Gi2EWmrxxhDPx5rIggfMFiQNJYfCGfm3l9hkuPrvySxOeMas3JeHO5uq318KutdeAOlz9dfVZeGEdaNX3waG6XXO7IDPxqe3w1o3V7w/CP1XvLcKhFZiZec239XdObHMYeU8vmavMdGGXyeNTdoIodwR0DmXgMApE5shaqk03OMrickDhmR7CvicuvDYrkZMkRwExqchJYz3dpbjlszIJn6nWAmeZZyQC4MzYCERYcAIqGUc81nQuC17G0ewYdHBEF50ZG2yGos2dHj85wY+eGalOTaz1eLrbEvHJNi3rMgfS3ePw9YO3HsT/yTuP/Eo8PjJ4WD//zUxR0h6AO//sburuGneurSa7J/iAd3IqYfKmEEuPwzeH2FWwf+TInR8ZOThV6fz5dD388PCdd9dk2ef5dvrPWDNr2MqD4XoWG59KNmON0GEWPMimYCyxSkTRxt6dKV8JwAkhhmkRUzAW9Pn9Pp/f58CKIptexybeMR9fp5+9LfPLRYAt+9C5uhJdoOwcKNPtsWzs4hcuPoub2z53EZa+++zFly5uWoqyZQA/PxCI0Uhd9fH9Fy4euOuOIO6EYHbvLXDLwlh09q4DFy8cuDsWfY9z0ur6AvQJ7NcRMsri6gVATTfM7HFshqJARYHNXWZGygVUepwzlYRF/PPc2MhQINWMg1RiHlWGFlIoBXy2WLOsoWCosX0mlpm5HduTBYowcJvldE6yWNCFY4JjIXv45H9eyTQ1xCIX6sBwcS6DSmowkbZjKblvtu/Pp++eTjRrCE60cLR0cChD06MLJxdG09AgiLYtJgpT167Hc6hvTR9YyczXqj93m6BrQ7ccWRyJ5Vt9wUylkscTQOasgIY6bujgsdViuirdLhvV2eD4wJnpPEzdcynW0VmPqGZjWV/piwIR6rwsWlZBCJXGcYu9H2kdYqslwhy6zvS/35o/ViwFksnaOmYsSm914YXOpnzp8v1A0+vu2NSqOxbeocrVX8mqKoMmq3D15XszlvHKzzwW2Drn9dgHaQ87sPJ5/P0uHGLp6vskFTT46Cs/1W08ycTfml36aWeNhBiLe3UzIIjvxOYMOTOtUJAJSFGZfckBMCwqWCBjzV5vi117hQALYELs4o0X+/gym7voR4bjtZgbk3oy2v589/7erAHz6UoypCFQord84hOilajPHLvJl2CYbaAJcmf0fL6SDXH8P16sfs8bjuoAq/LmaWedHQnrvI5cUVkMYjV6FVRhOgIxjmFd+aQOKlasys9rnItj9nbssPNuFkwiCRNsK0hTCot0HjUMWeaxXKPOqKutiyB7ZI9bc6m8xBY6dQIqPcxvhCStCb++MlsewV8GrxSX4sW4twy/2g7t27ffurL48Wvg+V98/JprvruOLvwC/6rTt8LzK89ecw29d+XLv7j2WnrzHzj1+xvuFvo57C9bKqPZTGsUH0esA16wTcrxLhZcXIM3tVUpas5kx+jtBGm/cR2xhG3HvbG0MwtYlGqmf7YYQJlFhjmbdYgVEZuUUUqsxmaXUBmXuFuai61TZx7b957rfcFz+3vmTB/qkP6JZKY5Uzf4mZPCkdFtxXUlf0+BHi+lAptuv/lghW6nW2CoxInu/QPUT+u2LrTuOCj4rc2HYa0WrSQurbf6CLcBMUeRDFcGW9jiU9hj6lDeYesEgLC1UBg8XsK+JPCcsMSsj2wNqt/uUolUczhSW3LDL8addc6yYqozwhaBdGLNmWnQA2xWC3O6JVMOEu7Mcxu6SomTc3Vrsp5Eb2mgkNfv1/MDQ23zA9tml79wJOqSEomo5o2GI4mrZuPwthPusbtnPXX1SqQyfvbOryxf+6V7jpfm35Z++PDRC3DV0ZkhCqJtdq/J5aErf/jMaizAb/geuofcTPKV9uUpHBrNtYl1POVPCG+YlEgW3/qWA/u2bulfl2lFzO6s+VYLrMMBYfsdeI8jRmJzFdiEeZ1zgCUKSJGFA7AJiIV+KHWWnaXgAuw3wuUZ0cJcx1HhRN05i75FKBLcBqgFubE1rmnZcWnQElvlIcBn3fvcgUbFoLrtp9vCLMjHtm/TEy6XNxNN6CDqKpuLo1qV9MRAztAFq7d7awxzlMB7JY3jFN4VkRUjErQNiaMqdQzDHK83yS7Z3XA426DpKotNwiGnygi37YTVVM9ixGSZe9AOczSXOG9G0lrEtMIGwKa8xNuGjiXJopZLhkVes5J1MmIGF3DBWFrTheDY/MUJRWM5bKUyUQt3e41YLmygFrWMbCQVSMiiT6CaijofRE41rEg0mA14VVuzsJvpwUKse4MoY4tQCpzMuqiD025Ffp9D4GGRBtJChrDPHa4cSnjwvHV5qnBjo72cS+GGN4NrkC0vy6amAGHTVGREYrImn2CzVxTKKUtEcVHFdZS4XMeJRqnjGaGovqlGkddt2zI4UOyM+xM+K4E4xpmGeGlqFiactdJYsCNXwy9vzEw5UxQDVqBGULLYTcqrU91RFaI2DdQmVrBYF5YzGG5PQDIbhvvDthGEkMcOvxWzEu1h2B/xezBHt8PvNu35++fAbZmekFknZYVb0+8/9vzS/qeugrmxgcYTk0k8PHf//Oz9C3R7IBxpC4eqK54QXotFBiHzO1k/5abunMq0UJReoA5dc+pBVvzITdWr11/VcajX2nrL/RfGYOuFmr58CvUli3VfR7aThcqebhw2m3t7UEhsAgl53ShIg5SpGAFYCADKDBaqywuEP6qwFcYBoYYMbAXtSdzwDCjy0lh/X6ZtZKhve//2Qmfbusy6xlgorbKJfGzyY23+qjNrrVysLQHf6QRysKnXlsNSsNo5RByFLHUgh1S2fUibHVlaq3BKk9I8B2ZfKDpaHm9tAZrSPbwmuGReCCeB8yUbi5KeOTp843xX1/yNt51fKMGGzNunD0/dd3KQVpbvmT629+/GegdO3YtYFfGSmY3E6yb6enNCPqlR0e0a47RWfOmWeKSeL1W/2TV308Wb5rppaeH8yJvnbmzr5rjB4w8++uCxEVrc/IMDV03du9xHiPRq9dWXuH+irzj8roG0kW3kILmG1FXsAXjDCnMbB2vLTTaXsiziIgJOZGxtAQ/U1w7oikA5S50VKGl51d+26hJlca5sjXNEaZLuTBWkXKQWccvWKUDR5QTL2mUnk+VhQaKzrKUN17jUVMblVpPZiiDqJqd4ZeNQ3blrM4Xlnr7SncL0HeNnH5aF2dsmrn//I+mJI3fcd8/yGN06PP/ZdKIOBZTg2nomX8e4mBQtJNIBHRvWjZLBlUu4g5QztNjA2Y6wLYQjOm9YQws5IySbxuAtN/uSXsPrS1rmTskQRMmUqVhcW/h/iHsT8DiqK1+87q21q6urq7urq1qtVqv3llpyS261WrIsy21ZlmRbFkYWimRsIYNtjDfAeGMxQ8A4bLEJAUIIw5IQkkcgQwLJkEAyDOMk85gkQxLGw4SEJGQZkjfDZCZO3oTYxTvnVmsxSSbzff/5vr+Xru1W1a27nHvW38nt2FE2jK3JzrEmxXd0zN2clxsdqTRJieGZ5dW7hqbXNGXOVyQgF8lVVVmRYFQneklP/UBC03h4ebqiwGt1C4bKisrx5X5DixrFreviXj4Yj1F/oRbr+wjwhXxNElxcLfo1GUjjKtUDax83wLN4N5EKMCe2KwrH6T6goV6X4WCLRCAbQH303PaIcxP+5x9xRPI7+J907u4Eoe5B5wNkqXOvs3qQXEl+4awiB4C+wbjYyf8C+CQR5tkqGBUz3JXcpdWtZZxtq1YkE41+pLoCwmaCUEJ5DuUQmRPkPR4Q3RQqKsxdjXH0KqwnkjwOGxmD6mVp5OIt56/fedmWKy++cmpy/cz5MwP9pfZia3PWDnkxKrncFSqSrIku4n6CYBS5tAyrMzpudzQSL3HPpNHsiRORRd2j1gAWLDHEaF2e2e3lECzrpBTndYq4RHzInaIpnQIvOZT9xp5j9GVYghRVbPnIYq+iea4qDEkqVaXWldMPuCd8HrHny3vH7u2RGptwVYIxYKedn95MB4f7lpJ/79x/8dGkc/TdhtvtW566YWTkhqdedDdk+sLxs3/f+fIHvd56I9iunCDfEGjQAFFcAjZb+Evnn8nL7ompHT1drY2yrImGpOZ6DzgfEvhIkF62Zc+Bkz3k2ulemyw91/R8pm3+PbjhKPTdZ/gwPwIzOsNlq6lG28OzuewCsrAJTTmm5Cp3L+kQkMxJsuQ6s5XQMx2Dvu2sJRMQs+B0nid4hqwTb/OHj2mq+H5CNgIjrB2z/LRBkpx/el7yasds/UukSbfep5HX1V/XBb1vkwc0xRP9mkc7+3+dT3qDdWQT9dUxu/I2fhE/xYW5JpD413BbuKZqdgujN8MEBjhj8c7lUtOpWJSRnzDzrANykUfVb1epC8X5PLI7GMaeZ36PyLuI6J7BzBnI2JSYvhOhcvkcI0c4Upg6Se7Eh3WVZkMWbPIXvBxuPB5SYDVKXECSSqxe30BiKz+shrzAh6iRkHLZ5T6dfF2YjoX98kX1MlVD9aT/fZZgODfzKxLfFv32FxO2qHnJfmIof5Hz+SKeQIA0j+uiP1w/Ju4b+pgcFKSK5fECbWjalvdKXuuGRsVaTEJ6rLA907JIjHwufliF2fyRFm9Mi6hWK7Q2WbskDJ1g+iNl4Iwef/gKyysVPALhVV/UXrIvRL2qdl0CcfRh7q6BuesBumHDSrmUew93EXeYO8rdzT1Gv1HNfPyRo9dfK1rh+0g9vJR4MIJ2oq83ERMlLlgpUJmTarD8V8ZINB69vBEKNlj1DSzgxiMKnj0hn5eHme65xK9AcU2Tt2XSST7Oha14eCZFrARpqLMaZrg6nYhCnYhguhwNEjrNBQMq5eQgN2MaVOPsiGZvwT0tMsVFtMi6WojREffFmTRNxsPxZHjPOVXwiYJvT4jA5PRd4iXn1oP7n6kExhtd6lbi9z/6Xd/a2MDX11n1f+JFfk0RZXiXbM8eyJFJLiJHMLxJ//+nsav7/tQ7ya7/6ZdOwZ/q4D333PPYPY89+tGHH/rIhz90710fuO3Wm248ct01V1+1D+20iIGzYWztmsFVK1csQX+FUntbc1Mm3dhQH0XYqkAwmE5l0WckjNbMTtTSgWxdLmU7OtPhjsBSGkiHmSvmMpIOA49WQhxVRCEDgbuj0w2h7UybqKZHLBx2CR1JmJ9RVwUKp9DrqwZZkPg9yALSIcP7kOTAioREib2qzDyVugLpztq7OzAoqauTxi2fpvmsL3WUzv6099NLux4plQJ+lZCSKJfjvxTVnkipVFcfV8XnO4gQjG71W2stv2GNmiolzpPt7eQDulJKbHcuvjRRkv1+uZS4lDy4PVmS9bPfWbKyW4mGjd78r40w3AW3ho3nOuKxOkXooKo/8MDBrPZJLVdXlxsvl50Xifkd20uDf/fdmC+c6tzbrDfGr3aO1zc2+tvkBtHMLV7SGo7Fwq0zreGGuN8v0roD+fyBvHP0pmqyCL3It6b6iAL7vNcrwD5d+YMPfaiwbknbB/NbimZDQ3jRlkX4gKLz88Z02NfwvR9pkX+Y9VfkY0CXkrgqBZFRAYofBXZmlQDCPXLtNWYzlg/y6Godgk4JFSnTQ1gMaRBlVughmcm3EvmBkm7LKPbxrR2JWF023bS5M7KsqZzojS9LJINqY1g+n/Q6B2SZ3J4/89g6Renrv38yf8mKsSU7FWVxfaCSVW8DWXwWQ1LjAlV9juMNhyhCyC/ANOSnFiY7mV4AGUjn8AuKsJpNVSemPBQV9nPWOiDKxItxGBzwoYhbKkr8OCfKCDUEfJMkyDMMckghiDk0vuH880ZHepcu6aqUC035HEy8YIuGLVJmQhyI8+V8OuWHFRskPWwKtOohx4Pyn43iCcLsma6LIuo18m6+mbKrBnVlmC5WFG4Km5arGOADiuRB32lRUa1k6oZUpCdYGsl2DkeJrul1FT1xfeO2nuGDA0OjxydWXdl4fcJX0Zu7Nd0sDLa3TuweSN2QVFvVRQVgfUHW9qjk5roRo06JxKLZsEr5GNHkUDzWfOPR1dZGy1eygjoJhusO379u0+dvSyDSNulr1tt99kZ72eF92zPJVGuMSKS7zVfywSd6PdSe5JgAzr9Je6BRw1wjyN5lkL4vrE62ESqVFxWaM+lEY9QKG14RuEdkUBVJQcO7hGBPHnTur+F0wY9nnPN4yKQqiyB6eshIpRPxNjoHK6sy6AkQj3jF+pYuIDFtzGQXbiRmqjPfVf7je20sYDwcslMItL3AzTudUiVB1wVJNSYiiH02GVPVmLYxoSgJdVOKSgg/rFR1LdM+eaMSiZZHRsqfFYTBYUEY3q0oux9TlMd2qsru11X19Z2quvOHqvrDHZq2g3C6/g63Xyd3qIK+f1xds30N00/cxd/HF7gAVw/zbRFX4ZZze6o7gRk0oX9hZAJdUwRZAeYcpGMP+gZ7MDTMgxAyGkEH8Bkv8zUe95K5iJPurrZiLBYKEq53adfy7uUdpWKlrdLa0pyPJWPJYH2oXlU4kDb8NYg/Bk3mGkJh6vJMqYjDLcSSFdh9pJYxJU5qYeZokmaDuJyjrfe98sIdqQemr//s7gnt5b0Hu3fca209OGnsXkP3f29y3707Nh43rvu0oxb6+iZ6e1sjCcyTwxdeuff4t9WJvc9cN3N/6o4Xznxzq3Xvju6D4wfJ3SM7jfX7Twbv2LTz7v2T9NMk2Av3TfQ+nCqm4N8cxhL9CdCoCJcCzqmDy1cziwvN9dFQEOPjvdyqDgbBzg0wxRzcEuEijDFFwbaNyPmQBCPAtuyQLbPATz4vm7JtgcQi4g8UCblbP6Gp9nLhrtHq7u5vDvQf/uI1/dFv9uyujrQW2nur19G+8kx31LHwt1S94XuwjZX6hOt+uXHjYKY182yCbFdzg2RgsKmXbE99MdN678AkKeRepUImHp25+AX42RrLve58E4/iGeHV2vfB3DlKb4MRooF8UMctq/ZICkWrEeXINKKh8XQMNpSf9IgUEZd8PsIhBL0v5Av6dYSgFwVOIpLq9jE6oqBJMJlKwi8Mc1LugCN+zIw7mnMFaXXONJE7yemYdebTTURwXqG3xc2/ffvsd//27bf/1orRXOltV6/zAMitCa6PW8dtQCvgGLSdAWPOi2GlQ5wb5aHKl3OqqNYASpnHhEfwzGV2QXBohnzEwLFrcCPnn7dmtZXNdi4KpbI5BjdixkGwxPUZnUdsJJGyZHfNqkJBPmREE8is3VHqRMsRuoKTRopLQMVF2YEuRJmCQBN0SfQtVVFjayr3N0UVOphKCVrUFITWiZxKE8HFjUYsExS0SOuXzVR3z/5RQpo2xoMWFV5S4+0zklHoTimCoueigZjXScXufEqg1wm33fvCvduj5t6mHB2k0ZwgCEcNk4eWV5pS++Nm6meDwnC5yRzTlYyha1LCeVYql4tFSaIKBlt2W0/cNocLyr/Ja1yMS1bjASZjuessj+OXcNCvXi5GYgL0pghic77IMx1/nNosZxFmDSCnda/zqF8tpKLHj6SG+4ohs7U6mD5y/Abn4+p5KlnvVyuV9dlrbyORQipsZpqi5I5f3+B8Rp2Lr8P3L+E6q6USvDtKmEM+wfUfVXT8XpHAwBTGYSMwjwGBG2kqNIbDYaa7LzM7HsJG8bogm7YHRLVaMoN315Z/JJKrlHqrvRlDTal6U/dAd6VUMOllZIAMXDaE9Y2rf/BTqFgcKEQ0IdKeCPp8/lwhTqV4Zk3L5sucvyXdl22+Fr/nD3+qa8dja9JBpg1uRS+JFEITDGHGSR44HYbLRUVhRnZpqjxPU60w4QpN2Uy0LtxgNXhVziQmyz1ZivMmhvTxZdRcVFz1bheMPBvttOhIohNyetPjV0w0NU1c8fizszubNt1447M33rhJ6SkI/Zuq1aKuGPRgac36vljv2JpSac1Yb6xv/ZqSE7z+s9fDv1OKpuqtfX0b+4rtc1jwb9K/AdlxGddXXVrG/JA5LyrAa5iyAoLLockZvwKldDqJtqURwi3tyaQa6oMGZxObKaFSLF9WI0xmDCms2WUJcTWqKH8zONJcJcfi5jG6iSHakAQsCaf3fXU/Wb+63e+LXrAqksil4JgefpHccOxnt+QLez9Yn+EVHfGbeU3wmbJpyP7JreTYz4jxs2P0utGjI337mmOdHcVMb5gXR4/ed3TUeWPLozPClpwiaB5CFYH3i7qlwIpWKN01DpdmHkXbzK+gzy6n45yPk55WeLKoJQRDzrZgyOVRObKc7CP7rWg06sCvsz8ajdAe5wGyNRqFw8OWRW6JWhF8zul3Pkpe52PsOR58Dqoc8BHu08hJeIblHI5EyC3scfeb8IQouS0C/9nD7mBz+J1fwXO+X3uOV4TnwBSAetiEVSnnI9ud+/FR5JZIBCoQjZpYQ3yWczAagf9Riz3nNHzXbvguDZ4jY32yHiKx2qBBic84dzjHo+0Rcgc86o5IJHojPtgqRskxeNI10YjFxsarvEZ/yWGmGrtqCoRbVRf2yYILpxsMEOx0TJAlE7kLeCbShZQ0ncc4Ocum30zEzzivv1UiqTMVZ2OElqyiplvBWDCi0U8mqoZxxvlh+ZckcUY72x1pLVlRGllvBCORmq38mzAu3+IUmGMl7uLqRZwocbAW74GLEsfv4oiiKkTdw6leRfXuAjIiiYLEsHJlns5oROYUIivTnNfj8Y5zXi/CrHk9I43xtkUthWw6mYiXGkupcCqQRjtLPZCeipurMS9hligG8mOZs0ifYkc4zYZxzhX7MOC2Qsanj07Dv316+eGDTd8++uhhwwiWgqOHt95H18OZl489ejAYNErBsf1b77M0Mj2wadOx6enrew9f98B+KGgYY9c9APsHgyUjGBy7frqXrdvvvP3O/fyv+CjXwnVxE9w011CNTk1WlwsLxaaGGAjHBo8aVJ2YGKYkoTYPhdYS6spwp6tkl1zcbdsCwQH6Bjrfz0Y2zMAs86tCaLM+knOxNqCsxUA9UBXfZbNHfkSRaMAvGNqg10cTglSIwwk9Zx0rXxPVzMOJ9a0pQVFHdKHQ85/k/qDZbhnOxYoyrNGSkSjt6G4dGxiI6FTSbtA0QUvpQq4nJzVRIXjmk87Ib8xg0SJvKzHL7wOOeETTaESQYu2SHjc2wvpWjnT3FGGZG1SE9kjJyVhGQQ+SVxWtT3lhR99kVGsdHR2M9Axb3d1SUNIG1FKsqU/rEVR6duA/J/7DNIrBGr9xFPgN9M8tcMurvQ1EIIMgKmAyRcQ8xximacRSBGo3g15shBvHuDsW5s+RkWApVMqgv64HWIqO2YGSnd0hkgVskJlOppYRPt1ZXkpKwCkFTPne3rGenrFectrdOl/OCAVaMs/uM3dfbD5g0heCTb14qeBuiKVGR0xzhJxeb5oTzluWsHBdL8J4aK7mciBtoX53Pskdc2Jkgczc9rQdWmYjZGbWRDnRTT2K6WiKIov4x6RALCWQJYc7ErbFvzlEVEFEGBDCA8/SNzHRdcRMeJwfe72kwRuL0CPk+Mb4jzY/JAQNQdVgseJzjd0bq+3xoHRCt7wkDqss/Jj+Ez9aO8cDdMLa2IMZSHMIHptkKbcMwq9iZm46lzG1u6u10BDLCGLYVfamZ6tnoVnatEUTjQJMvcJYtvw5hWwohZrebZYs+1W3xoHW73u9/EwwGlO8openOolsyBy8MKxIUOINKBE37PDPLpv+Td5W+dnKB0J2/nVvzPurxPjgoGGpRPD/YFNTq3zHwjIe1f6gf/fMfH+0wdoPM/MPaNoLDR0m07QzzgW1UildDJu2iQB2wNpQFjRcSSL0ugVTkn/TC7WPWUe6Jib6ulMmWkYDkqBI/FB8Izl+xIphX5B/ZZ9g6SekYLy9urG7MScEJVjPRd3kH9p8+dofQX9QDxRx47ku51/n17E4oxiM+iLzH1kEK3drBFFWonW2IPLoAlNzFBF5IiI0riDxyLmAVCmNwUZCzlriRhoaGgoNhXDWDma7EGmRWKafLPBTt5NIFz0kj5mJxACLhmQusckAQZfXr0YiX4hbZzdZcZIIk1e+EOmLOLeToSucZ8PCJAl/wpzIPmSZH3f+lr6wct9K+pBdtb/gtIShtEk/Hk6QL0QiZ4+S4SucL7ROCN8g3Q+bUfJQ85j5ibMv0lG4w+VlkvwB/iMw9lYhV9bR2pQEPqy3szECQs7ysE8SEEiyQMRVnEjFy3mGJSnMklQft3plf0/34rZsOhatk9CLxwqGTepme+3qzNHOcnA5wdB+pmlZTnL5uR0JxD5JTiGaAuygCgGk3gDmebXJV54//d0nEk0p8sR3f/O8p3zkQf5jitcwfCe9qSvZzrVbPvbozDU+w/DK+1Lek2znY8IDRxIFEELuTzvf/atnnJ8Uq+F4PFwtktgzf0VyaXJme8upmx9V4vrJdSv2KSnvtbekUrdcqyWIsm/FupN6XHn02CutdMaK05TJaOAXBIt+EdomA9x5vFpfDFAUEFzTIkuS2VluyttBAROFyPOEopH1NGYI5BmoBEFwA7S6AD8Bn4nuJq7PCWYZM8lkTNQl5wz6XYuGEJOk116TyMDLVJdSikS+RTU5LStkN5TQpZgovvaaKMZgF0qvgkMiirgvwSVD+N5rkk5Hz7bJCu/hNYW+DA9Qqe6ccH7n3vTa96A0vMI5IxruvHyGN3iFq6Cky1FREinD8xIRz4swn8kZoPYilcUZjkkhHAohKCqP5OxcNhQOp9B1MmvWiEwfLpgu0UxJOFNZLjo4Ao7AbGSX2kjNdx6msbGxurbbGV1+3VNVMiamDNF5snX/GCmQz6SLGWCMnOf0kGHpP5UyuvTTdHXR4jQZ6F63YrKLfLb61DVkufNp0UiJZEPL+IEW57xMe7oIBXQr5f+JBOd/mlpcrMIzKrM4nfQmHtHhGrlCNS8iknItaxLd+26E7nQoWwkxhO5QkrmF2uLCqdvBXCphQShZT5OG8YPjhLycsM7+HAThhBW4++v30iDsfnz30nG6ftkjzpfdOdxvJcju7XffvX13vIaZ8wjIflmuvbpImM0ID8waQWYN5L4F2DkcQueEsp3psJu9AFVHLhINVI1Vwz6HsqAPC4h7lp7RrbHDY6STVaxWP3LorpfvpIETzHfxBKvi7rh9TiUvvYveO+uXehPDny5yvdUlMqtlTcyRgavB9DozHpEySQe3IOswMKORRa2hjoCZ6giHGTA8YcBoGIpaqogIo8Oz4O88n2YhKx0BBgCRZCquQMkimmqo8I8csvR/ayCqRPy05UdQ4cmuhgIt1pNtDYVCQ9ckueJt9LTEny/pFnH+A2aKn/hN/6q9JF7oKZDW7lbivLG31v/8XfQrnMEt5orVlmIuGwn7dZ9CeA2bfkggc+sSm9yFpnQKWBJM38XIdhpanyWq9hCri4lmeRQQmA2VzfrOMoMDb8Cpzwct/dSJU1BjsgL+XpcSZZhDzvXO9bJPTAONJR8ItoduUZVdinqNRJqcX0PRU6cshKpQnP8kmWbMENLvfBmKNku6SEb9/it347f+eLtg1Pj9L/L38athrVrKbeIeq0Z7iEd8zxDlhJCXEpkfmmihnkGJynTQNRpWYMViyXCJDB23DZg7XlR4DEPmZA96FnMyEeQtHJUkhqOD3ghUGqmvduONPCamhTthDOz57946VdWnJm071mRHohGTJQgoQ3sx3/JG5q2MSiVGGNDETNhFf+1EVx6zNaASnoHdVQhzRkT62ZWfpaMusZVttuUXGfuNomFBf9KEpei6YIWMq/yLjDHDOeS/ymiFHWO/vxiweVWI2x5d9gIfHiSn28eK7yteVVy8uP19bfvb2sbajrXNHX3K9u83gkCpJD9UWlAFK1D07/f7zzfIQ5ZxleEf87fCQ+GZuu6BqSNAu3i8Aed4f9v5be1Xtb2vffFieMyx4lixbX/xFvfIzVVWi8XxcjasMMu4C7iLub3cNdxd1RM7id+zlWjK6iVUVItAmUIayGhBHwWBbojzexSPX9nD6ZpX070YDQXsDw+UAwYlJ6HiXtE8ygxmEdYxi7CXU0VMHgy8OmHY5zJFT3gOU5/NYJq8SfQ9Hjl8aN+Ve3Zfun3moo2TY+c32nYmE7bCQQN6rQvZYtbclmmzxT3PCGB+FgEVx7042z/5LmZQrEBvMrsUQRhpt1fl3IJ+E2fvZnF6cxnigZYteN2vT0i6VzoOP1OqAeKrrl2vKp/FiQA/9EXWdV/UtGP3+Yt+6N4Pq6b3+TbnEzff53Y3HGvPuV36RY3sUZWn8Vb4cV52KcyP4fmqeELUve8/IXp16bio6g2zhdQDCpZR17POfE4LqR/Gnm/133+zV3u+nYypH3YHwIePadpz7TdjJz+n9eNNUFXSNFtPdRN7Nv7M5xO8k+VvUTEjESLn17zJmH7vcpGgm/8Yqvz4CZRc1siyrMpqKBCARQn4ZBZ7QsRwspO/81+ch/+FPOBs5bvJv5MtzkPO1gMHDzKVG8tPgbqqOuBgVnPV6rL6IIEOD3GULPRNqiWvEuFIpNO/5z6/bFFdodl1n2c53mk+7eL2ADE0rS70m++EfpUwoQ7z+IsLbo4Pht24IAMwutTzjwTD90zFMr31NNqXapi8NxzUJL4iq6hcF6QzL8Hehl37hUQwEdGoNxo34+L+3fHyUDl75qUM0IgsX8mWveQJ07hqTSQap9G4teYqw3TGZQ2YnTFdF0XKa9L0ivFNfEw34aSlxemm8chY59lHsmVSydCLsuVyTU58CeZgFTgCkEuCflXgRRZ5gcIhM2E0mDaztcLYDqGjI0axsYz2ISaRZLtwJIvwUf6X2rWw9ru3NUsj7X+nN5LI9d6EdoREEuTnmv8rzs81r0Hko0flICL72F/xa2GxybFtp0lk48Gth4drRptKrM7UfcySwhPt3AplM7YVZFoM0oVWElvuskNu7ZCH/oO1o9c+/n92XvYvn2r+znccqKet/uF6ph5L/cM/pB77P5dfTj7rVjn2Ryo8G0tIXwL+JczF0WIN3AoKCG4kFRXmBeyQHQjYJTZ8ZhEo+nh0JCjFed5NmhAn9KXBxU5m8aAaKfQtWv3SmkJ/LqacuO6Za4Qbnzi6qndysrd9fKK3iQwP5/rGJ8gLk9df/9QN9LpZPOzDUA+F5RI4VN3fmqWqnGjE0KhSCAPOhhj0OrOP6IRTfSrn28N5fdTnpXtgeHA+r+qbkQgsyryCWVsUQWAg0MKkhwiKMEK4dWvXDK8aWLG80rEYHS1SsXobKKPqEQXE6mD2PBY6RSURQdfDSNnmeLRaSqmuDjevFHDFCMgRnm0L0Ub7ScnF1MFwU3Lr1PX0ms8flo6SvzmJg1o5qUnAJ3wFw0mkrwDPADvOtkLDidwSJ7JyTNCC8VxP0uttHd863ur1rm4/0lAg06yBnrlm9e/f6z7U+auGVnJzbHRlvLu/0p2KUjUFf9RKoWEeZ3xfrV1HMVp0NeHkTH2Qp0qJSGh1wr4GEiULl3sIQoypCMzsJg4CSVGC7pek7YQbHhxYiU0Hq0AybBp+t9G8CxvNtmqLh/wuCQljQd01XpRxAVnYaOiLAk2GKnR7vs2ocLsojoh+8fbb4WdExO05x85F28Lhotd3TtNNPDvh9foNv07Ccy33udtEY/4Bhnjb7fCz1j1eC7u3bzN7w0W6oAEHBlTBHzHjYfQRfeednUIb0PgAVwIObYCb4C7iLq/uPk+nmDw2QDxez+WcV/FebhBsMT+LasCQWwyn2aOplEgcYajRHENXFvbqbrIAnSUL8KGFaGR688apifGx9WvXrB5a2b+8r2dJXdis60qHkkYQ2W42BLvKHSXMEdglhc1adgzMDoihyy4acSku2MQ1m5QwtwNLaMLY9BzDW0O7BLFL+bkiazf2rF1UJauEQn8yl+XpTWMrncjAeiJoRgLaU8oUh9cP1jUbSqo7lzB0cvarmFUExKRba21LVvYV1y7ZuIjPZpMDTcKqodr1aX6gtfUrVpT4wsaoc2H/6Gg/tG53OWdFYlFqGVGVWrlyd3+MnnAzlTj/Ntvx32kpkgF+xagR9kUipHaZYwlz+Y/T+4BOAY33u37bNQ2Oqxg2bdOl8bUU4LWB5zIp/McNJwG8hPMLv38Eto+SvfA7YlDLggt+P7HYofFxcrlhjPjZmvJv9BV6DHi6eLU+VWfIAlJwmBCzJNyMmUzZlf1TYx6VCPQV97WPuq+BrTF/7Pc/+qj/Cgt3Pv5x/+8XBJ4ICtRkzSDLU9VczbkhT/D1V4jugBLZgKJsQKU7sumO9KyQmU/XqFhX50IqxrIeodTJBxPWmwlrFzC+bzLZ8s24vQt28OAv8ezPmVD589pZK4HFa30SJP+KuFnV8Lu9WTs7mGsRvj5Ze2nSfdXZjewl9LHZx7vPTeB6NOenFOZSKFEzU+IQMFPwrQtyPcGiMD6fLyls26bJ8iXVRI/8AvmDVOyFKVu/oXZ4Y96fXA8/Har6khr3kjb1joU+T88aasnr/fH1Xm9JbYQSKhRYu9APaq6OGZBBoY7xsMYLLKET5mehIgJfIATyOGwocl9UgCrCeKljyycy1JV3V1SeFZ9cprtrYZXfq27bpqodahy23jhWDrZQuThs4WSH+uqC6v9Qx6sN3tlSsHvu8fsXZoGd/5Y0146RmUCPQKYTeDqEOgJUYuxh0GY80C4ZOkAmICZKElOyoHgoSCPhcDqTTWfM2eBb1H9iFh5JxoSbIGjgMmlaLBdjJ/4s/LZPWPoJSx8CsfkESP6mf/7gswv7pGcYrtZUHaZ/4UHHOUlt57/HDxI101Jz/Dkjh24PhzszTEtdS9/Napj8/Xo5G1iNyJN/qC5uJc55u6ubWgJ8OmZz3PU5jhGptU/5QWjH2Up5YRtLaMl4dIQsnHn3nKmv5t2CdM+fKDlV9eTNlniOKZKy84okxpqEEA5TX6BeQg6eZZORZKajZZDysG6QW3XlmAdE3mMe7TNGJBcN23E4ULQ1hWSsnMpEzCZgt+QLFSpMPb5o43DxHihI2D1EI6vi5VQiqPrafapBLE+0OBYyEqUUMfSSRxiUDOXuVM8Eyi/zfdIFK+hwdVUz4mcTV3pB1FoBXSRc/A+Zo4JMWZgjYUHAksS+GwcbgcEWbwlZuVyaqSsXQKUxFOZykaCbSyNhvoFzvlnYwXgdtfLAsy7oZnKaqW7Yz4m+TYtvGfL41giSR4xnuwtWfbqXsEuRYEyNm9o/LhgFY7O3qeTPFo8XD/m8XYKcq48Hw1HN35814UIw5TWkaKxpbMEYmW+LOFeEUbK6OtiUAM5JRwzSCFANBLpWOFFSxBkQKzFp9gx6/NSCxjGgi5uL5wpDQ+QCuXQarXNuYwQWtkg4Pd82/LvaSjwnjbUqV2rieGcn08TJ6tB8y5BtCz98Ck7E8QrsPM1+VXJmqnZC/eG5OabZnCDba9+7vNoLgowUDQLlVjCNN/o8cSKPgfG1XK+Ci6shkPl1JJfOJa0OjN1l4zw5t4LNrWWoN8VlbMGAx7WNbDMN58eMTqTTbIOavLTfGgbCgcHcQEO2DrEL+HvK3cDE/yuLHtjFdnexaO/Z72ivxbC3VpvrAgbPXAz/aMxxZy7HyMzvTU5MQ4tV5928gyQ+X5ugQdgBSISW72nduv8Iq8URJDW0bwFBsrjZeTXFfHpj0LoD1RVNcSoKVlhn4AnoloMhgTM1jcDvAaMSrrWQTkYjQUOWOAT9cR1y5ryBQ7UxI9eodz5UzjOodCkcckcReXL/V/fNDo6/VmUcLJqMwokqicq1iiipqudSReW9tTEBP2eHd+Jg2YlFv0Y2yrwo8rLzmIThXa5fCvkB+SXzA5EIWdSC9k5YI1nIDrBz96AXyUkrejIajUQfJ6fQh+QFy3ohakUiD7j+H8Sq+bUwfxTMaNHGDP/4nDPoQ/JCJPICPuaBZ9B/5MVI9EV8yhNz7w/X7md+KMjQ4ZuZA0HO9+CDC57wzONPsCdEIy8u8D8h3yPoOyI9LWL9uyR8N9wPteiLtkdORq2Tkfbo4z+zitEvR+Ff0XqQyWlv0P+k32UR+xGuu9qJow4mBc4MUeIxnpPleVKQIE7IAiaTWBMwQBKLBCLBYCAYNDywFAQSXCBtcMlwiQuny7m07VrqyxXSQ7580LnF+c13SengW5/cVxwY2DQwQL/r9DtfJSo5eND55quPvfXZ/ul++OdiZNGv0IdZ5h7lc2hmoYtaPDS/iNCvOK3klUHnX0mIPux82fnyzV/6Um2OwKA03n1P1kNsHyG95BWndZCEnH+NkX7SP39PDRtC4XYiwu+2qZEVwOwtBbmJKzfVGwKPRAJD/FG7NscEzkPc0u2bLtxw/urhlkIqEQrKyHLOBg5nayHiiALFUKrRSlkLAuvMoxEzhdovFmPFXM7zzHDLspq4mFuNLMkJm6bMM7/C4HpYuASLSJ/L6UhiirxD9YaaJNG/3ifL6+qiHlkwrlM0o94+TzKkQUsQlSbVr2yXFaKKOxTdzrpllXWRqEfhA9eBOO+P2eeJfnnYFASPW1idzeV4GK8b8XB9SdKl8Hoi9vqUkZihypd6tF5RqsZhDdFK/li9H2YgK1sXTSySNdlcv6Cod6korozVikYNotV0BC5OPOVsrhWpG8XoNJb4gXLoKj/zbsNaXbTONpi7RVImLFqt1pSVWhvJZTxmDAcLHnYDTjaRxR8m2xe3n7/hxQ3nty1e3MZ22hcP5XMrVj6wckUuP7cz+D160xa8dk7pLaMLCuXhz4qVzA/8Jv5NfgnwsHnEoeM6uF7ulurNSSIjR+6ziQdDLBVhyCBcAFhtTp5G32BohekQ0Tm/T/fPBInPixYwH5lWMeuFR6GeaU7heWWMUxQUNBRMzNrenskQbkl3ubezt72jvaO0mCXQLTQ3ZfKZfC7bEKuvCwW8qkfm0iRtIkWdAyqZXY8RsgRtfsCBwl4ngkJh6GqyM5lPd3ZkO5Ph7Kx/OH/qzDLF61XIDbtlr1cmTyLp3Ef2w6b+zMX0Aedq8r6jN9989k3+Qafb4/MFfT5+iaqc3a2o+1UYPnDPdtj1yvRuRc04zeQfz9y1Irs/s3//iAZlg9j/4ju/eefr/M/pv3NVbgQWr6u467kD1X3XbhtebIiy1E9U+cD2Id6j7iOa5yri1cSha4BiDOLIQfwGReQxDhaoFBWRT5VAAEdzM7SBirYlzetB84UgMHc0lIe8wsgVezdfeMH4eaPhpkxjWzZjBljIvztgZNRYsB3k52AKd5PFzEWrhvG2HE+wPO95Nj3tjlpegrKIiepAqmJQRvPWB5mvIR0VCUuMiayxjY+Cg648egnlu+JE4n8s+cV4nWlpdaQhEIslc9nNnUuvaKGfWmKFE2Uzc1Gl54rWT/HdVjheaqyHJbuOxoz6aCIjOneNhczGSObq3KZN69+npm1tWEva3tW5i8vFDXFzUX1+8YNXq17NVhv8ybD36ujVGcs7VqhP0v8jinEfwjbgSDXS6Ww7vm/N6jvLoWyureUJ2r16+ES5QVcJEWES6kZaNI6Nea3M1clMo/MLzU6rw5qd8DkfyBWSjeaiIzfAm7zua+B1+KZIPBwaazl0DZOPMD/HaZjrTdw6ROVYVkkH0NSLwDUocOwBBmYvh47l40gaJlF+GlkzvLTHCifRXYm46fFQcnW7qpZmlDC/O5QzULrFOAgZk1JJbiGZoGevzKipbTH8Q/QylPiTmep7fnEVT1t6vHJvMuqR6CdEzSc/duGX1u9c2xSEmpnXimR1w01HJZHaicDQtpGpdUvJpOj1i87H+HDj8j5Zo227Xh9dXJdJ8MXM9Xt48b0e6lm7bWS8q/kTot8rfkIpN3eONIUFVewapMKB55x/Xsv75KWpwFBHvi4sw9OglPOxDesPbsAo7ju2XV2XfdTFv9gntPGrGS51PXcN93nu37kHqh9+65+ooO/cTEXl5eevgNX5y088fGBsZFW6wUO4px+sQiv2LKISvecG6uXloX9+jeqrbiTeAZUoHtGjiHvQZEcleQ+nc4JHx6AUhfOMcyLK3ijyANNPxxE8EaHIYP33ehnX5p3kvLx35Kc//tpXH//k7bft2b314o1T5VJLIWSaC9IZM8ohMmcH3GOIGaiYls9dDf/gYtg5vxYiu/on10KGLOMuhSw+ULZcR7U2VMFhihY3LXwtahAxIhCjBdj1LkzrwB6A9QksvDeXZ/f+N28lp2sqxyfRR6DQ00pq21cV4T2SFmoUBG3AEKthS5IF3w5J9YXsfsEnrRfEjOKTLxAVRZyQvW45VZKqoYgk81iQQMkVok88X4gEFJ90AbBd2zdIaowOEDHc4NW8citPBvgGVd6wQVYb+LJBhIISCMRsga6kMQ+crpUuKKy08F8Wnl3nf9zQSpsaGwoFOgU/SwuFb1wKddFDdn1W0oRAv1DySr31PgUqpJUEYa1fFJVWLWL5CHAg4lxJ0YCSqtIbZSW9i7GkIMXDvvqQRhXn70c9il9frlPaVJ8lxFsmTZTCsV/xjHo8hg+vxD1lGIRNNsnjJZ/hoR1wzb0rj5e0ct69yQM3KXM3ATHLz92kuDkvQU6hIP3WsP5cpPWV3BD3UPWBFuKVlhKfQIeigTAvG0TyytK0TVTOq6nemTq/yYs6EXyiMB0BfsVHNd9MiEHtj1ueIE8URA3jYCGfUwcODFSri9uTiVgsEjFNUeC4gaGBocFV1ZXVlf0rllTaly9e3pxLtCXbYo2xxniDCwlo2sCohH2qEBJDDM+qHsgdAhFnWeonNlHcSRFOdobgPG5510wk10RRm7zrGOGMQ1Du5ElyK5Px8OdNJ37kCD/lbDviB3nOOM5kPHLa1X+5ByuOHHHi1aGhBZIqOTU0ROLDw2dPDg3Rm2ZvOw6PcN6YvQ9FxyG32Kztpx1ovcKlgC9aX13H3P8EDwX646aTUWouqRLmNJZ4XhqHjYTtKPEjmbQKFK0pn27JtDTG6uyg35NSUwvsPrC06iTXR7IISjmfAWspYlegkRjEtVIfySEYCqafnz46QzeRbywdJ2O9Z96C4b70SMzbHSfxhm5vg3MavZVeuk+6g7w2fWwTnbnx4p+NL3U0LEZOLx0fqW9qqh85e+Tur98rHH8FgwY0kH+v4H/BjzKurx0I507uAHcTdxf3EPck9xz3Ehmuapes7OM9epDA6KhF+4/YxPQpPlPZEyJBQRSC4p4wSMo+k/PNAIkOEN2j6DOG5ec9wDYJQY8woyH2J0YLTrPsVGPz2alqgfxjc8/kgkJICIb2cCERBtKu/w9P/p+t6NRUdcmXnt+yReKef+lLLz37ucc+vu+KPbu27Nxy2fatG6fWn7du7fDgiurSHgxDn+VoLZPLS/kI9nT7EtK+OKVT1ARY6H88y8W2Ly6z5R7z+oSAe+U7+HTZhgkQ6mDRPLjEhNM5DCJH30FrKbHgMI/IZH20xBKr5MudbvBoC3UjfjCw0EI2D8F3YIGxssirMdYCU13aqCNn0YUwsqwQKvisDsaBFImYx3OuArCS42tnEUYM+D3yq6W7xhZVFntlFVjpBPDQsrfUuWhsV//bbz8yzPd/Lct38011mUxHyJbIWiIGzERdNluXh9PZlrb88OYdm1fn2o7JjSrQvOdyqt+vBlWZfpOqKq3ykq7z8Ov8gqoiL8gS38vrusQ7/3YPXBcl+W5Zl8QH7pFlXgRqd68M4h9fvgdOSvK9AtFEXvyYwN+jSJIuw0WeqPT6lrFdPf1XNStWovsY8vLv607YSvOV/T27xlrO2ltI3nHuNRsvITTXkTVCWV5XPI2mnSvnLnloS2Nq+5KOzUO53NDmjiWX3CiJzf6wYViG32uQVUQS75b98Oa7FV0WZUr9svtm5/tVImnsQ3Td+Xov1RUvYR+yYrn7hcQr+0nJPQef6FNEiXNtQbSX/CvwNHbV5M7FVeo03SjzWc8vN0feUvVtb8z7trdG+/63DvvwL4bKLbS7/jX/Jv0dF2FRvcMwr/+ae2/1+m2E556eAMaKDnE+v6b5tgFT5OG9CDAm8B5hFxA7v0/xz+iwVqicpm5BNtbL8TOw4tZi0OewOM/NNNfd9dwXPvbRR/78gY/cfuuuyzZtPG/dIObNYTHAy4rdiwNoM3AVYjio3RnQyeTcfC7ENAxJKee6uLM5sRSVaSwn6pw8Z9dMryZhEUMpl4MOx9kQ7nJ5aGR4XP7Yxhgjk0Ex4F/22M6yzOTttPtelCNx28bmg8yeqNMGwsLiGX5wZ1du/nFhunlxF1l/c1veDBayVMy2mFZzYyp3I7A/wtnfiZogBPy5ZLF+IE9yA51m0MgmnJ8NXDR960Vb1MRUdfmFy8lUcfXap2buOrS/u4MgKnx9JSh1dgMJopJ587rq8q64rhPq9/kj9alVKU2RSBflJV8ssMwPAky9bTY2NPga/G2yX82GMtlFa5uJIIU6iz4FLqdK37ntxRsqmXCEyuELzq+OjawYXL9+1fDI2IrFiaxzSUMkbFOgIZH4spXVga6sFYm02FZs+a2vXXTr9EXHtvwyAVVcfiH5fns01pBILOlYHswbeX+MyA0Rw/DVeSXJjKkeHTg6pV4LpFSvxyMoKc0OBbqXrGn0h2QvkUxRV+o8VsbnBXYdEY5x+RDFhkKDN+ALSgFR0NW6tNmcKnWXwzGjYHMC89FysazQl2YZ4iP44DYbllZ00RJwdO5BHR4i4yPGvMCrwrSXeGAwehgwLCaIneY4WWaYxajj5+SR3p6O9kUtoY7mUCgZCBgaSMl2shP/MpVykrDsv4hky9iOcM0voJMZe1HhXPPXQhadeRifIqcdjZyeshLOR4CNSASpFYsMatKRhHX2TStOjsgaqbZkEmFyyK74L/BHSHpRn3zi1KmENeUc8ps0Eo0IRuBNWSVTaAie0qQ3W6uEtFuJiH6BUbFO9M3qy5lfZDP3HtTrIc+A2MwYrAYCEEJDoGs6+qEy13RBFt2g5vH5oOYN569bm83GOpuzHR4MVAvPsxio83fnwWwuHdtVqrB4rpA8i4qCQc+WH4UdhInvk9HujaYvtMvzwemVTvvK6emVx1H11tIoCn3MsYy8nC2rhl+xj55S/bJsTX2u2l9HfbJH1KREJEgELZhpqo5sXzplybLuPeUlhTvxMeTl/mmiSX7eH6LlrNPOHnbIK8q6RyXqKaBTkV2r1z3nk4gc8PSWRhvq28vF1qZYVKG7IkDDTqnxeT3qm/QLXJrrQkt/fdDDg+w/RGoQ7qJw+WwcB92ezZsx02KW/j9pVS7niTxnE0J6Ak2Zz/GT7/X70/5m/3vfCz9pP25hU9Bnj89+7Ieb07GG1OYf2v5QyE+m3wsXM7p+4406bApY/pxj8vW/iKWeT8X+whCEJN2aFATGi34NvunXzH7SwWWqyUiAeaETDK70KCBKcbPRUYWmdBLhBogrq0qyjbqdfE5813H2D31M+4FVuaam3KoDE+2lUrvzz1c3R2OxaPPVS1LpdMo5dc6X0F9vXTJ6/ufPH12ydd2OXW/t2rFxRzCTm8ylQztalq04vmLZsdqH+HkxSS/BD5mPHYaxHYPR3Vddis6e0boIqruHYvWUIrCXwBFhhmnAKTeOWw79czk6Em/IpBua483NdQZm2sym832k813KUjSS22HSRVzQStckQ19aFGxt71g8/p6X3jO+uAQ7E9tWXdcWJA0TZ28fPLhq1cE7Dg6uOvT9YNt1q7ZNjC/uwBJYtKO9NbjIeWOCNKw6dEet3CwOxCfhOzBKBqWyDDdR3bDAVK54ZI8i7+Fk3iPzu0TCSx5e2qUSVzcKy6ggSGOcJAkTnCAJayQhnWqMgyAVCRp+3ecVbMkOGF5Y+EPJcFKsaUGXotTU4Wo9STKQzM46I72NdIk+deaeaDYbfY6cfj6ayTj/4txKDhGlPheN5up588jyTNT5WjTzu99l68iSaObsCbLkuyG8Vl/rl7f5n9O/gXmT4xqrsVw2w1Nujg+pBaktT4aZn1DOXUCZUZxlZncXWWh9y/V4rZRJQOR/yPuNunju85/734+l4tEk7/HwRiDakP7CX3710VRDfYpXoBbdtD6TyFp1xEd0oT4ynL7snsvS6VwkJmjEJ9XXDacue9D5Hbn0mfm4xq2wVnSih0JnazoaUKRzGKbm3FKKyrY4Y13byJz7juxGKixHTEnkbVm4gpsqBegeGpn8hF8a1fW0v6funkLDUEMruTvag7Oz/u67o4Y/4++uv7sQH2oo3BPtNtLwbXcTRe+JLoN7LvhUQ4G0xj51AZxdBjdNTPyxCzX6/jB8wyKunxutrl0Ka3iWiCDFc+iyI1PUcmEi8z1Ar6gg7uJYvk1G86VZAIsFtN60w/nOJZ0dzIlkIaFPolslxkLmGcT3AlLP9EG2FSILwwhqsQTztJ28nI57eLlekkWfVqPJSODFjCTzgve9zhJfRv+lri+DNvoguQwO+nxk7Wfm6LkuhKQYDP45gv5+RUzDpxHR6dH1X7LyPrzRB09Y4H9iINJotQmhwDngWf8AjEB9NGx6FM4ghuiCCPBx2seDHLUQjok8ufroTDft3XTL8WPTPT3Tx84xxtO/6Z45etfR6V6hvP26+6/b0e48dK79nV/go4Val1S1EdORo6Uat4SbdDN8j3Tinw4WKVXLjz1rWhdrx13vOp5Ni32q5r3F3Mca3I17qpEdwM+7/LysP7Jfs0X9lvvHOax4lrUYWCUW8MDN5Vc8x84+V/OuhZqXmj/Awi/hw64WJ1/zfTv1J+qD+/fvZq5vu/EskRZcJIr7bfAz53c0xfTqZfT9/uN+AR2lRa3ROpMp002G2ckycVoYR4mGiTgt9cGpXL4GN0tYJgP0u4cvmBrY9/ATH927ht94fqTXCCqRSm9xZOf+HesLpLdiq5le+/yNzkdQDVrobSLT73lw/8DA/gffs/2zfVDW7g00H17Zs3OkCPf0DBwsBHvaleCyZ8iwcz8GYpHt8It4uW/Dt/wC6KjCrYFKb+eu4m7gjnHXVg8fOljtEzzK4T27d1zav0gWPTddXeAJd+yGa/JBURVuDFOvKgIFkBRJxhzFXt6LyRskWEskBW1BIoe8LofAGuhIxqleQZ3hoBCzDaHeycuPbN960ebJiUK0qSnfEg0xnhd6SydFWrFFpHBSKp8FFs+SXeyvvBv+j3l80FiPYM8Myq6W3xSBeRtJtsIgM2WxwlQRLOC/o8T3EXbk6hBCNmqZ8wx4LQ20JC+G5UYKZFXsgvfJFJNZBxNBIfo0qTdEY1gOyc6f9Qm8QoVK25r1I+0dslAprjm/mBOVgQFFzBXPX1OsCLxV17Zu/ZpiN08VuY+8F24bhtvPXhaNLSp3FcKw6ehurlsUi1rN3R2wCRe6PlQJKq1+IngIOVwh9w85G6aAcxaon7wx5Lx+CcgR01aM1Sb1urdJyQjCqxk+Fm1Z39DW2raqAJugIjY1i3KgLT7akuy1WtsaRlvr6/nsq6KQ8eS1dZE1saQZGY4nnQOxNbaZxB9yKCmbXiGqU3jxjUGyIvPLaqfIyyLxfzb9k3WUzuFHMf5HAem8HnhUoP9BlQp8iVChnojoVC4TDCpkIWYChpgJHIXFARMiQBdA1wPfwMQcdOvipJHOdGfIzoSSBroyYVIWJsN0oSPhAg+9UEd+Ln6zczZPGGbEcfHhyZPkNHqqnjquys4h5h1PbpXVE5/4BInXwiadb7mupxfBRNaUnxjWeWR73H7zkQxzrM/gPc4HPvGWcysrNpUI07fY3l/Kyk/8ldlcLlNMzktyi7lV3PnV0ZZCOiWA8Drkg0WQKHSQU2UiKKqAKVt4CT9fQrsomRbRsOzhxnDLITAH5xmpLuvutHMdgdDSALJLrnwngtzGzDDyvEQXQJ9dlOXkWWcu17eyVBHfle8CG+MUedLZQE4Pa+KfizGlFhg6PAxy3bfg209hCAE2EP5ujdtng267iCDzPWBY8ikQE5Wo/ICk1dx9z1bYlsTdYCi8Vz37Np6ib6Hk9+fYOuiT9Fton/8F7XM+t4W7EuMNuolI1hNB9Ps0nkoM5YrKEjo4YgQbMgQg24jTcwiB72IM9u7evnV688QFa4dX9S/r6VRYeDoadNkoQNcaoJWdFdcAmZvddrk75RzC+qN3fB+1w7XGY7eCWIjqm65QJW+JEmMp4FFstKHGcfaYZWviP2hp96vV7NmzLeuBs8XUE0QI+iLA1wiyqlk8wWwAPjXKC4hM5RExT7hpGmGZ/K/mou/DZlPZqfdror6S8kZc/IRAwme/SCWFbFB0qlHJ4zwp67SHV2SyQdaBAioynuHpUGOzI2faSW9rNuX3yaIuSFI03BuWLK/HZ/aZYgTe79P7w4Lp0WRvQDXVoKIib1JtcqT+HAn480Gd5nwhJVAb4Pj79PxgV2rxZb8RDgG9N2BMV9jqhTlYiPiHMvh1dWebbLOGWVVDmYYFKwsHLSxHg4zoR12wskFbFnnYTZbilN6Ey5S78uCGPNE6umPpqytH6ZpVr+KKNASsDRC54RqzM0iexF0y3TN/Dy5aeFi694l7S3gwfGxTH9998Q333rC1TIERqskA/1c4DN9iclmMD8fvoxw/I7iQVMJCSKp4QzhrZbvKopsWnMKAQBRtrDcVWWodxpNhzdzqsJq5leQDWBVaWL/98Pb1BaE0vJdMI6dW48coVOs7535yLY4PdUQS5wPucEm1Irh6Uoy45kQyzUsUA/PHccthe3MYtRSrM9GhRIHvkIiETno2CE7AB2fht5btZjY0D6nhFBl37td4yfkIDDB1uJI5G2QBd/StbFmmN509IWsheuXZIyr99NmNbiTdY7jB+atCHX/L6jibD/k8jHfh/ow7wT3EXVM9dOt7L9uypHuxLEtXX7l6RV1A4unU+c1Jj0KA4sPkhuWaSnJImgn4qKwjvrRMZ/weyqvoIQ98MDrZBINkHLckOMkFSXDkwY/c+8H3337zTUeuPXDVnl3bLtl84QUb1q3N1f6kzTn3VtcXET0PXf+Z+WPxXf6tpPO/vv7Hyv+x67Pvmz3uqpHc2UYncVVx55UbdTq7SxpUefaM8+M/cgFvng0ydd74w+fnf87t0XlH5Nd3y6oq48/fzzsnf25u9+//u5dfnzv3RYy0hNdcxIbHvO+ywqIzeqtLMOKUsoxlOMlAxkOQbeZpKgiMiOMg5oUR1ZNojNYZfk9YDdec9NyQwZKVBxISRzPhuXLPnGfdnRvuWE/Hb3n82IQwepxceA44rWsx//XYHY/eMcZ+nJcXiD8is38equUXcHNPb69ewomqeLmfqLx6uUZ4hb9cJ6ib9DI8EA8sSTA9L/cRpt2Azax6A3P3ukmQFubGVXwKZkHyLEiDZOAKFUgH2P9wMtDB9rJ4tO0E2XacvvS7W4fo353Ao2nnDaCZ8bMnae/ZI8P8xjNvkdOwaj956uwRetOcfyT7BpHzYqYpeBdmFx+ad4FEWGHOhbPkJvCONRynyFBeDASQsoluHULJQIgIh+Dd/MbjZ2beJitk9kK61NFIP1nh/JW7fiOu/kkWz25wFiIsQB/zBvYz+uoz3KV558tabGjADITT6A3oQfrPurAjlMTUBMkAk2FJ+9IH33Pgq1cIh7989Q7yF/3LNjkboKfIFuflZf2EdZizYfLBpeQweXLfV9/13Y3c2upwxEsF0Q4aMKQCGGI8hFga7879JLlNIS1siob6sKn73OaQ55sD2Ko24sZt5V3FQd51x3ab6E1THXAeknTpxjd3kSERtoRf6VF8v5LVWrM9+x+a6sEy0o0/300GJSwxoFgq+gD/7p0n+Wne4FZw0aq9rLuj2JxprAt5RW8tob3BAORsFGVs5p08G5fhovnjb03Dk2e6nlylEU3qja6OB378KBjKPLcu4LMui0sBw95RL9qyEPCuHfFHbLF+h20E5IbLLF9gHSvTICexSNEYWWsU8XJSiuNVMg3HUv2lthGU45fZMvFBeVG2L4vLQcO+tF4qGmtrJVJyww7bF4Trmr2jQU65V2vywDf5VxhmnQESQQJxihMNMRDaTULFSFjjeWr40JMU3f1lQZJRHkCtEJo9ML/fjOJijykMewzVYLDuoTLRtkJBvw5CJXM6wNSk2VmH5nylZMu5lJyvJGCbmNuSXxR6esZ6eh6fPD052PNoz7fvIvffObjf+eLBb3+d9r00+GnH/HQNn+yKycnhnp5X7r578ODBV775zcGnnprz9edDtTXwv9LhUC5eb4VUmfNTv1hz9ZxVUKGC0w6co8iy6JULFFDl6+ZVVP0z9G/mFEx4cWruyjQKS6yNf8tP0X8GkSHARWEcbate3AMToRgD/pEOacQrEB7k7RnRj7IFHfepTNQY14kHrU4IeUxkmdUeTUtEHvGqK/v7V/T1doOUXGovNOfSiXidjbNFDXhhjhgIiARky3X+5zHwV4qTbDkHwxZO2HPh0claeLQbd8GgIEpu9tc4kfId8N3S06axyzDf2TPoLyZojNwXb/Ov2m0lvqUqnSCZPWIlWNjJrzvWrOnoTQ0PpXrLw3Sk9GtF3UzudK7QdWKQn2wMxIvxThBeAhsTV8PqWAtKZMvl8M5B2rJpU8ua7SNUrfk5fobF7fqBi+mslli0UYLMw3u68UXTC7rURbxBmM6cy98GXOlTrmUZdPksM47QpLXgW9K5EBLhTVU5cxNb3/kjsjYIHfqtoEFMv/OG3wSex3nZxT04Ar3cRL7FCjptsOCSVxmigVlMyejro6Raw7PoBmhX/K3QxmLKGrkCV+IuqI7VBSgLPcFcagRdPRQ3Psgza+FWiSSKriuPOAmLsjjS2pJMEK59UUupdXE+kygkCw2xcMgjcX6ioytPlztI8TPYoCU1RIjOWhtgHk2XyewUS2VghMyON+dZg8zZE5pEL2KZEx+RVfrOVDl75ib4Wjrg8Ux5PLeUs+RWLO4cguJvLJDNiXb2dIX1Y6USDLqyyG/pUcZjRLgmbrqqBQMqz2IROfTg0dZPVuNMRtyKNhaQdVhOTWbHR4mRYhBdAy7EV/yx61N/2VnJNQeZ9/qc9bSWQXJhX5/D3m2rWUpfUWXsM+g67MFh+KQ21qvkW5lKddY6uovarC1+Dr+08RwmanYukyeZfi3CtAj91eVBXNcRmAxD4mROEOWFcTtcjfycGwvXWV5czmXdZOpZFvSAGavelRuTZ70FK1vXAmLEkmLy0VyExlLxfarivIHMH4nL2m7srynPI60x5w2mE4w3FKpoYoGiu8gtLCHmYeQcf+QJBs+exCK0l6kNXR8Q7nvk6/BdiWrDOXCSNZLuknEG3jlLxvcWq9VN1Sr5enVjf//GKouheQf66Ur6IWyfangeNXHh/bBSG1ImF6yQJTd+/vPOmWfpM/RDzzoObIn0TM2GeoI+yanA9S2qFgQMi2bZ6BibgLKgxGRBERMejQQDoQD8N7ApgWkxpXxnqZJPk/ndIDnv5O2bjpIf0OLc3pPOZ+84SS6/cZqMzu7N2W9n391WbcW3MoQWqAS3F18IJEfE/H+Y/w5ozsK3Z5M45MLQgR1kfpc/4Xzmq7duvvEHZ7/tfObk7bBjkPNuf5FcfvRC5zOze6ztfvjOxfQFfgIoRbIaDzL5clFOkQSR5RtyzUt1EdtCA6stsZyIua44rRSRw+iCyWCX5rXRaD3vQjhN+OXlXskMUqG4tV1tbQ0aUszaX4wEVUO7M1W8Rdcisdava0asck33wzuosLM93l/YG7/N1JTo1uvv/2hi04Dy4KcHW7eaxZle+ksq9Ccie2OtGUmNtMfWDyhSpNfo7tYVwZ0fl/P9/DqW+yDBNSP/F5CoOCAT9J+AVkRSpxCMk8UsEyITNZDS8eJIKmlbPo1wuWyyOdUcq7cSdkIL+8Kcl3gZmnuKGcW7KkY+ly9ZQdlDckYllJLcrChlPGlierYKefiGzRde+P0fbNy4+cZP/we91vkn57Vrf/N4eTSf253Lj1bW7t597066l/5046Qz9dprk4R7z8Ydv3SeOOy8TlKHyfgvnTdGd+az2fzO0fLO+6Dk3Xtdewx9HvgHxItK48xHeD7ggugMxusxvbhCBFF0M/fhRwniSF0EP6kxFknXpUDCtn2WLMAHqbVc7e7Ehmndmao5V8GZwILz9DYrFjfPftKMxyz8TyfxeP4cuTPeFId/W92N84q7xfF0Fur7EH2BC3HhatBDuFXExVTnQiSIY6gDjW996HPnmitkIqV/m7KeMZTWnuBB0mRUohFNdz5qZmL/EunOKJH7yXfhBJw++3INQ4CcohdzDYiz0GDp0u/hLETNEIujdFEHmZ+6i7LQVQNZQIgFcjKYKQWPHmXowrfdxvCI8SgTvO3FYCll3HcfO/XAg6wAHKVKwQfx+/79nQfpv/FxWFulpyMyxuvBNLDsSldcsPtIPi7ALKjQPEyHSg5d5nWWKFZW1wt56W5JjU/09QogBvrLvWU1tn+6OnqVWmiVJY+qtUejSvR9m95qfqZ7ePWzpyVrYP0VfZmJrFaZ2X7s8LHO95LC+paT5eWjZmBwMNd3cffIA24sFv1r4FsauSXcVoyYndl84eQFa1b1V5dVSrCAhwM+WLARUfaPGZi2XnLeaCYVZ2j3iCCYy9ssGyx2DnxcHsY8TGZY2zB5JsI75SW5jEieZcyGC1O+jP4i9nIMkkGschRRaki0LO4jz36ksJnKxIVGM1St9vuX08aGKvEbKTIz2qCnRm/ZdutTy2+7Ys3u3pwh5S9dNm767Y2RaovS3FhqNoxQ2+I2O98Ts+qlcLPgEagu1Ss9M34pIvQYWku4LvG+kc/f+O0Duq9v5ODS6U3pzB2rzPBo5pDznwc6+gfj9PGrJo8RK15JJR76wqWrNn2yoefPlIkHe4584cRldx1oa+7evWZtZ/8qsxCviycOXaJSybf6ov42yehfNB62L+4YvxkEF+AT37mM/zm0dZbrAFltAtp7H3cN937uY9wn6TrXs7fpBmKHP0gsz3oSsXpVavovWkqD5if37JoWuGBbMZ9LR4G4ykO1bFpQ3lMrr/7X5f/7j56acusyzQVNjgtuA6poRcLWDFCQiGpH0K6mEo+KllFFJgr6U/k02TfDaZzh14wZ4B3NoN+cqQsFdK9EZTe//JZ35yCvfcH/K+5bAOOorrPvY967O/uafUharVa7q931WpalXWlXlmR5LduSkGVZFsLYjhEG5AcWwo4B8zQhgaZACCYOIQRoElNC0iSkBPIAmqZNAhRI/jzaxBDS9s+rKUka0r8laX/HWv5z7uxKK9kOpE3z29qZuXfu3HvnzH2cc+8539lWU4oBpYSoHqa/p/zTf4C3KF2IBVg+Mvs/VAJ69mr7yEMPfvj973v3u25+x3XXXnP14auuvOKtBy7dt2f3JRft3LHt/MmJjee0xL2dq7qXx+P1cuNysQNtO3IsFqKo1YxCVVCFkWseIAV6GMhUMHqvpsVOGLjnHxBWcEXsfwnhpgP7qO0RzL8oSSjfzyBbCKgYAPk4n4r7u/DBrk77sSA+F6pEVbMSkWl/vjPV1RabDH7xxj0fyx51hg3FdY/EJpvbqGe2NT73qeZWOutZc8TNJtxH3Kc+435HPHDv9OTt8YaWe6cOfKrZE6tzMo8heZvqXG5D0pqtQxsHLoP+d93Gre9sbfaNTY355HBwZ8/qqfaWxomGdMsdaU9jxKznvqZ6eFK/D3IwRQYQhBw+6GNXQpnXfvjy7YOKFg6ixNoWC3uvD0OVWuPh673hd6/0eFa+273mwht2jrgnpu96Mj2yulFx68vO6W+UPBor/8P6bcO95sDEvnOX51hhmSNfooPFpqZ+eoClN/ZFZY+xbHhNI2Put7H0cH8EHs2M9EWBP/MY5e8ySbByuI64mT8D4wRwc6RA1pFzkb89d3Tjuv7VhY6VBqNOsiERd3DbP0CYyoHl/qLfxp8P4YWtalQshKqo9KGg2Geuxq+hTbj5lEoX0du1mi60sXQxaG9dpwUAeCp9z+E/O2TUhVtSoYOfuHrq4J4LduTyTvOTy9cwunLFORvHzlu77MJsamXrskwoLEmp7CvXqbKzLpfu2NIpy+6NDi25KtE/unrNmKYGN/kUZU2uYzVvKJY/31030F9YRYvlz/Vm1/bd/LZj917xNjnQvOeCG6+97GChL2p9PuCPNvSuKq3PdwcCtybDuWCb52b3wAVd0PQS5wy0Ob4R7Mgf3TI2Glrdv/aKZWlf1dfNCR4A+SYLZCmVVq9bu2Z1X2/Pqu5iV14YzXp9dD2ntlrWvCa2JNjxRJySdCqeTWRJM2221WOEznVVRyuEM/T8/65OIBGvOleiLWpa9gP53HQNVUPFUDHdRFeCZBSir3Vf0tjkNCxnNO6N+IMOR9Af8cajTstwNjVe0t3c1jawciX9Uvnfv/P9cvn4hxrc794w01f3Mcv/cHjN7Ia7vHUP8kBxZXuxpbmh0ZfIhJdlu/r7u7LLwpmEr7GhuaXYvrJY/sXKAcxn7r6L4B+9tJSKdT+Quey64S1bRq+7MvPh7niyVJFxeunzxFzsjy2HmvItYkhooxWETdZructOEC6dJ42ocdL4BFoKRR0nDeOkoyp30b3sBuI6g+59yPbw5rUWtKSENKuLxyNhtq3sNIOOiio+mc9vLTsCdTM+L6C1qFBWQcULFB9xJTJI1xpCVx8eM+iUWdHjtytJYCS1fftOzPv2rVp+JWCuLZJesbN0Bflg6f61LazRd86KJPc3sqEYjdZTX2PUt6u5iTX69cbJBuqvC7m4rvn1C8NBJ9cCXpXLkiZPWR6FS24HR3QUqIEBElYkQibEBYlsIxESGT10cHb/3j2XAA+19dxNoxvWr+mvtEFoMx0rl6UT8eZYUxR9SqBMFLD8Pm/lnyeOW/H5rgT+0jVnuuTM59GO7M14WpO+WLlX3agvLrKSmkcaroJxCQXtoePHn3nssWeqR3r/44+feOwx+snjx088/vjT1T1cPN4vok4cP+4ztIRYUkloxoutkVOvolg+3NmSbOk8UUgmWgp0qDG7+fjx48nHHnsseXzu6eMn8ZB8jLYfF7kdF4oPKbh3/PhMTVTrXJeQ8L/amC3gIkbBPmaJXFlfwy9bV7G731/aG/SjQ9lGJqtsyKAE3VoRjgswksKkKY0qpu7iqqyoU04qYLHhVMXFzmSSyfp6j4eSzPLM8uwy256+PlEfb4p66jzhgGUvV1XdrtXuegaQ/IjwDVJPIS02R9fQrnwgDz9+AusslqM6W+DV+HFDg3c7daFTKRwdOsEdhWTtNuiwoR05ohlzBUOj55YfgZRDw8NoTlfBxOgR6xteXFMQfqlxjcN2UF11moFGc6ZL9xpee7lCqV3uaF667nFHW2lgR2X9AyPEsaK3d2+lrHrSUypqksoU2V4mty+hRKHMR0f9Piw0FPTV++tri9bPWPQZ67BtQJxr12Jqj5V18Sf5BEdt4XbEPcsmG0AIcSN+OO4NVXdhlsDyBVb1hAU2GzA6qcUweTb+jY2yLzTzUMcwWAXOo4/A4LLlSdkjlRTlyXEYX07CwPeRhUsramx5UjGVNQrtOYkuILY8JcsliIAUMDLRS1X5KXFlirvjT8Jd2da/3U9vh7EphmskuDV0QBKLTJzOY4Q1twSa/WIVGHUIvbiUPW+91EtRP6lQGZ3pbUFzaAgHvqMwOh81LPfwMBZ3FEbUow72Iajo3NNQ1aMOBySwWB8M3Xc64G9+rOWvMC/UJVNqQai1ip+QgwJyYwIhN7Yi5MaI3x/y++2FaXskXk3RFd3CqI5O6jpttMNXIHuQ7U8vFkfqo0A+rKLDrmE1YJB5LJBP8nHo1zH4ylbJS2lVc3p5tinIUZ9bmO0JAE/8VPJCkEEQqhKoSfAxY3xg1y27BsYNZrB9diBb6NSYUf5rZlRv8tGtt1/WMzA1NdBz2e1bJakaat8xcHi9VC4txMD9Slu8kbXzfugdCbQmqOICsgNLFYgyVjgk4N6ivLaavCCsJIRJYz7X1VmkcXPnzuGHf/zw8M6dJvNlmaR4pEwsloyHe7K8cPiFKx+YOPTQQ4cmHrjyhcNa+aBkKEpPW/ueXDi+fupesXf6y9f/hd/P/h5GxAI5jxRKecKFofIsYTJlqAON0N0CBJSIjkzm10YbVza2puuF/q2CGPr9LMoQ2sKWvXGVWi4EVeHRDwPCO3g/Rxaxn4YKYrXujPfO82Qikqe9/8o7H33nQHcqFktdd3D6uvV7JtvYZ1KlVCY3ldt1IwZbzawZG22dmrhpUARTMVPyzN9uzy6+zYKmFG01M5lMbFpJtUeTmdjlg6lIJHosNhaLp1LiOok5DMRaWSyDwb+PpcxW075ZH1tys/JNH+Cv8BjwCVnUjlEo9E1hjHBQoNBMVv3LLaCdw2SRakmEgw5dlUgDrbchrGBugNGky4urFpXuURTzbV4WCLUJmITTuNVBP25ZbdajHqfTvMYwrjGdmvWoxS42jMNByTTLf5uhW32Wh8esUw9ZFn1CYcaEYikTBpO+aH0Tr5zKTwRuFdb96/Q19iraP+LYqFC6XvCyB5HFZWQSXRFWTEA8bkosvzvkCRGTmnJljGZu2iZBB573gndy37EbSv1GfOtA4di+7vHxg2Nj7NVjf1t+deuks+2Wmx4e2HesfAPGHhwXMsoLMI68VuGxcD6GsQ2teGESTVbZnLBL99t70EHB0uEsqtqravhDvkRgVaHfNS+C0uBcap/5Sx6P5jFeesnnefklT9zzM5/npZc9nrlTH6PH4O/jcGTbDGvuCQv6xa23Ggb8LIsNW8YxcW3MfZKe3FdWlhwqtHuUT3ETeMQg0T4btHwGWyGUyVBR0E15S7II7VmlIT6uKYYRMQpPlQYK5VvoU2WrOxjxTZa/GeFE80TCheDB8kOHD9Mbun99HYzGmrKv/MrPcM/l9VOv38C/zEvAi1pAn1ZceV0eYcKlVAVxUUY3hhLwK4v2B4SuGK6+ZtJej9NyWaqMS8mioRVgyiWqAqIK8fdTlpIUXzDdL63BikM/9KPRJ8gnCn35WRqRWPlfnnu2/EMm0eC3H/h76YflZ1+Wvj8qeQa2PdjXB6fW7EN91wSzPVZn8lbeD6mffa78Y4nR4LPP0cipj7Hv0z54oPz0yw/Ujz+6rWQYcGrNlgyqWd2twc53JskiTDj6l/Q/2NXC5n1tH/lL8hfkCfIhcg+5lSiCvTiKphhw9TL5OzJLtpMtZID0A3Meg+HLQBhG+kF6L72H3kHfRa+jV9Hd9BLKyQ/I99G1HlHpuXQTzSD8D1Hoa/R79Fv0q/Sv6RdpN81DHGJIK2TIto9fu65S+q3C1xiB2uB2jPwHqINKhuCdcSChZLDh/x8hcA0P0Qe6UO2VMzSrUriKuNAaV7QZYNa4RmcQfAcYOUTf0bE1bpNh2CO8CjPQI1EuM5nvJkyVmToDech2HrKdh7yQhyzbechbkcEZafgvlrx9+9o6scD8Ej1Bn6Sfp+cDO/I35BnyWfIZ8mnyKXItOYxOKBCPAdKhzbVMFsMI4pSU66ddyCyEBNu0hsJQY6mdKaWrTcIBGgcfK0utuBJXYV5OFFLpfBuD2cw2YFTQx7BQy0XGFS7EsomKv1xK7acJzDQdFMN8LpgPdqZzIoESitvIgWnIFnK17SKjiB6jQlFKUMUVbxTQcHm7M5RWVKH2GyqGEN0oqOLKC9qHRZlVDKo2sFk6pQTzmE8TVKioNPEoCymYXxekCqK7NtaFBqZKlOWh3rmo1MSF9SVacMdRNRvNvQtdkAsc8O1ThVAOV3zgtSwlkCjgGIzG3HHV5MJFL74d1gvY5U54jyDM90WocLAYZUCdQtGe6lNd6S5kHQRuTzoHKeJQm36aD+KxGCyk+mmgWEhgHZHAuS4gCC8UUzD+FyoG5G4KbxYAeiEj4aapAip7KAUlYNJAGy2KBSlcwrKU4CLsR+pnGoIec2/AD9Ij0xQOn0ySDFmRqIZMEJfgn0IVBkIJSoOcaiD8RWDsZZDApEzVIQlFv90qzK+yi3PL9Eua2CGVdUb9ugKTv2JwkH5kxhUdcpN1SQZeANgqU3W4JQ+HXCXcIYYTZAyjuuSTudOJ3jKcdQ1ckWW/zB2Sy0HRNk2TdGlLTkI0AE7DBtRBlrCeOP5TZqiqT1J1CQpkJm7amkxizK1xnC9kKhkGuhWQnSrjGtfVoKLImuaRLMgHMucmerOTNa/B4B8FEZEajDs5A2poCLWlOlBlT7O4Bg/ge8sC8ZdTKcx1VLjmLmYiOSS4o0AdgE6SpGqy6pQgwODtRUWcEvOhArps6owZGpBKUVRZdxqXXjFOndQFzwdw2EBCy07o8/CPYs0R64qhtrgTX05yuCk6s6+F6iz/A9UYejTTuOyg6DCdOamhCrpSpjhlBegKXA4XEQg6qiFZES8avrXKNdVQ0eTbiU0DXs2pA1FkeAXuZdzUMJ7r8Fm5Qk3JgCxleC1DUlWV6rKmahxdmkKO0BwMzk28LYPoSw3NzTgOZibO3Ar8h0qs2CzhV5cUtwF1kCWgh+VgVKlnNAQtjssW5x6gsaTJmkQdYZfshLeWnJopmdRwWCoMn0By+BY+bkiSLiuMG4LAzKP5sP1CPQyY1/FTAr09shvHYuaAl4agFDZ1U9bRAgQ9A8A7weDM3NBGKHrs5pockpgGhDQRDQT3rh26jE0DvgG8swQdAkigUHg9eBC/OxzKrsB5+M7IBWE/AFIzgysQBdQ1FYZpsD1hPnJE8+qm7mSSRxX84K0gx3WSdWQUZJEpspccKh3oyzPZqHfDc8vjdR4dpgBE1zQcssOQZ93QbalONR0NthyG4tilAkUo1WS6y2O6uE6IPikudNtsUCejuy6cvuTCvbv2XrBz+7bJc8c3bxwJFIJFYMMKlhe1toMVkQsEe+DI04GFsCLcJjfSmhQ4vq0WbuUQuVkNoNZKMCBXMc38NoRGXPHPo5xVWWU+PTw4PTg8Ot0aFxfRtul4ShGXW7dNj4qLsemtW+d2ZLszme7st+EHV7fbIRqOYChzMD6WGxzMjcUPjTm/Vr3+mjMVcR6av1O6rPOO+CgGRuN3dF5W+mE0k+nJZNhLEXGeS9lhcejJEPb6ydcP8nq+FXiJFcRTcvmovUmwPCt0QIOI0eFmOMji8FtEq2ThkRahbwSCHrrYQgsLyhVr156B0uHBfSCIOS1olBZlYdN356H9j10W9U1OR7F1saC6zmOGTcvDpq981uc0vux8OCKBrGVeHK2n78gN7n/Qst7xhdb9/VarM6h7VEvucGoeZhKYxcnrk3yA7xNod22kCLzQxWSG3Fy6abI1HYEekQW+Vl/ncYAUpvIhB7Q+GH/1WRcMnNhuZ6E1eQw34pUjqB1Rma7u8jpNLjaoxQUl2xABAzep37KjfaXl37f3kpnpmQundlz8lou3bd08NrShf3VnfmWxvRhvDof8DVZDwIc4XKh1Z1J0MgcNBSY8JYA8hdBIFM600d+UhWuwKvq6KNoAsG3UD7MtPocmljiX28hD6PQPEqMzjSAV6HiQFa02pm+t6KE737GD9rSNdrQNdKEjyUxcqqe/qMT3rdjcmh+042MsUt/et/OmKdrd6jo8ctWj7vnQlSOHH507EYAUbREpSf8jEI1mY7E/8kzk1u5gU2tyE57ERRsyVnrdzzA+G2XXeSY61u7cuTY37vVdurHFWj7+3WhrFP7m3umeyIuHOsZ9Q1P0vivd452Ysh2Cu+gDTLPTnforO6fKOs4D7FWQpVvIMhgDdpcu9sJYToeaqUwHUb0MBtLZef4RBjt9BhW7DxrU3vWcgu8HUzXbtRQClZJ1a3u6bcEy1gTEdeoKaaFJ1CL0L6idrRaIM01A/RziMuAO1mqaSOMSrdwcaG7JB2xcm0ZEjxUKBSnbxCIXaGzy0y/7m+ocCHJ8j0fP6Z5crjFQPkinyg/SL+dEDMy1CrK9Tf4cjzUGTn3f39TkP4mx0xs3Ur834My5LO89Ochu+rncRq/lyjkD3pMiT5iMVMcRf9O8ffQE+1Pg0ptIF3mvzaXnDCqUB3dr0AtVZRpZYnSuJfSVYSq9CNq+qsqTcJLVrUSVVWCw7YeIhP0AuvXBN/HQ9lJzc0yHhCvblmeBnl3NnXqTHg1abqe9gOu0qVoBD4KWLPSXgGj55iryUIJWPTKKBcGgbauSmF7W2zvR2zub2bBso0vS6vgqSbXq21dtm3sZSJVqYrfDocnP/hRTTfROL9uQ4bI3Vzcd8UYC9aan/O0m/z1I1OlpPN4jyEVkkC/38wk+QWyPUd1kjNxUOuIRa4SW088dwPc4zFliAgOkzBjAPqgwE864XTp6IVVtQcMneblw4SEuGAgbqJc32rOqqSkUNF2UDA+tX1das2qsZ1NTd1N3V759ZevyTDoZb6gPRkNRn9cVMAM2ZnnA3hvEZmdrq8pVajVXL2SuIOyETZl89ZwrpHnzwoP5+QwS9HuG2x0wzfIPbRLSH9vnubfdIPkcI3BrGn4bHT7pCL060AjX98CvMcAnTMepEQQF459zmDmbrvbfyfJtuucHeOsH9tGj06sbA3NfwgBiYuOZrQk0VvXPD/HvA409tv95QwdWmmzwVKYOy49TRxdN9bOQ2gSMvcnSNG0F+xELSKHfqIseunfowRVXPFQXO3TPOeWOlZFUBP4C9Bvr7zsUrXvwqhUPDd53MBYudxy3IizcGlTiAuv0c/wVrpA0aSfbyE3kXSAhP1H67Aa3CYOETLaed+6W0ZFzvB5ZcnB5326Y9qcmYb4PWJSYjF+694KWsKyxt8/CR6qD1n/jkeuvvfKtiXoNuBkYo9h+tIsdWFvCPWDcfXPoG2645uorDsl0PVrBHkA/F0TmswRaDEgPs2glqqCEi3PLDCpOVraStMpO8VZcmBl533tvv/XA5W/ZMTSYz2EfaorWGzBdrEYgrbRACs3jFnwIMUoDiByjog4TYmep6WIqXQSqMSBaCyStpIeklfRqopo+3VVJz4v5+XSB35KuqAiBDCVL/8LllObuWz9S36hdZDTWj6zv86hTU6pHRBkXaSLKrb2tczTHCsPdtKQNas6WQocVMIdZ0LtqRYfB1mvrNTPdvTIYMActb++KDk1qUToUrb4l6fIY7R7nsqaEIq1UOiQjkklAVIfLxCi2QQpnIkq9T/FGfFKykJViEbU++auLtGjdyIbVdkVWbxipi4q6DQ9CRaawuoPD9Y29LQWWG2uXur9arYc0IOoBdQvN12NAqVa3vCXncS5vbtFYu9yhGA3LoCLOvNuO6lDyULdlUN26QFQKtoWVMH20IaulOltZXOhawJf+Gfs08ZMIWnCSPBksrVsOs02jBYKIMJbENeBZFRlric6ApMkFZDEuspL5NdZUqm1FKpvKhi3450Nk/K5ONDG21EQBJiEJdQkSKX9nIcoEe9CP8A7AL3QVQ4FqLPx/gGZY023LXy4/+/Ly25pOpnJJlmnLfjHZCef2jLujY7QS9YVv0BQr/+O3dk5OTN33j+zlB6YmJqmnLsXihbiUPbdepJdi5Rs6fv3rDjpdvbEYTwh3U3tKRVvjGZHHJH4Qfe6AVDC1FG6HELfpcsIjDrFdrct1ywP+vJpP5/3NPMH9eZ54/qR2SDv5fHnKuMtw3uE4fA9/5Sc/ORWmTeUf0Kvo5MJe/yOC3o2leuMMfrV8wRSvOM8FFnUeTgNXWsQO3VPHBPTosadwl+nOuQ/j3tdTtquNpwxrft/0ZlFGG9rkpkEQluaLEZ4Gxd6h8NRD9qwMQZFix/AMRfotYSqFX4y3SUV0LIsYGUsr8mJ7WtbNIHUGPR5JA3ZYsty6nG4/vYLlL2VH3NzyOD1OZzQW03yaxx2k3D0i9JC/xY+zn4t6bySXkZHSkKh7kcpkkqoyH9pH2QZi+8ijyukvg9sXwGodIKq6Z2J8aDAj3k24kX/T7xaajy1W3PgIjMEKtEXlZlrscSDWZTolmC3M9HeizNFdm1QV3jwQcyxra1vmiAUst6aOTd1152GIh8fr6gLrx9jIYKBO8vFg0FTVw3f+DuTMnncsxoNm0OHRozv27YjqHgeEePNdW296KQc3LJfTNPP3fvzevNvFFe6yID+eP2G30dc/zr3cL3xqgJyxYjl6bEYdCvRSzqW5BpfP52L/5KKbytMqCCAF06nBlVXrXwLtZ6KlhrBHQ7uQxf7fu7ryYodwCYzCUlgFvn3enwxtdAfLjkVB9s+nXkXzHe7DY811pZ/N1yNcCgjnN7UAmfmqks7S8k79UhTAvUsKmLcJe6XGVhvaZzuwnhkKb+Op+tiR0J4E+fxdb4ykk+pKpVJJYYZQ62oH6pJeEi7O41Kgo3L7ftXPm20MBTTYZdf9w27rO0FzriBC7AW3dRfc+6h9b7sZfNFyz9l+btjNZrDGIU/wuZrr54fx3YXTrb+Zd8AVJGekw4bSANLBQxfcDP0eSSCAj2pIIBz71JCgeFYSoKaVrSV1V20LAQKU77Nd++z5LxDg9/r+qbO/f/EN3r/429+fYhPAV8AWQLEFiPffbt8RLo7c7OZFHpn+q+//3+0Hb4IIZ+sHxd/eD+ibDv3u/UB7/fXX/5P/9AzYDYdLV1x7zVvPGV6raPqlF+1a1hxTJHn7ti3jdWGvR2N8VXcHGokijdxUN6km69ouF5WduPaMIKXcEHoMU6rtnUtF71xbxULOSAWzYRrdeWwCtiuUCsE/S/gbX4Iclq4JhyphtRIWmkBLfEXSwIJWUNW5eHrJmKPW0Dpd8y3w+aO1IDdnOfJthjbnExpv7FXVeerhs9+jvyV0uPoQRHyzpoivixh03WuUR2vSsCM2yAJelzed+YFvLCRBO5zX76R/DjxiEJENccW+wkDZ8xhOIslE0nZIGqxoKqGikk3ZgDefo5+Q1K8obvlZzXAcEfgOR+CsvyjLL+oB9oQwWByu1UkqooRfaqBVfVJCJxb6SGOi6t0z0Sxs6YWWBeog2Yawc8NBbSFrevdlqnHEaWhPy27lGU13HjGq5TzNuuGdoBznQjmiL27FFCOp0Dx0NCo82aMNLn6gRy3+tPyiFpwbxrqzJ7BAukur5K9WSvyKIt7p9fLr+4F+bTb90Msc+m4jFWUrYV5oJRPNgg1QxEwsHGOgoldVz+sTcpVuTk39CrzIsypb46gtHWpDanmOMMjSHaW2TFMdZ5LPybmtKCfcagtNJcoX+OweK1RfFGxvRSGuAmVn2/2LGsy7Ll/QoBP94iPyk+OG5T6J40PEMf6UbColmX7GiunjqB9XkuWntoj7QQrj35NbgA2E4eQk6qxBAtSf+958oAQPV1JU+BZbNllPJkqbiaEbBxxUV/UDLqpq6gEcA9CN42xll2OGcH65k2qUahNw0uhWGS7pyNoSyP2rOvNtrf6Q34u6dZaJsG5VTbYEar5aNRp2XYklum3C3V8F5FFoCwbyi7XdXrS12FDjDcbHFxdU315cpOv24mI9uDdIV5uz3Y4Q3yos8IWAjzP5Yj6uOy1aa1Cl3oofFGhC0BFhdOJu3Vv+RRB4aeOoUf6Fzx9mL4TYI0GILF8cMjiUijuufm/rYn5xA3rp6e/KxyXGO5tjDT6vh1Ed0TgkYcwqL1jKpXqKDT2rhIagGioWql4rBJiEihu3VfBDaFDpKkSyGCAQIzmEW8oVNWRR+TT72rPPjntbLc/JkG54t2BAN0LYylq94xBygAyAypUhQ8fwFq+hh7CNCVRkloQU8JYnzWAogA9v8QZCkDjs94lnuX76LZ2jUiSuRX2b/5T9s9B9RfuBHjJCLiztXN/Xyw1HZyvT9AY/k0D8AonAUBzGFM7sHGd2nWgM5q6FmV3G0URGtRNpamH0Gh4srekutPihWL/l9yHCYBH9ZUNnC3bNu8euTDdVfofW3kjMD0UVv5M14RP9O/rn/7gPBsMdYox4GOaXX5wpltYGSq0l1rezj5X+bYXIovzz2nmDVCPn4XpocGHKELTbDzzAJuAAVpNN5AIyS46wUKm4Y/t53HJffTkzrQPUZbZD7927MssN31CEcXlNo8kdkgKzigxNWR+6kBohPwxRg7bB/SXEbbkPBKjhgwawG5gnh3Bli+rdu4lluqzJoIeZfurSTNcUKt34NHUX8RGv7vPiN1FkXblQ+LFFhW/iYLJj6jTXtxsfbYGips9WlAN9U/3+yspCWbsXyvIZ3tn/qcJKe85UjmP2910Q2qW1jo3FYtdfe8WhmUsvuWjsgrELdr5lYsv45o3nrBuIrY7BGJxsCHp9YX8iHkLzBmi38XQR8aa7OlWhYlLsiivpQKIrH1Cj1I+eOzr7ebETlVHSwtYM5iCm5rvkms4h0ATwGdzFTShqupgPyG/QR77T39qXbIrEPOFeUzLDhqEn9d6nuiJx+oIUiWeC3Oeqs1a6CrFMd6otBeL6psXd6C/6KJVDmdFePnbWnlRYkaMtHXUeT0JqUnxNLtRDiZ7XsVbJ0oHtltHYFg2HXaaHxpojsbZMpK0+6o4/VulsmuGk/9rdvW5FSDWs7NAPXjpzf0Ocke+wPhirTNJIEqVYxfrmdD34QGdqkbv4VEWoFGSqMfVZ7BRjseHPv7sNdJEhJufnTGF7g8HKfAH1oKEz+t9IWbZV0aKSlxRVm3cVg6FXvNfp9kl0aaUXV5M+v6huqpjLXhF4F16he9lF+sk4mS5dtIIypaAzriYRRowPwRdSVEXoqHFF5TM65TCwE1z/R/FkBleAmEPZBUwFfAiBoWBsIwY1RjeNbhhY3bequzPfvhK30uxhPby8KNyfsYK/io8BE6PwKoN60giXUUjNQ2fQ+TTzFzgRNgtXZMJbzYlsTyvL9Kdm4Se1Fdp/vop76iO8u7mgOVq3jbj0ero125dhrd1t5XsraX5dOf/5ZsM69W+WsXn8li8894Vbxr8RzYqkNFi5+NfvmPWK0/Md3tq8fDTctry51FJN8vbKxebK+R/fc4PXe/2xPU/cOjZ26xPz/ALKwOchGitxOpzAoTkMxwG3rspcruC0aWjReLlJDcaMSTgZDKQ4ZrCRyYnNm0ZHgIS9Pd3Qj5u9LfjLoxTXEljwfRWCW8iphWqQlM8ShyJa1UMzMhUh2z9Fc8XKib8SCz6G8KFd5R91CezRx8RxaTAbpY2LImhjYyuFmPsex6fhQGdmoqGzBCDpTCxQCUfpTDY6E62st/v4uQK7HPjztniQADPlklBLf0ihyJYzauOL2bYhZE/B3xVoaCqiF2oUDtSKgJD2tlFhEYdMk731uuRank+ZsO2+UPKluzNNAoSdNmWCEeCY0JBOnKxokH7SvnVENfaNHHVbvK18f7zbUd4k8Fged3TH6W5EmnG9IpyJLb08dbON22Jo9Isj+6EzW5X3nTgjpuOfk78i3yD/m/ySvA7sZxNdQVcz99ox2gZtqoUso3U0TL3UQ3WU+clPyQ/Ik+QJ8mniBEkqRP4v+U/yf8i/ku+Sb5Fvkj8jx8m15BryVrhrQmnPk+fIl8gHyHvIpeQisop0kw6CPIpKbiO3krcLXdtlwOHVgaTkhTuohXsOWQvzHTpQQBOJFTQFsUmSpgWIy8CVRip+vC4haZJMpndDDi2hZS1TieZGHorHIjzoDgV3NTUEuDtab3FTdZtTdX4XV8MggSGXOOV1yJx7DImLNQ0dBRQogEylaDKTSU7AKZnZTjLJzKYG4EfSWHxy9n+ymO1A7z7aQztpjmZphrbQJE3QOG2mMdpIG2iAAmdAHdAiOZkjvyG/Iq+RX5Cfk38iPyL/QL5HvkO+Tf4X+Sp5hjwt9Js/Sx4nj5BPkI+Qh8ifkPvJ+8jd5N3kXeSPyC3kCLmeXEWuBL5whuwm08AhvgXGjEngFTfC90zBb+G/Bby3TBrngdWrCzFdSxZ2Qksg4WsXeqoLO2oNEHv6LOmrjtvP9Hz6LM/Xpq8NVxeOlj7/29JXw/IZ0tferx3qMMzz3mbvvBEnrUJUV7CjTtRYZ9ZcHq1G2JfVaPqIoc2jUd8lrg3VvvzDJMeR40xJ7qyNPjF35EUbBhrd19cs7R9eME913mZDDNdga2tL4o3y986SvibNHy9QD5O/QZI/rr5HbeIzJ3j/mSIXDqf+k+849fARDHKyaJ22gi/HboY5JE3yZG/JEaGS7JcQx6cyPMVrsSkJ4ZfU4mFtR4YKRpfmRYnsxajFabaX9EBDYyLfIsR67EcBAasn+C9cJ2mjxa7qnNNPxXpRMO0VunLQ/qKU3fzQdUfFxFC+X5yOXvswTjT07q/dw+B8dN89e+i+u/fT54du+JxrxJ6JRlyfu2FIpB7aeze761Jx/Xz5RyP72GXDtHFkP9tT8S8Josy5wJWtg9Hj7pK1ocnvAvFEseAtOnMJHPkq5FhJVEU9gFjvVRfujNFLCKolyxxXj2RuozPz7cg8A23aTn8CJ+SzPbC95B8ZXtNfLHSsbF2WSoYCPo+GylNqyp6HG6klwNRB4FFR4ElXqSYoCjwwSivos61L+MJFNrlYWWxK4zJqKBd8f3cYMfcPv7BvpCnaVejbe7cg5EPX3ukOMp+3fD+6B/AcHVx9p+yR2hSFfVo2lTbl5fJH9p+zaiddt6qnv0LUKF35wtDIPuooRI7tq8TVUF9N3akobZAJ+7Q4byg/jESnAxXsfduu3g+89BD545IzIDOVNboQannINhRpdegQxbm626AaEEnV2C6cPNBV6oVLsfcbSivs5Ezls28i/faSb3D92v7ennxLAbdJql7JvM3FJaDJLV1nBk3+rebv3HfqVRhbktjv4EA/udAlz27bzvpmjmOixYezmq9X/HX4eAn4iU3ku3YbdfdAE2sJMpk1Uy7zivESRkuLok9LWDXuSVebJ66C4loMCC27VBvvTaULGJOVjDNnSU4kRqVd9gMCZ7ThTee8fXvJYUVT6WKrDQs47xC6peqYuQ2XVqNUrdlrBqE9bvKKoekaCvL+vA52XhiToConjPM2k/qaKqmMnVS0o/0TMCKKHfDBoq+5PxOH0TSoqy5D1eRYsidmdo50qh/TlJOM4TP/jFJhMBh7XJcl2sUMZZXr4lJ5rdgS/aveKW9/fTxjSX5JrXebejaZ0UN1+Ln8XsUA2UySq3u9+/mHoP0bJA5S5BjtKLlD0Ew7W5mipSjVccDxA3FHvFToYIA4qai7gTqGwowZPzV03bgEcnI5iWvK8nlMyemmDs3pwGUXRdWUKQKsmj5JdJ1uBwFTh3F646MW5LjxrDkqhj7zO2ZZGq3NTayf/zeyg8+eWbMmkVgztmZs0+jGkXOGhwY3rF83sLaU6E/0r+71eussK5GMegK46J7HZekEeu6ed8m5eKsIGKDmLj98+a4ELrQnQMDjIDIHhBEtuj7OpxNqHs/+vJ994OKMAu0QRuLyy8pjMOQ9rmmuGbGGAn/0b8tPfV2VFU0x3rGOrv66pCma7HjXVcez9bfWZz+cvuktN7HLr6vXmcMwlLlBRX1Mlh/XA5yIDSlijLwjR9MOGSSz0k258kuSga1+gP6qr298vK+PvrV89PR2kSOb6LqSc7A/xE1eoC4vqzSKLcRt+kz3bov6vF7fJcThYi6HID5xMTLjgU9iurk5BdKIy+F1XYirFyCuTPmdhobLo8qEfaXQrbrMqEJHKm1joiZj0+ed+X3kXDrXztQ3+3vMFVtKPp9I5DflN42eY7eRrs5ELpHraBegPF7vQktpWWgp8llbyuLWwKstJ66k59sONp181xs0FCbVNAmH3WjQjMZuNk5Fuz9vNxNdfdtpreQ9vb3j47299FD5TnbzzXmaNmQZi8I28103XK6zcZzsvawQcG1FmDvPx12FLec4ucHWrmKa3rEM+mJzHQOuDPWDFKiAPOsAYhs6M8TmgqprYrOB2moERJ5EQ0sYfCEwik4LNqwLoc8CIKGFs2LLWcl2+vLoaculNRIKXyKB0PvPQMBNhlZuR4LQb0IEBO4Xgd0icBKvT4rLo3gJh7bTyLh5wTNAcOEysLDgWRNdQ0/3YnpGuCEt0FOnQvkC/QdShVOgpwT0lBbTU2zeLKxni03ZBXoCNUOpBNJTXkKHs9G3ZUk6/5LlZ/8SerOPLpCl/NoZRrGrF1FwEWUXaF43T5w1p5H2G29IT3sM66+MYSVgufaWpjePnTM8GFIcUhfV0B2QtgK4M2nISSWHdMB0MQfQEjfAdKCdTnYJPJgKuB3MupNEVQXIrMpG165dO7F2Yss49vk1q1vSGaBqMBF3YyvtTKWRTUBXQmcjqGVy3DBEWDLhnzJhovKi2BLAPm+v/QtTjmLey37ZHm+MZ1KRTPkTZyDmg2asdSCVqDOBXdACgZXdOnW0hXtH6fjqDTu95ZMXUMZlI7FiZv1VyR6a7W+Ntp9Gz6bEQH9rRJekNRJTB9pdnvErJvbT7lLpFJodqUasfW/5vUto2gk0vap0CPgFaZA6gdVxOPup4ehoX57NyFyThyBzDtLeLDRW1eDqjAvaKmKyYtt0OqhzF244ag5jl4kMM1Mn8DxP4URiy+aN56wf6OtJdCY6G8RAWqEwxR0UoHAxV/htc+5iKvqB5mlIWUNyhO1Ezc7gG1D4WC0RZyvkDp+B2uzTiT6kMI3O3X0aje8olX6jSEjN5vZ95feyn8SB5lGq60BzDWhu0vHu3nG6355/7xT+GjRhPbaBnF+abIQJhw7BhIWW5EzAH6NMMQM8CwwENdYhOlXVy4mTc+ckcTrR0MjJR9cPrOlbVexoX9Hq97f4gwmf32fabdU27io2o6IrmnAIJjeK8kUVkn4eHMf2hGwvXSOwq3COhQuwTuBNWfdgt48Vc9SUyufKJvtaYbjAcqO5txhaoX9H/9wzcKBdmjGS9/S4dhTpI4Wdzh5P5/C/A1s60tn54nMSdGNefqcd3HFCM4ZW9PevGLKPhnaic4T+rGuQDnf+bLi6DyKrwqcFWs/UkR6g03no1bzHJ3ECPC9w4WQ5ZU4+ZMgeLlFFV+hu3P7TyYw9tc8Q1amozhniZIqTzbgcEmeaxi6BMVihbhhENdPUJommmduJqZmbXK7JLTjPC9OL3u5CW2sm1diAYGeugCtQl/Z4UbcbDehDcjqFLneLwuodp/K8PyGnEkBgxdY0Fh4qREvsFM4J86hIkIirPF/MB0P5qh+iqrcDaWyT1uhUT/0ypiTfxz71/h2GOZDZePF7rJ09O+mh1Ir12+hEg0Xjgfa0y5XtH95GxxrqaaQuHdVPDiedt19kHeba1uFs9De3oRQnXd3YSrPW5kTTuoeatNbOX+XSA97yj+ie8gfoXt090NW9zBk0vD6/ssU/sKo3ZfrqfNSUz28qP1FwZlndXEE4MWUv4Al5Rsf897CxmHtgdJglt5A/IZ8gnyPP0iMlzx0DjOk7YES9Z5SphFek62kSUSIHQh6mcOWARQ2uc0Of9aNlLIO/GR+u9FKNzIaDXqeE8HeqYzZAHW7icM8QdwP8zZCGhsvrKa8TenW4n6URez9LMBP2HrWNxlpbFpRhyDrHUmZrSgl4nQ5FhSagumffdP5/mNcAfrPzmS//5VOfffzRT338ow8e/5P77j5257tvv/Xmt1979RUHL907tfP88yY2jwyvX1fqT3d2JlsSyWS8UagG2XrtBTH5ADMkdFMq7dDWfw/CWABMktteXUAfb2KVIVQU0SoMCgFLwJkrwpS4WEmdFmsS6MfBjrddyL2pjNRKTsKaGZOH8rliCwzLdu2CdEkXoB+OBLw+GgmAjPz5cJ0PBjrDaZpPR/0eK2J5rDk5m9hh0BZJyjqoQRXgcrX2wiMhCGvMPdadanbHDaamHL+R+HJF6q3jepZLwTBdoULwTvrtbGK7Ax9fobKlj5ub4XFPHERFeP56dZmC6ZIOemotDyNIg+IIWlJmUe/aZkV8nkDEty7soX0Kc15YCW9ujlLjx1xxrJYliRVufA/IFr5g37LmFDUdqqx/EMEIzj9Xl+T+UbpGUuWv02jlEXXtGR6RJa7/Eljon8IQ5/iA3wmFmdS5tIMKX7DS1expMaO0kLd9FuUeCp0wCR1jRcUPurCuUNQDOkwmhCiXCAy3gwvmQOejOdDGhlLrmdIrB86cfHvJG4lEWiItIO0mvV5/zBB+AXDlHwWaRGUbLyRXZx50FyZ8BQaO8qfhYx899dGjtsIuXTt5eJKNXzfO/uzGbeWrMQZ1nY4eZQ+7g9TynLCdWE0mt98InMGLuMyGuorSXwPPAoKI2CvfRt6K1vu5JJOViM6cRsjNYBAYungY6DFor5MaslM2nLNARyI7yYxGFbfOZEORd0FndFEHIw50gserq6bbcNV0VFFm9k9dsGV8/bpiQelSOn2+lJVKBXxe3PmlvBn+/NC8vc05oU22wDJ7xdxbCfTjnkg1CRrlC68aFNgXdG6L/clWYERrdnlxbCgq8adP0EdOXXiCfvI1LR5Cn3WoWit46nODcb38qrj0OQuDBScV8eXbKh4p2MHOscnhydFuZuWberq5kXU0NUZ6m7JznUtvGLynMJBi8AnobfB7LZhU51Yaqr3MqBrsW1C2WHBsymSaxIUORUixaLxct6yU8kjh6HCLkr64d3o/8/uL+c7ZVRPS6TekPfsOTVRtutAf8AqyCfXxs3HGpXq0YfQ7hKoDkRRN5pxIfEplwvHHBJ6reHCErF/XmYenW1PBVCqoC71QNFkP5Rd/il5qm7YnFoQZcZv283SzFWWhKDBZJg81dyKgDitw3zXbth+mwt/Oqa/iseua7TsqEVwcy8eXj5cydO6Z1MBYqwOhmbMT/VnGeqth7jj2/d7e7x9bIN/ScPkqz+D0OzeO3HrxsFuyLIt7q0EPhyCKK/N+VKv4sBmynLRBa7+l9PZIQ31A4kacOtGhuMd0ObjBPcZUQPdxrtm66Jbq5egOQqZkyk9lIjlRxc/pdgsm0r2NuJ3uUY/H6bS9tq3u6cq1rVieTSWjjXUhj9/j93mdkMR0aQ5tsQe3IEKjQUcvws8+N3e1wA8dAqkJNa0KuNeKhxzggGT4W+pcpemOO+5g+S9+ER3Yw+8rGvf93VWH/84rK1ST2GckpZzc+yN62fU/og+0x+dGE+3tCfaZeDvdOjx859BQ+UfDw0ftqxgk1ujRXbuOKvLcKFwq7CAMF47qM3D8f2Fm7oQAAHicY2BkYGAA4ulTT4bH89t8ZeBmfgEUYbhmzKMPpQ3+P/ivyMrOPBvI5WBgAokCAEQiCyB4nGNgZGBgDvqfxcDAyvr/wf93rOwMQBFkwMgPAIv7BbMAAAB4nGVTO04DMRD1epMiUpq9ATeAmlRwBLqVKBASB0hBDhDRcAMkmj0ABTWioE4FCKVCiNIFAqGsEOGT4Y1n7LVD8TSzs/N583HpjCkd/ZYsN4AaemWMnUGH7E1Ewk5ed2pj/1pgR2qrNY/a4v+Z+jeSp99P4iuREt/lDt8eLpEVkfcbJ3nd/xwxvsnje5saFzhGXvxPe/S+tJJYyAqoEz7cZ+BzhjxzyBPIVcIn4JAWxR21wKI8oLYchn/0xTGZ7xNwLBz9DqbCLcgIiafwzf2EnrkHmVMCz7eD7Eb04sgYhtfvwXUArgPIW2rtZz7fjit9cH3Ps1a+TvN6XsptfRYu6UHvzMzD3WAeoU5Dy95Ed9FoPvjEvWInem/f5UNyQ7w/wE6JigvkfsRsxsmcrui53IG8Bs7RL2rbF3q3lzlHO0J8mEsjee227JrrcG7vC2m3IE/pjb+LVu37wA39+L7Yd4jeduH7Cn2PAfs8r8k5456rtdvPwL3pO/NxepvyNpZpDPfBO2EZ46twW7BVoR7yZbfV1ec583tliN69hT/7Mhv9AAAAAAAAAKYCMgKQAtIDtgTkBWgGZgcYB2QIZAjSCmoKpArsCzgLeAwADSwNcg6EDr4PDg9oD+wRChGwEgISdhLgEygTchRMFOQVshZOFuoXgBfmHDQcch0gHVYeHB6aIH4hBiGwInAiriNeJkwmqCdSKAgosCloKeAqbirUK2AryiwYLHos6i1cLjwu+C+gMGwwrDGKMdoyijTWNSI1RDX6Now3KDeYN+Q4kDjQOUQ5qjoqOk46cjqWOrg69jt0PBw8fDzSPUQ9lj4QPp4/ED+GP85AIECGQO5BzkLMQwBDkEPURC5EckUeRb5Ggka6RwRHTEd2R8hILkiWSNRJYEnmSl5KwksMS3ZLlku2S9ZL8kw6TFRMbk0wTZBOME8mT7xRYFIcUoxUUlR6VdJWWlb4V2JXyFgsWJRY6FlKWdZaHlp2WtJbOFxIXMZdVl4wXpZe5F82YERgnGD+YTZhemHYYlBiuGMCY5pj/mR2ZOhlVGV4ZZpl2GYWZnhm5mc+Z25nrmf2aKxqwGtaa+psEGw4bFptSm3EbfpuRG6obu5vNm+Kb9RwdHDScRJxcHGichZ2GnbedzR4GniueUZ5+Hoye3Z78HwufGB8vH2AfZ594n4MfpB/EH+QgBSBAoE4gWyBooHYgj6CxoL6g3iEFoXOhhKGOoZghxKHqIggisqLTIwGjKqNho6Sj6SQTJD0kZ6SUpLkk6yVfJX4ltqXapgRAAEAAAEPAfgAJwAAAAAAAgC6AMoAcwAAAfoLcAAAAAB4nIWRzUrDQBSFT/qj2IKIguu7khYh/QERXAlF3QhCF10pJU3SJCXNlMlU7cK1T+FL6DP4BO59Fk/SQaQgzZDJd8+9d2bOBMAhvuFg/ZzxXbODA0ZrrmAXV5ar1G8t18j3lutoIrW8Q/3JcgOneLXcxBHeuYJT22M0w6dlB+J0LFew79xZrlJ/sFwjv1iu49h5s7xD/cNyAyPny3ITJ5X2QC1WOoliI61BW/rd3rlMVqIoJZmXirc0sdK5XMpUZSZMU+X6am7089gLApXl48TnPAyjZerpTXkzHoU6T1QmPbe7mboJs1B7JgyK3fPHqG/MVKZazeXa7isLrWahb9zYmMVFp/P3PBhAYYEVNBJEiGEgaFFt89tHFz2ckyasEFauqxJk8PhDhPOSHXGZyRlf8p0yyqiGrEjJLnzOcyoazxizJ+AoanJGSZkteMiOiOulrNBbq7flR1ytOFNSxkIfLt1s67phV1Z2eqWD4Nd7jkeerk/V0GHhUpeuBNcbfoX3WeRmVHzqbnmrhuoFOhz/3M8Psneg8gB4nG1WdZzjvBXccYzJ7t5dmZlbt73dXpmZmVm2FVsX2dJJ8mZzZWZmZmZmZmZmZmbuk529fn80v135yVL0YOaNshFsjJ/pxv/94BACTBAiQowEKTJMMcMmtrBNa4dxBKfD6XEGnBFnwplxFpwVZ8PZcQ6cE+fCuXEenBfnw/lxAVwQF8KFcRFcFBfDxXEJ5LgkLoVL4yh2sIvL4Bgui8vh8rgCrogr4cq4Cq6Kq+HquAauiWvh2rgOrovr4fq4AW6IG+HGuAluipvh5rgFbolb4da4DW6L2+H2uAPuiDvhzrgL7oq74e5gKFCiAsccNRoIHMcCEi06KGicgIGFQ489LLGPFU7iHrgn7oV74z64L+6H++MBeCAehAfjIXgoHoaH4xF4JB6FR+MxeCweh8fjCXginoQn4yl4Kp6Gp+MZeCaehWfjOXgunofn4wV4IV6EF+MleClehpfjFXglXoVX4zV4LV6H1+MNeCPehDfjLXgr3oa34x14J96Fd+M9eC/eh/fjA/ggPoQP4yP4KD6Gj+MT+CQ+hU/jM/gsPofP4wv4Ir6EL+Mr+Cq+hq/jG/gmvoVv4zv4Lr6H7+MH+CF+hB/jJ/gpfoaf4xf4JX6FX+M3+C1+h9/jD/gj/oQ/4y/4K/6Gv+Mf+Cf+hX/jP8FGgCAIJkEYREEcJEEaZME0mAWbwVawHRwKDm9EVotudxiPRbZhhk9Y1SWsq4wSVca6mksprIuY1pInBW9YV/KsEK7oywV306JfWdrCKhuUZVqqiivNu+1SdR0vXcX3uFQ6LK3dTStmm7IveFZxKUqhejuldcE6x4wLK1HXaWVEURTkiNzrQu3Hlek1k+mclbxQahHP6ZsLk86V6duC8+lc9cae6H3ctXAx/Td9EddK1ZJHtZa9Teolk5K7WcMoYJN3fGmjxrXyWCY661htWJsItd8o6+LjSrWSpcftXFSV5LFk1s3bRHLW6b5IpegWvBJdREa/H7dsv6y6tPWrzDWxz5yKphkVTXTcxpqtKPptLXiVa6HJO5Muo1o7brh1wYkTseFVRYEb3tFf7EtpV5u2EcZZ0RW9XMysaLVcFb2QLrWLFXMUVESG5pGVlNPUSlHxAbstyqdcqD1u5lItI+s4a2fWUakk77Xqthwn9DqXL7koVOwMuaOHXzexWwpXNol/UHjhHmWQ7S0UobNwPF7ysmEuXdJgiQvRcEKyFF2lljZbKlNpSsmG+6KrwxWXOlmp3hHa0Yo1SsWlMCVBInmruqlVfVeVUvXV9ghVPi7bRKpa5VUR2yWveJcSfUynHI8aThyZDWPOW+1WE77iSanaltIJKYYulHzuIiPqxgW9jgmKUshsKAuj9COnlLRxwSyxNjKcSpoNI0EiE+LTkpkqJHBdOucEJje7oWdzzBzVtAmlKheZH3KP8oQwDBvV8tBTIu47/0h9GFKxKmyZkCFhYaZ+GANOe7vGfzA8NaeD5UTL7cybNq+N6nVAPKcW4Y6HflfUEtnsVC3WRaq2x8WD6abfdDDZGjYfzMKGgNj0w6nNopurU8t+klGCVEOhuiOnrIMNmc8opyNF5qs7WNOhxIOZ9Hp4Toy1s4GFJvf7Ntf2sHNSqnpSa5sQ8MIpE7XU+DxZF5lqXNtk3G/jkrXcsFCyVg/FzCthMkfZ6kZ1PNKGOifm+1qRXrQ9sXJPyb7l1DbMlE08rO+ka+LtpNS83Ai7SMuGlwuSk9mYV+4aQdwiYdNW2K0DIyeyuYmaz1NbCmuVsZH2R5DoKK1XoRegqVO15yvtyg7MjnhIYXQ2cp5p07WTSrmMeoYIWxARRsuTcf2SRGH90mvFrCTfYi5KRv6sqDuSjYOoR/6EtZi7hBp94ZQmYdL+MTh0casKIfmEPJKQlNSLsxM9dc0IwHS0PTAH1N45TExmA9JUK+8/pD7qo8EjoUAiIcO5MKSvNFCA/pi5UtVoJgMc+c6kZTomDhBK6cAPD9dID/+qZJJ3FTOz0vi+ykvfYRTjjh92N0kuxEme25Ya8NB64hGgGsgj63mjjDjpJUhGS6qMGe4FynjChElYVXnJSQ9yiSicfCcj13TziAGWlgC0US0V3TpeEnOSPD5Z8NV0mJVGkWTNey5JeKqapCt2SviKLkmNiVGenfnRpGZ9zfOjoaHmno6c8wyYrU1P1Wxt95qalq2IOcRy0gClp4yK1o2NMZpegrmZjZOhXlujfby3RIJV6G/cKTOGQvRnr01/wmw0hy+lo93r2bpa817KsCX5j+d0WXBz6DTvvfLM/Lk5XSqU4dZgd/4WJXRCYrvL/DA4TAar19GQeGKF41Tb0DMg9RcRXYH1pBVl7JswP7p9gPTI1E2+72hDLyxRbXM4qmNDabb/N/FuZsOUAqOlrVO2X1lvHKKjxcOnnfr1CXEpKct8T1jqpzIfL9pJQQJYMOn5m1sfVNbQ74OaLkybLDWJfGs3Nv4L3DjB/nicY/DewXAiKGIjI2Nf5AbGnRwMHAzJBRsZWJ02MTAyaIEYm7mYGDkgLD4GMIvNaRfTAaA0J5DN7rSLwQHCZmZw2ajC2BEYscGhI2Ijc4rLRjUQbxdHAwMji0NHckgESEkkEGzmYWLk0drB+L91A0vvRiYGFwAMdiP0AAA=1

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.animation.css
200
text/css

1
ok

No Cache-Control - header
GZip: 5056/81317 Bytes




local SRI possible, possible hash-values:

sha256-/a6/OOnWB0Wi4s3L+VUL9QBY1JD0wKXu75NnHHZZR1s=
sha384-7pPVegt0/5djdpyrluCRLZIQKbxh+cl1UNhdANgN8dPFbXQx52iGL0BcqI4SE1DP
sha512-iDw2xihN0q2xYyNv1K9Lpd+/zYSLPLcb/HAFJ/i5cePDkEBfJwnQHNEmwx1i/zXO228sTVsuUzOi2vKfRBFRDQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.animation.css" crossorigin="anonymous" integrity="sha256-/a6/OOnWB0Wi4s3L+VUL9QBY1JD0wKXu75NnHHZZR1s=" />




link
stylesheet
https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.css
200
text/css

1
ok

No Cache-Control - header
GZip: 38663/329315 Bytes




local SRI possible, possible hash-values:

sha256-LgDVDwoGerhwepmEYLNGzSgp8cYsrn8pdNyEVhPZ9BU=
sha384-jkLHhg6N/rPiUy8Yr7jOTghcorvnZsi9uUxKaXwd9loRGwUGyPg8bePAuM8IVFXM
sha512-t82GfpTDxnBccbcNb/XKh4EiWwYgKYJq5pkZqOxKlX8FgiunER5nyKwHqmuYviEwMTxniC75Z4BfA9xYOxAK3A==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.css" crossorigin="anonymous" integrity="sha256-LgDVDwoGerhwepmEYLNGzSgp8cYsrn8pdNyEVhPZ9BU=" />



Content loaded via url("...")

../css/trx_addons.debug.css1
images/colorpicker_morecolors.png1
images/preloader.gif1

link
stylesheet
https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.responsive.css
200
text/css

1
ok

No Cache-Control - header
GZip: 5162/38358 Bytes




local SRI possible, possible hash-values:

sha256-jjFe2sdZ+fusol5EUX1v7MhA4Bm/8nixkzv9E+QHGVA=
sha384-1DNa7fr0kn2qX4+qyPe0CvgDinQGeK/NH8pWA90uQm5NRrHIhU7466Ip+pUcKgz3
sha512-3S4mDt2hlF1S4L8SpvBLYs45NQofxDwA1VORAlHIwognH67TC8KmkjP5zqqlEBjrPERqlnNwhfjwu6pb8biQCQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/trx_addons/css/trx_addons.responsive.css" crossorigin="anonymous" integrity="sha256-jjFe2sdZ+fusol5EUX1v7MhA4Bm/8nixkzv9E+QHGVA=" />




link
stylesheet
https://blog.coroico.mx/wp-content/plugins/trx_addons/js/magnific/magnific-popup.min.css
200
text/css

1
ok

No Cache-Control - header
GZip: 1548/5156 Bytes




local SRI possible, possible hash-values:

sha256-W/UdEuht6Yx/WUUWtrXJYT2mD2TIY6gDw+hw+ocfPn8=
sha384-HLYJkL8O9h+MqjpZw1arnyfldrWiJuFrI9/qKs77vmCdno2aPl5/2gb6g5suHb9F
sha512-C9OM+e4rOmiVOrMIxE1VHkM6md47+MpxSNiUSHDoSmX2Kv29uzt+TUP3BRYg+t/tgI7ucoZTfpZTjTnMiBYfcQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/trx_addons/js/magnific/magnific-popup.min.css" crossorigin="anonymous" integrity="sha256-W/UdEuht6Yx/WUUWtrXJYT2mD2TIY6gDw+hw+ocfPn8=" />




link
stylesheet
https://blog.coroico.mx/wp-content/plugins/trx_addons/js/swiper/swiper.min.css
200
text/css

1
ok

No Cache-Control - header
GZip: 2868/17759 Bytes




local SRI possible, possible hash-values:

sha256-R7DnEprdmCwOOU8N+o2WIebJ5BJoWbJuGtJcGN7w2BI=
sha384-vo50hXtn++/P8/rFjBxcsOVc14cJi9ibeQ96ujWvPfEmiojAoHF+bt7cOFv4wkHe
sha512-dLc41mqdowYwgVPGg7/h/HhL3zQWZJLrTnbqAVwyvfHwHF+Xpsfu5UWcE7BOjcY/f/0gV55oCP7UZ+CJar5Lqg==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/plugins/trx_addons/js/swiper/swiper.min.css" crossorigin="anonymous" integrity="sha256-R7DnEprdmCwOOU8N+o2WIebJ5BJoWbJuGtJcGN7w2BI=" />



Content loaded via url("...")

data:image/svg+xml;charset=utf-8,%3Csvg%20viewBox%3D'0%200%20120%20120'%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20xmlns%3Axlink%3D'http%3A%2F%2Fwww.w3.org%2F1999%2Fxlink'%3E%3Cdefs%3E%3Cline%20id%3D'l'%20x1%3D'60'%20x2%3D'60'%20y1%3D'7'%20y2%3D'27'%20stroke%3D'%236c6c6c'%20stroke-width%3D'11'%20stroke-linecap%3D'round'%2F%3E%3C%2Fdefs%3E%3Cg%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(30%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(60%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(90%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(120%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(150%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.37'%20transform%3D'rotate(180%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.46'%20transform%3D'rotate(210%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.56'%20transform%3D'rotate(240%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.66'%20transform%3D'rotate(270%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.75'%20transform%3D'rotate(300%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.85'%20transform%3D'rotate(330%2060%2C60)'%2F%3E%3C%2Fg%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20viewBox%3D'0%200%20120%20120'%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20xmlns%3Axlink%3D'http%3A%2F%2Fwww.w3.org%2F1999%2Fxlink'%3E%3Cdefs%3E%3Cline%20id%3D'l'%20x1%3D'60'%20x2%3D'60'%20y1%3D'7'%20y2%3D'27'%20stroke%3D'%23fff'%20stroke-width%3D'11'%20stroke-linecap%3D'round'%2F%3E%3C%2Fdefs%3E%3Cg%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(30%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(60%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(90%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(120%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.27'%20transform%3D'rotate(150%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.37'%20transform%3D'rotate(180%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.46'%20transform%3D'rotate(210%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.56'%20transform%3D'rotate(240%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.66'%20transform%3D'rotate(270%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.75'%20transform%3D'rotate(300%2060%2C60)'%2F%3E%3Cuse%20xlink%3Ahref%3D'%23l'%20opacity%3D'.85'%20transform%3D'rotate(330%2060%2C60)'%2F%3E%3C%2Fg%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20viewBox%3D'0%200%2027%2044'%3E%3Cpath%20d%3D'M0%2C22L22%2C0l2.1%2C2.1L4.2%2C22l19.9%2C19.9L22%2C44L0%2C22L0%2C22L0%2C22z'%20fill%3D'%23000000'%2F%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20viewBox%3D'0%200%2027%2044'%3E%3Cpath%20d%3D'M0%2C22L22%2C0l2.1%2C2.1L4.2%2C22l19.9%2C19.9L22%2C44L0%2C22L0%2C22L0%2C22z'%20fill%3D'%23007aff'%2F%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20viewBox%3D'0%200%2027%2044'%3E%3Cpath%20d%3D'M0%2C22L22%2C0l2.1%2C2.1L4.2%2C22l19.9%2C19.9L22%2C44L0%2C22L0%2C22L0%2C22z'%20fill%3D'%23ffffff'%2F%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20viewBox%3D'0%200%2027%2044'%3E%3Cpath%20d%3D'M27%2C22L27%2C22L5%2C44l-2.1-2.1L22.8%2C22L2.9%2C2.1L5%2C0L27%2C22L27%2C22z'%20fill%3D'%23000000'%2F%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20viewBox%3D'0%200%2027%2044'%3E%3Cpath%20d%3D'M27%2C22L27%2C22L5%2C44l-2.1-2.1L22.8%2C22L2.9%2C2.1L5%2C0L27%2C22L27%2C22z'%20fill%3D'%23007aff'%2F%3E%3C%2Fsvg%3E1
data:image/svg+xml;charset=utf-8,%3Csvg%20xmlns%3D'http%3A%2F%2Fwww.w3.org%2F2000%2Fsvg'%20viewBox%3D'0%200%2027%2044'%3E%3Cpath%20d%3D'M27%2C22L27%2C22L5%2C44l-2.1-2.1L22.8%2C22L2.9%2C2.1L5%2C0L27%2C22L27%2C22z'%20fill%3D'%23ffffff'%2F%3E%3C%2Fsvg%3E1

link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/css/768.css
200
text/css

1
ok

No Cache-Control - header
GZip: 2854/10371 Bytes




local SRI possible, possible hash-values:

sha256-6itzGltWgd/pHZXg6wBvt16Wb1XmeZJXz5IQvJ7WnUE=
sha384-Ypk4GktQ5OspFFLRktGwoUTeVzXt8JNIzZ/20RqTXVjoL1ei8QwQ7pPc3bVk5yCW
sha512-9Vye6wLIWb38lg/VKhL+/svGKpzoUt4zPRxbZArvUyd+uqlVo47AH0z6sj6571W8gdL9ERv2juncuLhC1doYrg==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/css/768.css" crossorigin="anonymous" integrity="sha256-6itzGltWgd/pHZXg6wBvt16Wb1XmeZJXz5IQvJ7WnUE=" />




link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/css/992.css
200
text/css

1
ok

No Cache-Control - header
GZip: 1828/6472 Bytes




local SRI possible, possible hash-values:

sha256-jDc579K3AnY8YeEFpc611sMoUJGA5usO+UdvxMdm5VI=
sha384-bzfpKdxXszuU722kdVIwRnqSsmC+iGOYFMzXvCztxauwYRbrVVUQfMQMHsE69ulX
sha512-YoomDfj0kLnVslLuzdhmBdBU3lcoWNjhdmQerYEyJZOfP3yznjqnVXPRwbXCQBiNYnT6e4/UvdaXLomIg60bpw==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/css/992.css" crossorigin="anonymous" integrity="sha256-jDc579K3AnY8YeEFpc611sMoUJGA5usO+UdvxMdm5VI=" />




link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/css/bootstrap.min.css
200
text/css

1
ok

No Cache-Control - header
GZip: 3097/12546 Bytes




local SRI possible, possible hash-values:

sha256-AxAOIdIETjKLB1vL0vT4kT/1jy7Ya8g81Z1wUVHhiaQ=
sha384-Pp+upQ75UvwGiB3C6BSzCH5balA3Y3pPQQ/Z2kllyMG/ontEbOfwQDgHE8vS0TIT
sha512-3guUQobnwbolcJEiw0KzPdIufRxY8G2qHVvJUSZxWPwbo8JFf9gsbiPzZGDGxHXbGqz7+Fgydk82Nj6HIOt1lQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/css/bootstrap.min.css" crossorigin="anonymous" integrity="sha256-AxAOIdIETjKLB1vL0vT4kT/1jy7Ya8g81Z1wUVHhiaQ=" />




link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/css/fonts/fontello/css/fontello.css
200
text/css

1
ok

No Cache-Control - header
GZip: 2561/10926 Bytes




local SRI possible, possible hash-values:

sha256-FelXOFjGXGXMF4XSaOqQE/QNsJR2nQ0d/PXodfRqv48=
sha384-nzssPM88N3jPNsndtDnhGjesu8P2qo+Bxc9cMzjNtDswTGwtrcJ/CQJ3niW4R6Qu
sha512-sTHJ+XsTBKTiJ/+LEJddeiyB1GJ5pNEUb260HKXqUUVQCqxpzCD7lP/G0TnQAkUwS8444Pgxbgyc6FwlCIew6w==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/css/fonts/fontello/css/fontello.css" crossorigin="anonymous" integrity="sha256-FelXOFjGXGXMF4XSaOqQE/QNsJR2nQ0d/PXodfRqv48=" />



Content loaded via url("...")

../font/fontello.eot?269172001
../font/fontello.eot?26917200#iefix1
../font/fontello.svg?26917200#fontello1
../font/fontello.ttf?269172001
../font/fontello.woff?269172001

link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/css/main.css
200
text/css

1
ok

No Cache-Control - header
GZip: 17319/82117 Bytes




local SRI possible, possible hash-values:

sha256-KpuDRs9rxWAj61z3veaRgU3tmd11eKT1gFK9LhmDmHk=
sha384-kV+xaGcFFQ2wykN02Thlw4ShlwtNsVOzH+DV8fLYx7IYzR/3kE7pK5z9jhxflVJa
sha512-XeP9sGKda0B9ZBz8atBbLQP1jAs6zdhAzqKE6LYXOmJ6xyx8yQ/KD3nb1LkQ1BZduYQDF867Nqk0vM/muEmXUA==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/css/main.css" crossorigin="anonymous" integrity="sha256-KpuDRs9rxWAj61z3veaRgU3tmd11eKT1gFK9LhmDmHk=" />



Content loaded via url("...")

../images/bckg/loading.gif1
../js/responsive-image-gallery/images/loading-dark.gif1
../js/responsive-image-gallery/images/nav.png1
../js/responsive-image-gallery/images/nav_thumbs.png1

link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/css/wp-fix.css
200
text/css

1
ok

No Cache-Control - header
GZip: 498/1172 Bytes




local SRI possible, possible hash-values:

sha256-vO1EyHO5av4V0n8u8h+o2gj31Ny4uh32topvNGPA7wk=
sha384-AnX3LdiWtVdvx/14r+dSEcl7+nobTIfgjq5YbeDYxJnVTU9C7YNHCSJM7K/fMcfO
sha512-iKFxOOn+AvElcbr+EhL+iZpAbb1whI2/HP9NjqqDUSS+7XD5067fBHAVXasW5LGUnySLibzlkPMyqfV4wt2uYg==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/css/wp-fix.css" crossorigin="anonymous" integrity="sha256-vO1EyHO5av4V0n8u8h+o2gj31Ny4uh32topvNGPA7wk=" />




link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fluidbox/fluidbox.css
200
text/css

1
ok

No Cache-Control - header
GZip: 300/832 Bytes




local SRI possible, possible hash-values:

sha256-su9nEcyEijPjNPnL9pFRGgN5Bz19POJeBBSBT4X4abw=
sha384-p6sdc38nQTA8vi4wzPYJa86Dh6zd83ok1t4mqkd4+qTWYiAe9Pn6dzhlqkRMHhYZ
sha512-pDfmf/l8qwGx1r65EpLvlmrcVl0PyOcslE/zs7mIj+MsoyDteH4NIDVRR2VYeV6linKXPRkS8tXCev66mzyxkA==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fluidbox/fluidbox.css" crossorigin="anonymous" integrity="sha256-su9nEcyEijPjNPnL9pFRGgN5Bz19POJeBBSBT4X4abw=" />




link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.uniform/uniform.default.css
200
text/css

1
ok

No Cache-Control - header
GZip: 1803/8281 Bytes




local SRI possible, possible hash-values:

sha256-ScOT86UD71gbD3LxzIX26QTL0UJo1ryFQ0ZygEuIiRY=
sha384-dF3cF3JRhlbRkqhrag9p5dPIJliIUxVy2U22dWamaTlrLxyfuKIbsASVisqixerK
sha512-E9lCvX8yW7hh3YLqAGXSGafiLQwqPdOODpSckWD7obnVnbHkyE3GjnHgE1MkYG/PezZyHvzpyLf/npJd1VQMrQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.uniform/uniform.default.css" crossorigin="anonymous" integrity="sha256-ScOT86UD71gbD3LxzIX26QTL0UJo1ryFQ0ZygEuIiRY=" />




link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/js/owl-carousel/owl.carousel.css
200
text/css

1
ok

No Cache-Control - header
GZip: 1103/4614 Bytes




local SRI possible, possible hash-values:

sha256-3XuXx62dez63m9xyi8vGp6uOPV2wQh+w3RbTTz3Ignc=
sha384-P9Liqp3g2hdXOYCMNPr2nDgmccEaIeQRyJIUZNgjiS+OwysJEJ4onP4c40zOJKmO
sha512-AVs1DVaNKVmIbtWYK3RZLSYI1l8nVspbPNJ8lawbaM/su49vS8pPPbuwnDvZmLFYlztgxpHvzi8cFqIkrKgPKw==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/js/owl-carousel/owl.carousel.css" crossorigin="anonymous" integrity="sha256-3XuXx62dez63m9xyi8vGp6uOPV2wQh+w3RbTTz3Ignc=" />



Content loaded via url("...")

owl.video.play.png1

link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/js/responsive-image-gallery/elastislide.css
200
text/css

1
ok

No Cache-Control - header
GZip: 643/1824 Bytes




local SRI possible, possible hash-values:

sha256-yVzQG4nyNzXSXlK8iVIfXyI2Uol8vg1QmhemQ7FjKL4=
sha384-T8/BDInt15yl1S7psUWxGMYDkVyUG1XGXssIxp+V+Y1C9+8kK+M4fWFBMcoRH04A
sha512-MYThYPzkNrF82CD5CNNSQLWd6DjbSVoAzvXQViNVlGt/qY+7IVFX14cIIrqE2P8XjGfSYrOoYOFUY21sxI/gPw==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/js/responsive-image-gallery/elastislide.css" crossorigin="anonymous" integrity="sha256-yVzQG4nyNzXSXlK8iVIfXyI2Uol8vg1QmhemQ7FjKL4=" />



Content loaded via url("...")

images/loading.gif1
images/nav.png1

link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/js/selection-sharer/selection-sharer.css
200
text/css

1
ok

No Cache-Control - header
GZip: 2115/5185 Bytes




local SRI possible, possible hash-values:

sha256-NsgMCi1tubgIYYiE+5j8/cuvwV1y+Wn4cWWKQCvmePI=
sha384-rZgWTmk0q/hhoEtI5BlMi9lxtMmadaB8V1Ph/7KmLR9cqji3yUbyWU5hUD8+uKYI
sha512-CIjOzgpZmdpgccxvgKibHM0Iz0w5wNWWeemsAaLMfMK6/+UjnTo4ERs7XlLk1r5BmeySVqmofnyMYx6aLHRuZQ==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/js/selection-sharer/selection-sharer.css" crossorigin="anonymous" integrity="sha256-NsgMCi1tubgIYYiE+5j8/cuvwV1y+Wn4cWWKQCvmePI=" />



Content loaded via url("...")

data:image/svg+xml;utf8,<svg xmlns="http://www.w3.org/2000/svg" width="171" height="139"><g transform="translate(-282.32053,-396.30734)"><path style="fill:white" d="m 453.82593,412.80619 c -6.3097,2.79897 -13.09189,4.68982 -20.20852,5.54049 7.26413,-4.35454 12.84406,-11.24992 15.47067,-19.46675 -6.79934,4.03295 -14.3293,6.96055 -22.34461,8.53841 -6.41775,-6.83879 -15.56243,-11.111 -25.68298,-11.111 -19.43159,0 -35.18696,15.75365 -35.18696,35.18525 0,2.75781 0.31128,5.44359 0.91155,8.01875 -29.24344,-1.46723 -55.16995,-15.47582 -72.52461,-36.76396 -3.02879,5.19662 -4.76443,11.24048 -4.76443,17.6891 0,12.20777 6.21194,22.97747 15.65332,29.28716 -5.76773,-0.18265 -11.19331,-1.76565 -15.93716,-4.40083 -0.004,0.14663 -0.004,0.29412 -0.004,0.44248 0,17.04767 12.12889,31.26806 28.22555,34.50266 -2.95247,0.80436 -6.06101,1.23398 -9.26989,1.23398 -2.2673,0 -4.47114,-0.22124 -6.62011,-0.63114 4.47801,13.97857 17.47214,24.15143 32.86992,24.43441 -12.04227,9.43796 -27.21366,15.06335 -43.69965,15.06335 -2.84014,0 -5.64082,-0.16722 -8.39349,-0.49223 15.57186,9.98421 34.06703,15.8094 53.93768,15.8094 64.72024,0 100.11301,-53.61524 100.11301,-100.11387 0,-1.52554 -0.0343,-3.04251 -0.10204,-4.55261 6.87394,-4.95995 12.83891,-11.15646 17.55618,-18.21305 z" /></g></svg>1
data:image/svg+xml;utf8,<svg xmlns="http://www.w3.org/2000/svg" width="94" height="64"><g transform="translate(-10, -10)" fill="transparent"><rect x="0" y="0" width="114" height="114"></rect><path d="M12,12 L102,12 L102,72 L12,72 L12,12 Z M16,12 L53,49 C55.6666667,51 58.3333333,51 61,49 L98,12 L16,12 Z M15,72 L45,42 L15,72 Z M69,42 L99,72 L69,42 Z" stroke="white" stroke-width="5"></path></g></svg>1

link
stylesheet
https://blog.coroico.mx/wp-content/themes/editor-wp/style.css
200
text/css

1
ok

No Cache-Control - header
GZip: 700/1651 Bytes




local SRI possible, possible hash-values:

sha256-SOcfmsNejITWF7mrGTUTSW3TIF2jG5bo7yMiy4IuLoo=
sha384-NaYR6YtRHMCo+9ACT7WLvDdMQOiZ/10NAVuYDquf5B5HsmGeAeHNhaXPmhQANlbb
sha512-2k0qLvuIlUiZ4qt0+lzN6Yoyc7TfstVSkBgBWNX6MH6rCoayy5CyJWDVtHRqz8e1853QOVMvTHu9e/HODkCjUw==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-content/themes/editor-wp/style.css" crossorigin="anonymous" integrity="sha256-SOcfmsNejITWF7mrGTUTSW3TIF2jG5bo7yMiy4IuLoo=" />




link
stylesheet
https://blog.coroico.mx/wp-includes/css/dashicons.min.css?ver=5.2.4
200
text/css

1
ok

No Cache-Control - header
GZip: 28481/47558 Bytes




local SRI possible, possible hash-values:

sha256-GKpmwZLL70OmGxOYwpKuXGwdQNZ5Qo7pmLHGv69h11o=
sha384-7C8ocYrcXKR1loNXUOAHzjPE8vNG8p3JYegoiFGi4iky0Z7lBk0PHtW4mBKFRMHq
sha512-pcovNCBqzLXyLsC0xKfgUL1XL3Cin185XCx4kP0IQbOy0hU4rO79fmagOWCcuIh4/krk85m5TupFb8PyfOVVgA==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-includes/css/dashicons.min.css?ver=5.2.4" crossorigin="anonymous" integrity="sha256-GKpmwZLL70OmGxOYwpKuXGwdQNZ5Qo7pmLHGv69h11o=" />



Content loaded via url("...")

../fonts/dashicons.eot?50db0456fde2a241f005968eede3f9871
../fonts/dashicons.eot?50db0456fde2a241f005968eede3f987#iefix1
../fonts/dashicons.ttf?50db0456fde2a241f005968eede3f9871
data:application/x-font-woff;charset=utf-8;base64,d09GRgABAAAAAGOkAAsAAAAArpgAAQAAAAAAAAAAAAAAAAAAAAAAAAAAAABHU1VCAAABCAAAADMAAABCsP6z7U9TLzIAAAE8AAAAQAAAAFZAuk8lY21hcAAAAXwAAAfLAAARhDPzNqdnbHlmAAAJSAAATqYAAIQUYJTKLWhlYWQAAFfwAAAALwAAADYSoxtRaGhlYQAAWCAAAAAfAAAAJAQxAwhobXR4AABYQAAAACMAAAQ4GgT/9mxvY2EAAFhkAAACHgAAAh6YX3d0bWF4cAAAWoQAAAAfAAAAIAIpAKBuYW1lAABapAAAATAAAAIiwytf8nBvc3QAAFvUAAAHzgAADrBt7+iZeJxjYGRgYOBikGPQYWB0cfMJYeBgYGGAAJAMY05meiJQDMoDyrGAaQ4gZoOIAgCKIwNPAHicY2Bk/Mc4gYGVgYOBhzGNgYHBHUp/ZZBkaGFgYGJgZWbACgLSXFMYHD4yfHVnAnH1mBgZGIE0CDMAAI/zCGl4nNXY939eZR3G8c9J0rQpraS7QQrpbrBAutOKkDaUtKgIFCh1lg5onW2hQHF1Aw5klOUWcW/FhQsVceIeuHGhuO+FKGq97lz8C/xg0nfPK8+rOc9z7nPu7/f6FhgGtMpcadOfu2ioL92pV5uh11sZOfR6W+s1+vl8+vU7k0NHGB3Gha5wXFgcloWBsDKsCuvCBWFr2BUOxCZ2xK7YE5fG/rgidaSu1JOWptV5dV6b1+X1eWvela/Ot5a20lG6Sk+ZV/rKQBk8fBgCYVToDBPClDA39IV+nXkwrAnrw8awPeyOxNbYGbtj79CZm9SZulNv6s+r8plDZ96Qt+Xd+dpCaS+dpbv0lgWlv6ysZ35MvhqtyHN5Pju4gkO8k/fyYX3fwV18gW/yC/7AH3moGdEc1cwd+j6pOaNZ3+xo9jcHm0ND37c1dzT3NPc19zcPNA+3jGwZ1TKx5eihM7fSznBGcASjGMfjGM3ziIzX+o/kkWa4zjqsaW86OJJOxjRH8GdexZV8n6u5hqt4Jac0o/TJ3soTOYlX8xTubdqYyCS6mMwMnswxTGUOszm5GU2LruM3/JZf8W2+qKt4D6/Q1ezmFl7PG3gdr+UffI9vsYL9nN608F/u40e6vsxRDLKS57CFXbxA6/AsnsmzuYidbNLKXMFWLmc727iYl7CRF3Ihm7mUF3MeB/k4b+fdvIs38WYONzQNP+U0TuXH/ISHKPyAfezVE3c9N9DDp7mH73Acr9GnW8d/GGAsl/AErfODzUg+T+Lp3M8nOF5P7c+5k5/pHtzMTSzjHRxLNzOZxTSmczRTuI1P0st8lrCYE5jHAvpYyCJ+x2e4ln/zDF7OS3kZv2Y1v9RdXMufWM8FvIgT+Yvu6eNZxaf4p+7z1/TIHuJj/JCP6r5/ha/qX31Ez8CH+CAf4P28j6/zXfawgYd5EtfxFpazlN8zgbM4mzU8lTM4h3M5k6fxd77MZ7mbf/E3buSN3Nq0chkHeIC3aXd28Fe+wef4Erfr8Wh/jJ7o/6evUUN/3e0fmiNr9bBau8Kjan0LLaYdRWg17S1Cm2mXEYaZ9huh3eo7hOGmPUgYYdqNhA7TvlTNMu1QwmjTXiV0mnYtYYzVmhvGWq2tYZzxiI4TrKnvOdGa+p6TrKm/O9nqExC6rKmfZYpR1+EYo77/sUZ9/25r6jVONdUNwjRTBSFMN9USwgxTVSHMNNUXwixTpSHMNtUcwhxT9SH0GKfoeJw1dZ3mmmoT4XhTlSKcYKpXhBNNlYvQa6phhHmmakaYb9yr4wJr6v1caNT1W2TU9Vts1DXrM+paLjXqtS4zVUdCv1HXcrlR12yFUa91wKhrsNI4WcdBa+qzsMqoz+AaU7UlnGOqu4RzTRWYcJ6pFhPWmqoy4XxTfSasM1VqwnpTVSRcYKrehI2mOk7YZKrohM2m2k640FTlCReZ6j1hi6nyE7aaegBhu6kbEHaY+gLhYlOHIFxi1HXaaeoahEuN03W8zJq6Jpebegphl6m7EHab+gxhj6njEPaaeg9hn6kLEfYbde0PmDpT3YZD1KOIjalbKUmY+haxzdTBiMNMvYzYbupqxOGm/kYcYep0xA5TzyN2mrofcYypDxLHmjoicZypNxLHm7okcYKpXxInmjoncZKphxInm7opscvUV4ndpg5LnGrqtcRppq5LnG7qv8QZpk5MnGnqycRZpu5MnG3q08Q5po5N7DH1bmKvqYsT55n6OXG+qbMTF5h6PHGhoTwWF1m9HXGxNfX+LDFlAWKfKRUQl5ryAbHflBSIK0yZgdSY0gOpxZQjSK2mREFqM2UL0jBTyiC1m/IGabgpeZBGmDIIqcOURkidplxCGmNKKKSxpqxCGmdKLaTxpvxCmmB1z6aJpkxDmmRKN6TJppxD6jLqubtN2Yc01ZSCSNNMeYg03XhQxxmmjESaaUpLpFmm3ESabUpQpDmmLEXqMaUqUq8pX5HmWZ0b0nxT5iItMKUv0kJTDiMtMiUy0mJTNiMtMaU0Up8pr5GWmpIbqd+U4UjLjboGK4x6TQNGvaZTjboeK426HqeZ8h9p0JQESatMmZC02pQOyatMOZG82pQYyWeasiP5LFOKJJ9typPkNaZkST7HlDHJ55rSJvk8U+4krzUlUPI6UxYlrzelUvIGUz4lbzQlVfImU2YlbzalV/KFphxLvsiUaMlbTNmWvNWo17fNlHfJ203Jl7zDqJ/xYlMaJl9i1M+405R9yZeasjL5MlNqJl9uys/kXaYkTd5tytTkPUZd+72mnE3eZ0rc5P2m7E0+YErh5INWA2C+0pTMyVeZMjr5alNaJ19ryu3k60wJnny9KcuTbzClevIhG7rGG01Jn3yTKfOTbzalf/ItpjmAfKtpIqjlaIhmA0pjmhIoLaZ5gdJqmhwobaYZQlOtaZqgDDfNFZQRpgmD0mGaNSidpqmDMsY0f1DGmiYRyjjTTEIZb5pOKI/SnEKZaJpYKJNMswtlsmmKoXSZ5hlKt2myoUw1zTiUaaZphzLdNPdQZpgmIMpM0yxEmWWaiiizTfMRZY5pUqL0mGYmSq9peqLMM81RlAWG7kFZaE1d40WmKYuy2DRvUZaYJi9Kn2kGo/Rb/b+Sstyo673CNKFRBkyzGmWlaWqjnGaa3yiDxu3/A94hA2UAeJycvQmcJMdZJ5qRV+R9VFZmVmXdVV2Vffd0Zx0z0zM9PSPNJXWNpBnJuq2RLaolWTYyPrGepbIxDzA+sQ3u2t3nNRiDl8umx2DMmrU5bLxMGQzsrjHHwq7dvWB23+8tLDx4uzX7RWRWdfWMBPh1V0VGRl4RkRHf9/+uKIZl4A/9f+g6ozMrDFMPO23PT/47OMRiuoS8NBZNJGL49zrtTvsUgmQNytc66HWfbijHfN32vGK6WN359DLGOUlS8ilbLqh6rZIvyLqa1rAr5SQXf/PTDZU3JcPRLQHjAZwN5djDcIYuF/LlGV0tyLZV0DDOY0yqFtfvy+jLjMaYkFsrorSBqsuouYGcFkZM55F2+5HXPNLuPPLUh9CXabb9yKsfbY9+/4uvIJfS6wdoyKQYxonWvAJKiwsIt2rVxknUbPf3vGLRi/qRWyyiYdG95hb7fboZP/tr6HeYMhNBrt1qh42wgat4lXYGTrpkA5Fe6bRRu5P8e34x7i/07xBCLJY0zKszizMrnqaqHOcHfqRmarmcP7rX07AkCrKRWrRkEWv5pVn04xwribIoIyT6+Vwto2cCL8iwrKdmjtQXZ0Y/aqRVPyUbis7ZcrWm5gQ+qesQ2hkyR+A91kTs41DEbq3VCHHYaYS1VtTuhB2/3WlFrud3fOz5EV5rNxtVMe2h4VFszLZnvaAb+LA1cKcjmrPt0Mt3Aw+2hnj06+Wlpc2lpWHOD+MT6BV+sJVccfSoaISk4HXktM0lUiWO1usL6POMzBjkHSCoFtTHb0XYdystv1Vz0SDMffzjuS/0moPB6PqwhxrJfjS7s7PzQr8/uc+30J8wHlNljkIeethEBoIBCy0wUQOG5QbyOLJLRmvaa+OOR09ZZukxHwazt4a+6JqmG7rH8k9b5WXraWyQnWP/7gck25e+X7J87WkJiryjxxbgvFn3aOFpu7KEfgnOgRMN/LS1XLaezpMd0xx9/Qck30KYphEt9Qxj4eDUCqk2T+u+j/YZh8kz80wb3k+r2VhAYQ3XqiKMSC+qrLXDNS8tVhvNth/ZcSZag+7B8LrGu6hrqgvVXnVBMU0FMao5yNXrrUZj2CdpIOJuL4pze9cUM4pMBTbmpxotclY4+mt6Nvv2t+cepDmolhxPMvR7jMCoMMNcJgejvc7MMfD6EH1TJgpbMFrgRflkvxSX1n0YWjQhRyrkNb761a92+v1g+zt6va0mpjv/laajfu866vWu95uo2UR3X73qPPvs+v0POA891FxY2H7ssdSzz6ZoGj340EMPwnczgr9kTP8R+i+03+gbx/DCTbYG47kN0847GL4/n7XtbOHSzJFuo5v9rZReyJw5ExrpdD6dRr+SPXM6W9Ct+6THot+o31OAU99CDuTT4zlO6ANH+qJjV2whcit2NEDMaG94g4n6qDvaDSLUTcbgF9GXGAy9VIM8dES7yGLoHZjrQFXIazqFWs1O2ycHTITuvnLkiphJ87/n75f0UiHzRFkte2oZy1+EYkfAV9D74AwspP1mYd/VZamsenDKK7OF6kNQ7GTEKwkN+2P0nxgYTgge1qDDmkwkSmQaMVEOOx4d50hd+bEVd9VO24K+vHEBp7MpT9GVlIkvbKykV1NOSkC7yz+6ovOQXXXJKWZK0WU/lXHx+Y2kfDLnhugajIsF5jyMWrvZqFWqomvHI7YekSG7gOj4PIlqZJCuQ/Pba57rT+8V0PSZLTQ01dEuHcNd1bzBZFXTVLOSIk0y/YAcDbCKA1JEMj3UJGWj65C+03TNhoih6ZB5N8k8eEvJeN4NWQS8I2LuZR4BDlA1ULqI1jZQcxn5BsLLKGx3GlUsAsMrIELdG9CNnXYIc6+I/LV2x+OgtNOG+dMI4WzYUBKfsEgPRiQH9F7E7c7extMbG0+/lSRvE3xLXiwJpuyIMs9KnlKv8JIRyEZBbq0ERZY3efyvHY4VeCRLqljAGrxsH+cKQcUuKylLyLgX32GWZMtDPMskd4Xk43YelyPdVkVJtWUd8XoGOZ6LVNXMBs6xiiXpoz9Pe3rWkU0VcyzP8XK+nRIFnuOMwjySZxbDM+gZUdZNXlUZmPUHfTQLnOME86qbesmBXLsDnQEtrZEOEkPaaYTrhaR/DNToQFd5PjnUWEHuMkwE0nkema5kgMKxuOfIv+iSLoTcBgsvYKrPNEGWWMHQeM7VBV1KF00txcumFCr2/XaOlVE6d45bU9MidgJIq7ovsCyrszwv8ClBEnWMS34N81DIYbuscixiOdW76xVHXH+6C0e/jmUkSaxUMPWUhpCAOc7SEOZ9QSpkbCXn8CXoLREOsbzgvk00ZQUeYQqSLrAyL8qen/PYoqe5hggVnvFUU65Dby+v21a6Bd1pT/VpiskwBaAVs8wyjMFjzCZzltliLjMPMI8yr2Seuqmvhcjza41OC0YWwCu/1grdGhlrJMXwjUQ/cmsNn3RhCCyUTP+TCDZwhByHQQp3COE1QUpKONiFM8mVeKqrR397Gkkd82sNRxI0mX20dl6UnMajrNw4zZsdKXj0svwwOfbUOQHKH0FQzllHJRbJR02usaz5R8r/w9eWyuUlzV8t/bWvL5WPTHfx/1urVn72brOuG7Vq7ex33W3q9VeerVXPzlSq585Wb7vLqOvmXZeg1PiupLg6U61WZrZnCt7C6cLMwug/14re4plibd6b0CHan8eZC7eMT9wej60QBiVpO83EA4+OVhiZRZbOVzJU8fjsqR4JngTMZcgpTZB4LuOcXGbNkuP0TgMS5fmUbkh5UZEMPbrLdbBQVdqBagFN0jVe4g6Nra9sLVY9R8MK5gn4kpU5R9NyG3dx6Ww+U7BZkXcQj41SztAUS7u7ttx4aME2ZEMVFeUA7/4u+iqThnHDEICTcJUGzBfsA6QRvITroZ/Kniu/02k3nJ/Q9bXTpTsu3KEYo49gzzQ9QEBZw/gJp9FyfrB8ds1Q77h4R2nzc9gk6GfynM8C30sDr2dQlXTICszk9prvJWAfdwBtF+gMrpKDLcDcEWLSpi6LPCfa6a5jCxxMCM1Mnyu0y7la9ciVI9VqrtgqIcdQHcPWG/lyOd/QbcNRjTMr1XZ+E8uCJAky3iy0gJ2JtNEY/T5Fh0VAr+vMXQzTqrQAV7PhMotbFd+u2YJBCEgLUBy8P28DLUPPeEA/4O1uIJgrHUKQioTwvEgZYjZONM+m06mtV67dYPauowf0TqBJ1pIbOFd4BbNAgdFlP8qIAqsI/GzFUTlFZjmDz50uiSIri0J7KUjRMifClufc+0xz9baMjoPRAPV+N3B0Ub5qS4reETgkKyKS1MdNWUSKIiCorm4LrKjwfscxBCTDs5BYtHMCK6h8ecJnrwGf5QBZAFF2Kq0KalVcDNsu6sEzIgAiNNOH3GDQi8glwk3XmYCT6LUOoLF6BAl8hfE99vZQtgt/o/2pG21Hg2gn+gfqUECTOjA3mMNVeMnn0+fC42sRhYbx9V1I9/rdbnKPnWgwSJ4tTWQXch8LMGgWxn4FUCggjopNaoDdKMHGLcAWHZBl3PGX1HM46qHt0XXU3O8S0eO4Wxxs0z9SFqEBHO4G3S6VX6Ko6GaD7eZ2sB2M272PBuN2IyKUVOxKnSDavVEzS68OBmjQbHZvMLtBkOCxa1BficiUNiAyAMR7zV60uxv1oDLDXrC7G/SYifx5DW2T3nKI1BX2+304EfX6/ezu7sE5fdQksxIwJepv91C0s3NwjGAwidaNPgofPAMFyWMn527DuQK5Dzk1eQqKnzk5pwv1Yam0j7rwGra/4/BzOq1KSBsVoSh+zLhxh59BMKePB/QRyRPGx+n9AdAMd3ZQb3L/pM/qNZs2I5zUfvKgW/qsTqWNpAGDW/qsS55zCvm7273dweCmcoQjFGwPoY0JvbuGPgfjCiQbx4uhs+/FAjuhKqTAIBCQQhvfowCnQRDMH2IWSRrLpTTfKASK7xcLgpAtrKx95yOuo8on6o1NXJ+TVUmYmVVV9PMcSPspxVIlSw4yoiaIp9vHo+PFEtdanY9WrqS9T1ooSHlpQyzYzngefwr9DsygDNQvpDX0cQmwPuniFRgT2Cejn4DocJyB/vM7Ud3v4LD2XYbRLK2vl5qGEZXX18sPz584ce+J9YVYYj9TaZ2e2Rz9Zbm9ObOJ/o/4PHJ+OYLzf/XEfetwcjYW2vPHtB8+9v3H9A8dS/rsd6BeJZBaQf5iDZZwU4r2Nthl1qCDzN9gcaPVWSWSYaeBHl07jqNHXr06s6bPy7PF+r3nQmHpznvPOUdeUJazj7x6Q0LZbPd1iEe/AHuvPI6D1PGZXGnNcuhpcHIjc9eHMmvHxT/DqvDcc5fbiGUm+o19QFfAFzsVtwKChA1CMcxVIgF2bMITiWSy1qYiGzS9TLYgP2wAq4ZPN1oqoWZpaTQALvggCggfGu0JVNGEJveHF4IiO7n7OrJr5O5RBQ2i+J57e0QiQQHaHW1P3Y+ZruMx5gy8QSCDUD8XPoflJLE2FpiSbTUcF7SoyOSPxdphtFL084FbLLoBPEPXIYnGmWCpHA1AGAKOjvZ2o+KK53WL80VSpBzlqbDUjFP+KNlsZ8tLu7sUAJgx36U0V2Z8ZoZpQY3fAHUW3TSIrq12w283oOWABLxordM+hLi4aiwJARyI1XGdg3M34CgAh3ZnLY1XiQIDJhMcbBKd4ZqLoYRITDUCN0QMt6Y3fF3JyvEIPyoarpnjsWgbnqkvdR7rdB57DUk6s+ezvM2Xmg88+UCz+cCSaKStgFd420wXH26czdg+FoKiVXQAoJNXnc9gIesFlYIkHq1lLJPPLy6trVxaWbmEHp/v1Gtv9URF/Fiu7NqLqXTKQgvJcyAZva6QE1yhRR8EyVvpWY7HziC5nGN5pLwx5W94DjZYjkPCc6mFanlRVYwSX1i59PJLK6RbE8UlDAcNOFkDcP8JwPyP3aS99Ke7FB8+goswVvAGIK4GJuOAjAeir6NyQdQkWM1kQ0rBXL8yhr+IOfeGs2ff8C6SnDvz7OnTz76DJGfWn1hff+KNJHnKdUqhEVQWHyktLm4sLl7S0yYInixbds2sJrfb7bpvSwKLcryEDc1SdZZJbgiJntwQkmxyQ0gWNbxaDjxxNldaDMhNNxb7pmjpKd3U2vk03MxttZBr5dK+MxP49HkJ7gN6vA/8gMzoOUB9RPJshtAr0N7OOINbZCoU4sKpvN9shDdNI7hgrLpeo2R9A/p1rJ114+49iSbq7b2sYllpczugc2g7nhjJprc665e9wCv7s6uOOy85nuZUidZVmp/dtdLavFxxdPPI5VdcPmKYTllOe1oa7WZySsG1TCXZvvdB1bSUw4mVXzFOWb5vbW2R9JSxctTzdQ6DXCnyMub0pe8UOZsF5uF38yu53Eq+64Ogz0oyJx7oEgkf9UGqXCFambHepUGJB8CjNKb0RqiQtFahsGk6n1AjOBFSoHPNDr0Deuia5XnWHOtZgeWxc7Az+p9TSpcZonA01Rsk3aBUJp+cmocd1IXOwgJplIBJ38Ud2Y03WyCRjA9Cdoz5+tAOA97+EnOSOQ2S8UWmS8cACBt0bCcjYXqXo5rTeBRAa+mYmN4POy4+hVwTxVv8p5qka6ohaf6SN9AkQ9V0SfOW/A+aSkSaEynmgKZ0fy8CSJp80DNWNuXatpvKWlnHyR7aG/39kFwyJLeY5D4WRPQ/m42CJnwnfOUXoZ0rVINJFJi4FoqxGslPEz2JiP3WMkuJKXBUt0OlV6DB6F1VOTAj7/bcbV7bDOSa7bDCXA6bUbCkphc3lhxlOWhZcn5OYB10NXVHzQvYfp/LebU7bRlZZuWU5SmPv09av329VoNE+sArpKy1WTEtxEzxqyGjU/0qSH4+4O0YETlhJ8TwAeQBUqePmCNX5sujnpsLZkqN4WOPqcfFP9Ui6bEHlB/9CTTcLJdHeyhIZ9J5Kz36vjvPK5XX6K/PSOcvqk8+PaGJ6Gvo15lLzP3MVeY1zHPM9zEfAHxHlN4rKE1esJkoiVqJyNvukMEJPQT9QYdoNNYmJtt4IMcnkHHv+eGYdXbGdJNo/cnAgGEE48SPR0tcBPOkPd73p/LoC97SKV/S5JTsyATJyZrkn1ryrHSqxgqVwGjIPOHJwGua8CVZXg71oMqz1VywL1tk0N8fs+azAvAm+HJ8wN8u81swycUtET+4RXSUJClRHEKSv/M3l3yQmF1LUgUR5FM3V9f9pU1f0ZWV45pRPe4C2wEWr5Nr9TiFXdYU3eNVQzu+YtlPxPMtijcf4DUAPgK3KWJJkaR1rEqSiqMYDiW0ZA/9GeVTZA4yiJhSSMdRg8nBTrtJzIDkRY1fDXQ9FqanJnQoUtWy+n6iwH6/ik5qJe19mk/y1qtI2auWier7/SQZfUOVNBUkYTltSlX071X1/VrJJ8dOqvEZkHz0VWrZ1+Aqeg+/pL0nlXNc28k4geHnJzLru9FXQWIsUC2GH6sqwg5BqZ5PBrLfMBGBMMAtgViEFHtgD2Vfn1po3NtYSL3OONY4FWV1LRWsrL4xA6BtNqhlGpvpwNlseL4Vosu/O+M5jjfz1UwO3Tmz6qqmdIf2/CKfXXbfFXhLXiAUXJBaKV1mmSlZ2GdygJxrgOcXYPZHTIdZZ04xDEGsPkiu4y/+NvJE4qUSdC+KtpsgPEXDl870iJQOfyzTJZuo3yR//ThP070dkjugBdfQb4HUvUztU/FUrGHfxWGrE1ZjXa6BCkTVS0FhB6AeBTANtKvbGTVIOXNWEKQWXCebUbAsCW6+srJ2bqNk7c6EWr1Z18K7Nste0ZB4brHSzee7lUWONzXZ0jP2JpYEycAYPXf80pEjdx890En8FhNQzRCRjfEY9UAd1hG1e9CaElkonFTn8tEgOLoC/I3zC8WFsBguFAs+J6bdt83B37guiOnOzHQ1P133N8jDEXzFDb+e9sXU3Ny/HVdjUo8h1OM8cyf0DumaGhGQq1iM+6Pjkaq0mnUYZESETEAGIWtQp/a4O0Niaoj/Ycr4UGk0sLJGCWUfeSR7vJANytXlubnlajkY/Y1Z5x1B0gRJNZ1MXsI6Xy+l9QzPI1a0nrZEFvF8Rk9vr6+v7xkix7Vf/sjRwDt2QZJEjOBdSdKF9llNzNhBRRBFLGDOtjRL1LDIGYGu+gUrDK2Cr+qBwYl4MfjgB6GZesITvg7jt3Ro3N5G234XcyWWj+zDtNitUe58EhHq60/lHcJRYNiuI6IOilx8U348wlG/O+p1/ZLfg+9eTKF24w0d7r1mcxuGdrIZ0AGOBqM+6mcJrMjSdJOQ0k1CFye50VuI4mqfDv0sHfQBTaMxT7q1rd9e+1oVtxOr2ug3bgdgoR6AoBdpx6A5IPXeQdv/SL0/uLeXvUb/DubnPozB2BYKGA5kXYroYjm1E3ETY2j/Ts201NHTqmVqd3Z7EVUGnICRpo1+V02lVLSsWSDNnrjvBHym7XzEBkr8JEg77BquuZ2xTXrQRf39qL9fWlo6tbSEgHzcYFDQ3Bsmpv4Y5/wn9H8T7W0n0arAeE/sZBso1i/T4gZl9Q2qW0kQO6aGJUz8Jqii91BWjFKXzt3ZdXRdzRu2krZk3dNEnNFLmu/mEZqp6ZLC866ec2AKGynowlKx4qb8hRkeCTI/s5iyZks8Kyh8MazbqVmrWopaZa9SKCgSbxs8BrZlYZ5DogHyYJn39IJ6LKWyngEsSrNk08rIsqaVlzKcLLFcZilXnPVYBbOsG15YP80wB3rEIXDSKowlphONEXfLTgA6GU0VXMPjPo0mnbs3BtYUh3ZVE2319nQA4GXf/xsYIGXPo4K7ihi6iXa3PSgbf6b0FwNixXYqZPz6MCCJJqS327wWoC68r25z70CGIHUtgHS6Qrwp6jYVNquUKmHY4rB9sI/GFRUmLgrjDBpqBIJY+tN6ORDbHEEn2hbaUSn4Gf0HldgizI/GWChC62LGIHDJzIqfUFJGKMvE/Ub38fejfgxZdg/JDZOxORzrZ+t2Lf4nY3S4HfWi7VjBG4z2hsMpTFtmViGXFrFdITCyTQUjn6okyC7ZukXE2dhLxMdQJNAADXV19PwzAnQrqgO5xI+YngVcSdVX7xPhRcypMPQuo4+raX70yZ+RFTJ9ecHS2I9pKcvnOE5wRv8MFX4EjoAwxaYw+/Zp/kr0pjbkWgD23dCNJkI/YlYvHxleW738+JUjR64gZvfI5dXBtSNk5/HLq7G8xDJoBJhiiWkzx5kN5gxzjrmDoB6PKjBhFokEpQFmA5wWgzSC3al7QGsZ1WCG1UQ/eXFrJgKOiQ9/0WrNLOW1dBYhjmdnMP6W5EpfwvgvsesZz5vAclgWabrsaVruikRf0Y+nfiz1pcn3R53fTP2Yg/5mhiVsKuNqubIxI7lwA/wluNW3pDPGC6aT0zRP1nXEsZwt0fdsw1XPwx1emPpOvXuCT2du9v6KNSexFgXAHvYBiq7iNGKOvrzTefmzJDk6f25+/ty9JMlwHHpdNwstGyYHIRntJEch+X4Oofbl554TVObQfMrBtkkmQw1mBUnctG8gN/aAaDbQW7kT88VVQ9GDBldbbIGUXG8toYCzhfmTgO3rOYUV16oz7fb5aDL3fgf9PrTnInOZeTOhtk0i8RFvtHXUog8glMMlU4ziauKrJhDw0KZqNwLCfEIeO9RIHCe+12416mPVcIdWeAG5scMbMZQVkCfSAnKESFLVxj+XFE0GPGCmTFbVNJU1U0BIJaSkl/Oqz7HLM+GVUiGLpUL5icW8bmiiqrKWYplpnxv97QJhHidUDi7CiiTLqkx0b3rK5Mi9kJ6XZZZV1AIWdNXAjiKZkuJgUzGFp9xiAdcXZm9PpfRc9s76bHHG9PNWypJ0GRmiwrJ+Ong85k7PCQ42VF3ABbgdr8h5SYBbxLc7mFe/ib4E/dmm8x0ILg7jDaXAPp36HUpwQ7oxUeKY4MdeDKcQ+lIuzC2nVFNNSYoi9WlGVSVr2cnnvvA9jiwqgmQ7blpbVNPO96AvObmcs0RPIRf1sapikrGWc43cm97upNVFzU07liwooux8z6HxJMIbr7sdGyY/YgYD+D766Oj6o4/edA4SWtj2W2h4Y3wSasJJbKI3ie1VTMeObCeya/1ur9vtoSaxd42uT9lHqOXD0SFHzHcDYiKZ0MhrVPfGOC5uVVo+bvmtjltxw47bj1B2ezuIRvvb26jbbXw86m5Fg2R7UM8dai8jLQndmh25HWK0AuljiE4+Mho+8shzz6Houeem2wXnd0ir/BbUuYWHgwE5/ddo0557bnSdnD0+P4htTE4ED6hF2/0+VIUgqGm8IgD/Ojs+p06nQTpG10TD3O5EhPIR6E3UKxSM1+iRWCc4ORARgYY+4axiZCzXtTKGwnIyx/ICcuyyrac1jeeVEOAHUEBSLksaefuaJPO8LCDbyMe1+wNeSQW1l9eClMIDGFFYOVVrh8DwZF5R+PfM5gwJyYLMiZJmz9uaJHKyIrCSAVRmYge9BijcA0RK/HGIJeFOYu8g/JlSOyAJzpj73golcCd2Fpw4E1YmR2JwuNa+ijbdDCV/mU/H7PnhmD3/h5hpv/AyYOLbcR5txIfeYFKngl7uTI1S16O1MygblzVjTh1/3vOGAbD3hc50WTe+FTNFz4l1d4bglBjFjglVpZWQQIppBYKsIwziLkFH/Yh4igH0gclpogdG14O9PeJHdoNRoApKENANUVHuX7s26B3Wb2lM5mbuEU7rtg44xme63Wj8OcQp9qYOMNN+g5gxiGU2omZv341wGLXQdjS63tzp9vtdmHPD4aC5MxjsHODEP0R/TOevA2/W76yw2Hd8TzRZ6jv8scqnqmblUzPfuFdFyv/61Mx/s7TKj1Q+CWWfnEEL96pFZTTzqf+uytzB/X4e7TLK2L+W3Ah4v0cYPNHgoSfOyggP31sc4tzJ9+bfs/3e/HvRJ87KWekrhfd8RUJ3vy//vl+Esolu+cCeDzil5pL3ICRb1LuOsqMBysYbEAOIIoKmzD90vT++PtpLfBF6t1z+Utf7yfPJFu3u7RGXC5redHnSF28DOmMyPswfxrFjdkf8RggDx60YlONojeq+B69vnQyKXrB+W6mWDzJBOHc0yEPxaDdaqjQwy4eFxbl33GGHqaPzvjdFx4gtPoppZUQMg3v9/j4a7He3e92pcTegPrWMQy3xDvG9xnu9XnYw6NIU9XrE4/kGQzdTPOIaxRxA0joggPmVDnSeD1QTR8DYKpjwjQ8cP17ula+OeldhE+fRAPLoytURbLfLx45BchX1xvmJTf3jMY4iWFjERGClFJICfaCeRISNNbCA7JnVKGXM77y8bjv3feBex6o/uuNqlmRH6I2d1motlwNRuhqu3H7X3bethBXYM1TTqqy2OuRRwiGZMvYrBjrt1uChYQcLpC0+52NoXIW0MtwdDPrbpaOPo/R26fGjper646XRELLrxDOgV3r82Ple6djj6HzlsWOlHmQfm/ZZ0WKt1QEeBGwYEmMq8HcC3ECaIQJzmvB9FycgqYp2qQGHJh+d1WxTNXWvYFXqpbrpGlIDG1nDyFJgnpyoqoYLaMZRzIpTzNq+qaryXWKg6RljQr/3k/FLZqNHNVdVgvGAPRKNR0QYba1Ossk3SrbdvaDXi+Bzg9nbhWEe9IZdMsSDbLYbPfQgUVl0m82tKCL7L+3/g5LZNtZHxLOGuN/s9YCGwbSB0bdN1SHNnd6Uv8UPxvwZwezAtU7UgS96S/tC2/wZi6Yw6aJorzmZp8PpeepU3EP/sUg2/d2F+jep2iXRle5PZLp/QFdKvHEoH3CnXX7ir/8Sx4hWqZLkiQcPtL7XjfpRvwnfqDddMOxnhygLWQRQpN/rdZuTv/7+/nB3dydK/rbi0ik9DOVgqBaPt3VEVUKEbVGWRvPUouADLOp+vtwqFltl3XKs+BPIlmX10bDUOtUq7SiWpaCIpKMhzXfhlO3r5OWIk3dcY64wjzBXmSeYJ6GEuOnBHAZhj7zlToJzQOzDVVwVSfRH22/Qyb0K5TADiOTbJnQPx+zWpyZmgoaqoUuq2+TWOuRe2Beig/GD+pzJipwwd2GxxIqswAqciiUBSYi4w66CBMEJimY4hkL0p8gSBU0CVMQjQRFUAQtK6EU8n05VlNFf7dM/VGLhJgLHCnOpVJGD6wSF50kBx0qK8BMSLwqqwWMQFFhdENgUoC1eEuCSlGBYKqpJd/WyehgM4H+6fyTqwbwIMtXLqAYL+6eIMY2QnFatRa3BMXnA/gYlgMAm48OUQkBhwhVibw0AIdAvB/yDON4OoBmahC7u7ZUXdZMTeWzaioZBLtJEjjOzwJYqjpU2FKwIpqpjbGggGBggFKU9XVf0CvC9bi/QZaycjYIPp5AG7dRMDbOiaAiiKEI7zcBcC+7UdNUUOICHtmhhjndE21R0hFjDDsZ05tqL05ka5ZUYpgGA7DolAPG3lmx3ezCTA0Jo0BShGWSzVC/6YoTmIIaq8k8Z8aj/b8qtUqlVVgH2WWliDAtgVJPBvtkqfZh6z0TEHj6i1lNEVD0TmjIEqmbAzFokSAYmeGfiC9O5ReWJ4TgJPiE0FJ287QZz+4kYz/5ISG48GpA0NFCzeX2riYbdIOgmaqUAjg7HFbFPnPgxmO/9W+qweksdHJtI1bSsdhAGQQy68In8DnwOVeRr5Pmj6watD8Gx0KFB0FoFot7MBoeqNBrGdTlpJXX72rV+Hz5Qr5jm/CrQZ4dYQTqxwQPEG6IbhXkcxUbym8v+ylLTKVNcqtXWa3OSsFavLHzlUJG42igv/Gw+bcD0K51LreWb67etdMLKLSVTePcXmTSlez7RKySappMo1jWR2KuVxIJIogPRa/KW9a/MJfOYaZLN2z8mSR3s4R/HuCO56J150weU+q8s66jltX04xRx968exC+fgj0ke7mCG+fbpbQm1/v/R22GPyM1jm8BvUwS5AnzoJEiYdybW8U4jFsCitU7LiP0ucBQCxwR+6b4E1iTEuTSOf6F6thD9sCyLipxeqtozFT8lpWU/k/167ljueM5Yb3eCgmnrZqGc9mzTsF6zaAic9ETWtm0zBzgzGPbQL7Ec7yrOTKYxhz2Ozx8t/p+DwcJ3DnzXsnnEpvS0s7mgeGowa6vBjJbRP9QfBoPuBDN8AV1iTjPnmbuAWj7EMMRo5VLBOKzFXiGAOGskOo142sKoBoxCmg/HTBQRSrrm42VoP2BIIItwoI6jFSRCH1C8hVdrUaxraqIPKbaa8ispk8sIhWxnJpMzj5u5TKaayfnLSylVxiZmK6wol5fTMnZkV5fZO+9kZW30V0JOEvlni4ph2a9avIZWA8v6Is+5OG0XJC2d2dxcWNgMNjc3Obg6DZdZWspRXE40VTtIK+Z9RtqzrHkk+crtC1qWmfi8XTuEOw58jG+ytR54FcczMf4kvtDEAtUcxHgmHqPvgPmJQQpj6hFX46DXwloHXTnyVLN3JP8q9XKjTzTU3fCtBzxrQHmWSy0GDRLVMNbeEab0kjvvju0BR/b2Nl8kR91wIB8FO7dkDmTibdSnXIOJfafC2ImKuk21XKJY70Uz7VQ6yhS/u5TZQ/0fqoeOW/vADy+Vw7C09AvQ6pgHfQt9CyTrHPCeCtNijgJm22CSyEwRh8RtAKgBG8ahmYIPJBJE7pB4QSdRmX7sYNARQhhvMDf8JDxTtdsLIYnPTJ+0JY0EaI7eDlJ0LwJh+nOWU0vCM2dO2KFdWbKQMD4I15PoS02y50MSqemc6lgqCdU8DQeH273o/faJGdhdOHbUqznWrLVUsd3kEGmSPeF1/xAujW2hpPeAq9oEwUcoQZ14CoG+2PaljqFBFzD6oHuDCRATZAdZsrk+SW4pQMMgGPWzWdTLkr9+PyB/0SQJoIQciGhCCia0lMjHS3EMKonmm8SfkmhZYkSoUodjMixOkViKTrsEX7TnWaMdYtNA25ZXETn+ySewwMncs+3Os5zMCuITT/IsILd/+S+Nd+8RqwhJ/k5U+atPYpFjH1tdfYzlRPzkVV4VFe1tb9MmcvJfQn2KRONJtNTA6OtUGd4g3kBAakosifRMgxBxnViOUBNScfBTRGvG8x99O6eo6BvPScv+f/Rc6S1k67t3/rfXqVhgETr+UzyLZWaKjxAZJ0s1T/AoaD08iLioLiPyNBJS8kqYs0dGP3Pk6z8t8Kotvf+HcErhBDRY/toyfP74PbxlssIrXymwpsVP6CmJ7SW+23kaOXtLnOTEflYhiGV6B+2ZyqhHIyEHijnqJ1q3+0f7zYNshKi3HT0PvTOGCzs7w3FmyrYkxVHubgjSdafmEH2uDfTM3RtG7535Z09G0Wh/2ARZbBjc9d6Zf36D6Ua7IP4cxAV8J4x7l9gugerXSBjrOmo1aIgyoKw/uHNDuSDKbiNTno9OnYp++eJySlJOc9FS++JEdzE8rNeL73PoNm6i3rsDPaMAKH6yJZ3UU2W7WF9otX5dNgw01JXRBxX9IxuhaR5lF8KljY/oCjmZmchDBA9Mz87JE8fgEFG5kE7MlpBsD3fjaJDtBsPRdUhoOOpgDNFGOyD5AfQFoB5QVd9Ed/J1Gt9CRAkifZWQi12YHiuo1c1WKsv3Llcq2b7jVSwNvTvCWKCf6NouJ1iG8QIzbQPkaC/bNbvTGgeSumLsH9KPutmat7waLNSChWxr1W9EqD/qD4YSQsSvQx5qLMKY+MQfjD2echIrjr+xccUhonGCjv1OLUDXd0bDrdg8MBgM+32Qi4c7CGjGNpCOIOj1D9q5j/bIbHTqbdqj4zh07CaAh+w027uIKFzvaLXqjrMnRNV6s1l30gb6VMRa6uhX663WHU35o9E3y4twkvz79OWxk/o6hN8hOiImKzHE9vHJCg1umJSjwHVrXbI+g7vjFXfIFrrIKxZRb8ZZ6XaLbp+U9WDrFbe2il6frN1w0DdZauWmWvRprwkarhwHEEAhIj5ZYwW5n6ziQBQIa7HPNd2lL92uxUIiGqxRIePTqkUz6E7VGsFsGu33CSsu+xFQO0nVrdR+SlMEnkWcqOhOzpDY3aylfhMNLHIxXLlmkYvJvb6Csgknf6WiUFfK4UBTbM3QdBD/sroO9/+mamWZ6TUFTOoRsvEicwBwjTNpUzNp06T5pGWrSSHJH0fvMlIpY/R6SNH3jQa7xfkifLoI0JWRysX+CeVAFwVR0jQrVQ40jPaSCwxy8WibYiPybhaKxVdpWiFTdTLUX1jdBZEH2gHicqAfjAWCs2n84WH5BYsvItQkhX/o6Jm0I7bm5hdqjZSrry+Ea/9PSs+4Kdyam1usNpy0fhzKPlvJWIIg1C+7x9PVxtLaM6eXwluLJvRknyKxIl0941iM9tOUBZJY/rH4F92SwbdYYhDz1mNHjhz7e5IosQfH91jUT+N74lf75bjw5Dhy48jcYO4ITa5P+3TEn3cnYyk2tUzkE1JfmdEBrcSxcuXx2wfO0/aJOEJkkuRLPbCgkHKYpvnaZhB1ASP042+2Oxr0d3ZiRoTQjmLSKEESKLhHPae2qY7QmNB3jqJcA56dntDfBrzDReLhTDS8hO4KnZoPRLceuh0AfFAHEggImFqAKQXHcCcEOQ1kiWh3d3939PlGd9iHtB+GmyHhSYPd3RtMHzXCbhCGDzU2G1003IW/zQbIw3BKN2zo4Q0GSgD4hOF22IBTNxtTNOZ5qFlI6kPkmVps84FhTg34aRoeUKu7FL61CHf46R9kL52avS0Mb5s9NhdmavV2e8tPcVfQ8fm5+fk5xOjq5t2zt91922zY8DtbbT/lrc3Tv5swwJgn3TIb/WSVjPFqGdPc6FcGqLcTkeQwHri+A39DkiTj9MvoM4BfPBrDtk58PxyRBDsQ/FKlEyTJ+gdZEMphpJYQ8UIMYQuDFGR06v6y5pFlJKph7Kj1FV7VjGqgSoVq4TWc7BU8BWcL2T/lFcjKOFPIpsrG6tNrZlkoheUP5+y8Xs3xOW1+SVG+sjSvQb5qFOw8xyvoPfa8YRXna5nMnDGTzc4U0mlznBldf83K0aMrr9FTqa822o9Lhvbo7ApCK7OPaoZ0tdPgeTThRX+BPkfQGlnqotMIx44tnXriV1ZC6DdmHpzxjOwbvw+7UgnYYnb9ZU+dygVmIKKXz9w/41aCT7wZ4xL28KiOyhk1a1bxAa/7PfSLRAqqx8EiZGkfEceOMsSdBjEnVxeDrODVj2dXHWc1e7zuCdHi6h3Bwtzqyn35Zda1LJddzr/ssbmFqXFwDcZAmZmnPjpEU5LGE48c4uhBur69hsW034FXQTzdqJu7geod4qgBYjhROEF7cSctos/wkjT6DLSOx3juZLH03NbS/Ens/awsLQuirv12rll2cnDX05lZDw562bxz6qlcqvT+3gn00wJcN/qMJPGSi+fCjVOXrA38GiUjLxFw/OhKqRJU54rKkp+tLJ+6JOTQxpGS9+7e/IlkXZhkvsdz/ASzydzOXGC2oL+AW+INdIprEyWAwbpkfHFrnUTDiMNq4iZMehHm2imW2K5r/kQbWYmNgUTAHtwQMMdzwGVsXTIkASEB+kTRvgoz/f6alTNFUVIc2wgMXXcd2L9GaRP1c4A59B4OC4okq74JQgUWZBv2+NtABspmVzwrZ5QRy7LAfGHDC2UjZ+ey2WYQbNF0St8zSNp5NGknbaMw1Uacdn1oo/BPbF/cttG+ILE8x7JiSpd0aJzAiljWEN9/Z83MG8BJ1RQ0zdTipu0Tdd9o0EPN14Nwo8iS5tFm8Qo0CxrX63m+HRhlFsAE3JRFrEDaZLWozBcFB/HMQAZTwBsy0I6EysV0LgJGAMjK9SMQPXrdYa/X3e0G3d42UQL36Hcr293tb2cnfhb/BX2V+okExL6WoAmQ1IqI0Bd/HIqPesTF9N4To/9a9xbuucObv/zb9XsWvDsuz3vo6XnqKnS3e/kOd/7yRe+LrkvKL14+wDFQXyJvkzozBGKNxWoOMDKHfeAjaO968/r1ph5s9nqI6cUmLdSjFi2COvSH4O9afD8W7gj3M5L7uZTitoiFvh6FPshduOazTDe+w+ivrj20S27y4LWHUECecf161Ps4PIcZ14/G8qlA2wmvZZwaYIKoBeJdza9DXYmrsE+10CHcenct5YQnzi7fhj4Cr3JvCM/o3wByg/o1J90+f+z+zwG/RcxeBP0+eNH7w0Dq1ECAdAGD1CtuZEPlHdIbLaLwRh9eu3zb0rn10LFHb4f7wN2i7laWPOD++4+db6ed2/YI74xAutvdm7IrE1xfpsimSLwiqYGjQyAVtYsQ5zbiArQBUsZma+3YsbXW5okny2e80/W58/Pz5+fqp93lnSOVV6K9cvGpF54qljsrYaE2f/6e8/PVYqN5bW6BLBk0mU9Ef0I0THl45hxZPQ2Ig10hnQTNcaDvomaDsMJORMYUydXHmMpvVamfW80lYeHNaDQEYL9d/HJ22AM82g8Q4xJgWrwwX01vpisL/S5iul1oLoqKrlsE6aYLJ/xsv58lMHSh2Is0HGKtP8F61+hYy1CtVUglppobv8aI2hMnAdYtwqg7QiXO9FEPBOhBFKHuaLgX10EY7QVdApN2R/skIni/GaEgGu7vb8foeRBc39vb6WeHe1P8YVq3xBB0Vkli2MhqWlAZm/rFwxfkthFID2/S7T2yXgCApV30c6N3oG1XS9kvoy7YDInzaDYP+Uq6lGceiigdT1yq3Jtyd7mc+PBMu7okrj9/RMeOMLlvTAPO0zjW8e06iS+pN8mE1Vq1BtRSJIERaaCYJExjbbwuHshz4TJL40r82BJJXjWR8oiqgdok0dnZ47PwmTn5wEn45A3fgM/3CmrdqeZdnjAuVnbzNaderDs1I6clJYZRS9f/TaXa/smobqZS5vwyzSCmQO42W1gkdzt5BtrmG9Yqq3m6UXXqZXpXmdxC0HJmzZkhd4XnYBZ94t6oXqmklrI/mV1K0cyU3HWNvkHvAHkfID0BqEAYu7vE6h8gMpphaKMBpOhBwrq6Q6A7TUtDH9QstGuAaEVOQIxqRMPd3m6WrIM13ffT62tEdo2ibNhyRDdMrO39/qDf39ne3oEMUTMD99lDAfASIJX97PaU7oGsy0BXbnCBE3R3mjs7N7avX9/+jgMd2fuBdpaZtXgEuXTpR6qXo7GiRC+3gqiDyAbi6Mp0C8khIscjJjwT6oppiLKp9lRTFg1TNsIzjYGkYkOLNB2rEtprnAndkpdJSzk1XvFLzUnpjFdy4czR056nW5qua9RNQH4R/doa06Y6WKZToSagia7NeUk920vvTOPwky+qfnvxbBBD9PhKtJOE3UW9cWb7lpLJHP0CnaMgI9Q7U173k1ALvwMIA7c6gG67RdNptOopqxgLjSfufeu/6Pdfs/jJD0vFVNBoBKmi9PJYUnxLdb/ZjPaa9c9O+aYRywITOw2O/YTH63e2aNT5RGidPzeftgpCHuAxrpp5oWCloWim2bzQBOJAstVilvfTi9nsYtrns8XqDBSeiS42mxcP1o8Z0LjkOl07sJYEa0+tcEhGD651lpMl4oALUe0g0b/0AwAPATXGMZA+21QV3S/6qjZDiD4KthZOnFjYspRdcgok147xjmL6vqmlOEC9xaJ32N/vZgp4yFv8kIt4bb1aXT9HkkP+frtJISTktsqkfTyVf3WqbfPgObHnEQmc9aMQk2nlh1MpBrErCZL0Jq8YRduj68Nut7dcWl7uTpLQzrCsGokiYjMWUbKoKhpujwCdbnf1KNCDrN4M9GygR1lIe1lbLudzRc3MnVRtFT6H3gOpZ3hQM4caJeFVJDGua4Qad1wSi0P1GeMqBSL/almQOCOdLklWV3NExbXN9KQeo79/By+mWfV+Nl1IY8O4z1rnBFEppN1Dz1aIlw99NvW09COSYPqQfhQR7Wq3mwVWGt92tBc1s92trW62GU37VpI2TFowruGkKje/F+kWm01yLXHMJO8GNq1KgY3oqqNhvEsRO711MIBq7Q56N5geUNPegOgXkmcRH6wu4OtuEGSJVribzWYnIkSCK8b1TY110gc9D+AQA/KOVtDEkJdw+HGboutwu4A8JqYwb+x2Bwddvr+zQ5yPthJm3Wx26YOtQ20n+t80pZFlZoZ6whxhmok8k9QlkU/G7j3428jTil4jFqrmAN7di6WT+nZjA1Qw3lADVTbZNKkpKrEfvth7e7F3lvigvujLoo7tDPWSv+VlRfTp8En49vgdUeQ1fj83ryhAdN3j95K1lC4NyVKsrWjqhWwRtkUSsx/bVeOx/3X0F9DzdAUz5LkEBgH1W0B+zCE7IQ38X6YhBxssXTq0NvFQj0mE78WqDeqfKVKLADAJ9FUJWaU0L7I8/7PHsNgVMQpKSHZl15Rw+s85XpLSi43ScWRqHtYrZsUs6VqhVK5gyVYUTjJEC5uCiFkNPVks5dcqIoveDRfx70ZIkp1j+Yz8LpbjWdGoRb/IG0HTz0VlU+Pl+dnXFIqfYznsuBlVScMZ2Mi4vqwzB/6Xk7WzOmTtL/jakMR2cvrda15rIqbZPOinPupPX9Mi5grY9sfvknz7JJB50BxfAzLdJAYMTY0Ilhkx4y/qEwtqd6fbndTtRZ8zVTciPo2fM6Y7RHYkqzVMrzySJt6ysQ9Hsq7phItR5znIgfhBMf/2xU6kGoZK0UHUvgOmLPA2siRfsJNYMUrusfuUVgwMWsp9x8iZhMEp5vQ6QoPYt9yJqDAMiI/6jvYm/uSo1xx7mU98tALScuKNGQeDBM0xhof+I5i1AaOTxB0xMPZrBzFNuNIxEFXibHAAD6jKA/lUq5FoO2IN4imWsjAaHBhuIJx40jZYxlmtZmdVRXEK4uh//nsA1DwSsKzKWOAIuLZ0rOFnzYxRrhgZQ8tIRbco2d9RmJs7lpZ1Taq9OagH8AEZalhdzXm8a38Da6LFyZIgiLLMSwpZbvOjBT1rkvgMvcCJiOMQz84dn3NM2wiw4z+YyuXqMU0ey7z7xMMDUSpGHPNr1GUb+pK6OqO9Xm+LfpItiFMHO2Q7kWdj/BkjzwvM3fHoOLTuyJi3O3Hk1RgvTy/wTJaWm4hO4wwGVgwopYEiU4mXa1LMKHEfK7rdbOr2VLY7tnwHo8FOsphVvPlw4/kGf/zScRj6Seio+UDiULY7hC5OZbMp6GvIFn9uMEjwqxJv3HTaIb2FbtxI5td9xHtlbIEbm+VI3/2TysbBGwfWvLE7pYuGFOjTSI6gf5DP9oODfNE9dMQt7sY0liRR9BJ5rzi9VzyIhX0BvUBpBY4XHA87fge98PDDMw8/VH/44fpDD6OHyQ7kyH5yzfvR++k1B5f4qP1w56GH2w/TD2Ie6jyc7HSSefoV9GvAY0kUUuwiNbanNapktasiK449pUS3FhvhiLspPYssVEp2pgT0P9IkX1UMP+8V/Lw6v10xnfxaijVNrlVJWfNeul/KryyuZPzLtxu10mxm0VDLQa2QsbfeF5uK0K/xSiGYcVJuKrOa8fhUaaGhzJ1Wsuc2H7rtZHuubvFrrXwmZYaOKWdqfx4LFkn7/wT92YEHj4EAty6jeO10EllF9O80rJQuuG4gqv5s0/1QnFoYGV0ji3Ffy5zazPIk97x9xNMlz3teAm71PDY8/HwKK6Kte0fsa/5ikeNkUQL2J/PiKvrl7JkzmU9nbNPjM2fOZF+wJVWU/FP+C9h08Qv0DqkjnpYSFcn+tLe5iBCxi3tk0SqWndbnqnQF1Xm6+tZZQv/bkwCqzphsTegXNfmu0pVOG81JaeeWzFW0uUTlg90Yi/XjzeuNS416PTSspfJbE7eM+MAgCYE6egEkDRA6LvxZPPXmyAQ3jC19Nm1vXdKt8lI2LlEPbQ50sN8CpLtE170PG7EAV0K4QyLnxfHCHKT2ZO0T30tEvE47FMjS1afocqioJcpI6eoCkNXt13qaYwBp9fDxq0og6U5xpVh6tiQSJftpSxdFafQ5QWVZvatqioB6oqIrl3TEasILry0Wl0tpXQqUMw9KviBJakpzXzsHhF73Tqd0zRS/IaiSoHUVVhYmPnf7CR8m68qvHnBwgufqdFGRxDDX7rRAKEnyVF5MQCswhj5xhBgO0bsGgihZbqEwm2f7qpIpFOYL8t8OtrdJkEG8MEpUQKL4Bq4wV8ikXsg/KECm4H4SSzvjYCF8U71y1H+6cbhmnZtoHHHevKk629tx8D5JHrjvPtifqkXzYG2oa82oO4lzuvH3hOiiG/BkIqG3KZXqtJfZFlkEgRq9ydLFdDYRzyTINepUo4bj5XjI6iunUIgeuWv5LpF3XPW7Tx7P5JycILVzhbOXVk5/r+KL9NjotzQZl1S/qJUez+aKevE/o7eSA77DvwFfPbJmmJImiBsluCo69y2FF+9aucz7Nb2cz7wCrvG1Epb09DcSWvcH6A+SWLoiMthldoP1uFZErAsuUYCjD87l8/c888w9ND23vb0FvfHB2XEBpKNfIGVbB/FI1+I1Vw8ssWiXKKWagFx2SOaAl1+jetObzu3TELsuSenPRCQ4fwT3deCddoiWyKkR+ye18K0jugiUiP1arHDkxBowZpgtUBwzdKLvihczrNOwinXqKNG7LKloNhuIrCG/Iy2Y90oq+/oelnAHKz+ipdEHFINdQAq+rODHAVWzqdeKCrvIo5PP8oC68XEN8yzqa8qNJ57KK9IJW8Y1XddHv+eoytdkpc4rmOdnsPiv/T8VJYEs0XKgj9uGdsfWF4JBiViwOsaeOJ0sBY16C5VA1ysLADQTVRTq1TrS/2U5Mv6q1KkBuLRjTDGFL/cBXdaJnoSGO4SYLBqxgRJvBzdNf9TAT8djzUNvqa6uVmU5N9r7a265mqlUjlTEy7LpCKyUdfEVDe0dObvK5kZ/hfr18F3VlWoVcN4V2c/xyDakKwfr8cNziYw8Q1bJGK+0Qq2ihF0il4RRNjurVVEgGotVmIChSFdhQbvBqBdU12u5TCZXW6+OhlFQXkLMUhlEvSaKRvsoG0G5osA5UTRfW7oSlZdq89EzfjWKqtNxw0Q7kY1xIaYezi0hAp5fE6AACCggw+F2r9+N+v3RsFvI5yKQ+vqFQtBDvS0QF0BgOLocXdsi6SQeep+upU3QOkHp8RJjbuJ5MOzv7PTnT56c7/fpigSA1rZ73RP3nYjmzl85P3cIr7YAg8EIrTXDztrY0YS8jEatNaUtdBM/9HYnom4xrXYDDbKh9Iz2ad7i6K97iNfcmp9fPL2Y9/38ifnCsvZmaTZTWmaXdvN+1v1ljvwsSE4xfyn1jBRmy4uLZbj+zcZKsHAi77vFpXJx8aDPvsTodG1awIfUK4dap4D7REREcAHmHPwUx/N3He08cvU7H+reubj0g3ddfOvF8Gyn8ANeubxULkevfvkjrU53cfHi1oMXnjvfzbfP1kuL5fJiiZm2HR2OC4ujy5IIOuJWItBln+PQORppRpcBucH0bjDb12G+bO/0yMJXQBL6A2ALxIvvRWJLnZs8MvZAoAKSQ7wwggPHi8l8+WX069SWRVfxi7WpZEFcYqkiGnEq2AM9xEk3rKFOTcnJsmZbkp5SkZ0NcpqsBqI4+3Al5zjtCxfloHVHs3kH+tDMK+ckLGmapAf5jMWqjiabdUlw9Uru4oW24/xKcGezeeeU/LyPfgPmzxKR4xD5/YVwmQOeYfDYFel43uDIiiDcJOQbNzZIdTmABht8p9WmTuUGR37KgUMfkcWgJIsp21V9X3VTtsbz7Btv55SgXE2FYapaDu5rNBvw+Y/jMx3dy+hOytInZ1acMHQq5QA9Y5RSooFTmswKAgvNTylIUrZEM3BNTpI40w2eC8jNGpfHZ0qcIHCSZqXl8ZkGUU0YbjC9VoFCbbm4RVzBNlCnxVVi91ZoMcyv4zNH6sLDV/ZREI36//3cwiUU9baQnlo8e0m4NNqP5t6HAi0cz7MvwBirkrgHCuqA3ISx+cpPVoohIi72yHIx6HV0CWXuWf/M0tLpzLMcWe/otP9ajnutR9c+KsvyegCZYF2W6amQSUHRIb5F4qaSVUejeIGCyS8WxOG2xEKGGIztdL4wU1uutIO0pCimYVspw9ZA8N3cLDtoyPMKgcPPP3LbgifzgqRoluNli5X63HKUnfKri5959J/yVDeKTXMtWkaDOahjzT9WmT4vwD9fCwuzal/27CCVtv7RCg5FeM1+vibJiq7u1mYK+XRKn2DE7cNxGR1iryezHuY5IaVhAr36iBntRs3rTZjhA/i7fj07oH/bScDaWMc0TGx09He/Yn/k2ELnEM/bCA+uE+RGkl8ZBL3eTW7AQ6KE2utP5tzvoefgfiUSmebQ+Gkquq3Gawkd3ufilQarjRAX0a5bxJplZR1c/DnI6qYVpHChc/4NftV5xZtf4VT9N6Dniq6hcayg0cWRJtnRR6/crh49d+6oevsV5sC3rRvb8FDFjyohCm4w/S3E9FGXrIx+sK6zBm0PmBpIQARvT0dG130YCRtIwNQBYBJcQsQJkFX9sN3xjcPL5PxlI6teNVaRelXNNkqrPxIbvz8b7/1JcnDKqPLH8ZG74yM7sV4sHe+dio8x0/7AMo1cBqCLOz5Z7xxkG5+sPgpzorvzVGEwKDy10z3xpnu8N7/Zu+dNaG/HedMntrY+8Sbn6pvNh99x4sQ7HjYP8VAZti92j6krb3q+eevzb3n2Lc+dPHMb7ZE5Thzu4xgGH+hrOvnhDBpd04pjGvp7mVIpcz8CiocNDGTvAdhHHzuNzghhVs82hDNn5FzRzWbdYk4+c0ZoQGE44UHUT6RMvJMcGqqTROwc2pxEYQVgoh/7vMfzPI3pYLwpgwNz2QxuSrqj3V633+uDHMdjzBdWilObnI4YVXXKZefmlKzdX/67fn+XlRVRNg1FdN3JVjFg67BT6yiO5+WLeSxHh37pCc3cYIAb3+yiHys3+9M2P56sXYhAKAgnniQo2L3B7KKt2CEZDcleL3YKIZcpyfu/xrxYHDqNPT+I0KlQe810xM443pzMQHR9t79DvDWy19H1vR6QqO3daLeHdokWsU881uhKnN0g+ZuKoR9H79LeuOnXCYkrQeyv5EY9GvniBn2ywgpaIQb+gPoS7O+j3aK7G/9wIWyiIMo2s8zB+gD7h/wHoI+5Go3LiFrJt4t6AFCj6/SPhsxfH13LxmsZMy8ZN4eSIIPpPiGhsdT1ja42tL0zQINhD0hpLBLTxTpiKfiAr9O45U41XF1GVJWULEm9SmUvt2aQJZPrUMnPcliVOc73ta5qRLwo4b9oS5dE3kAqWeOUT6vKOdcyVOtjMpb3pNerkrKzlzznq+grdM0Z4v20WkQ06IxoKNP0l25ImAogCqCI8DrRuennZIOpB43+BzFYTp7kvuze6Scd6Nn3QbqoMk3mHuorg1s0rgjXO94GILUOWS0fACNdLr9ElqZthz6pkoGIto3oaqI1x4v8SosMYxKP6Mc0hWiZTyLfE6ii1U80zCwTpBtmyg1GzwdOaKTSAeJqgqZ9QcsINV7VviAKiv3zn5cwV+NM/HlJZGusInK7uo1GPTKgcviiojv6UHdcYbSnYe/fqtIQa+jRiwgDqMMXfuCClJoN8cXRN6/CPc/Bva/qGf4cqw7PcQZ+HGMOttJVAY9+U+luAaG/lM5xltrTHUdfkux0T1IvrEqqymixnpllqPR1gjnD3AF99BTz3cwLzPcy7yarQSNgoId6y28T98Iiaofkl7EM5K96RELv+F57hW2IJfLje2vtFeg1DGxrmahKThFIHLo+Ib3EanGoK+NFxFuhL6ajEvn9vrUGyPtt3CQXd6iSk9h6TpFAuI4PYvGt/fs3Zv2ubgG+UdVCoirwLM/qaVbhWC7j8RwvoZDuFFLLV7GOUtpr25rA8XZ9HlmmrtzXEnIHff/qHEiBP1FnOcVIV1Ue8RlRSEuLmfyrFjlRWc66eV5Hb8wVTFNDb7yAU7MNfPGd58lWuvins938zN3w/ahWYkXdslRs55/ikISwjESWn197isNINvCplNF3oqu3GabsL5cvXWZFXnrQsd2tO4ESXnLDQkiMT5s6EtHsiSfgeiQdd1JvVpdOWZKZrhwN5rV7NIF/9J67xGl9zDXqrQjzPnaf7rgEYgIBiH9IBbfIT6LujgZLC6Ul6JCl6pEm6i3NFxY4nY8KR9CFV/2C7OgBh7luYKbVeA8efkdeTzMCGSuJL3UAGOZOKusQS1Ucbu1O2RlcXOv4N6vqxkqpIvmZv5pPfiqSeDs2ThEGCJUF8BPBQEJBqHnYv3hywblA44h2veLrmsHrdmkekt++XLinzNm6VZOQgKwV1z1iQ0au2brNnkqLbewg1FWks7tRL77C7d25luQIUc53Onm7ZmKZz8i2ptlKFuafOWOtpkqlFDqQ6QaUL1K/IDS1GhZZqwJH1L+/wsXtC1HU1YzRrql0+fpy/RVd3s94r0KBbymfkU0WDQwtCFSTVEA1jAdG/0s2dGXy3v4FPCdPfoOnehIla56PDZ0+XQW9tYzQE++UfsitVNwfqiwVi8Xj7/TKbOUjSre0VGr7pZL/rXa5wlZcv5Tc85vos+RXZ1GioCLaJBIjD7JxvCG/urCM6FLuCV722x0Rt9E3nXypfHzz8qUzunI6Kh6RZUnTK/Npz/H12ncc5zphekYv59RiDr2nkNY2T2zW5+fRLJrJI05sVpGK9Lk1b7HJqkrYsQxsVVPcVCximowZuhJG8gMsibcriv4xhcxYzo7jgk7chKAnxj6gGySKOV53zqQZqoRfjZXxxKhAEBja23jq+ac2aLIXRwPtLJbWFhfXSotFt1pQNAFjpe5YqbTpYsWW1WLVLSLmVHLNxlP/Mw7i/m4sUGd2XjBljIXORniU42+v1mZmszWOf7rVhPtMxbt+Av0KI1Fb9rdbYeafXsvPfTtVO/DtKVD9X6zQqk1+JJTM4Tg+DYaJH06vSkvt6xFxE5v8DIU6UBQN6qkpCgqoFxh1EzPVXRpzpprXOoKjkqBl1RE6B/1C6IpN40YJt/X8TmzwxjWyZkxEAx2J6EZGSyf6IWljNr9sLfjnZhe31nDrwYc+/9C6cuJQGQoaUcaL8qXZcwvb29F2uJbxVgtl2Js88y/Rz8TPJH5pPrFGx17X0EanCjOF2KTjsDcifQlLW2ti+6GHTsgbs7kj1kL2XGGxe1MJ+unZ8wu9XriWddcK5dFPTu8dtJX0tUj8CDqx2Xus7hoSpfkO+UXeAXEmaBK3gmmfU4LyFgDFnL41njkksREUrdJ4Xpe4gU7inMY6p5CuMETVK+3OYfxOfzXvf9d1PbFtU2Hcz4kdO7HjxJmd2M2SNH/saO3SNEmblbKtdARVLGmZpq2CAwgJGpVDNWlruXAwGjuQHTgh0Uj8uew+USQuoO02DlRICKniz2WXVewCEhx2cnjfe/njZEWKXpQ4tqwvn9/7ft/7vt/PfYQkQYJgWBLcfwVJ+p0yfrZPhVW8LKnhPvHf4DRDEjLNWjMDeTI4s0tZrd9P8UYEprqIwTOjfGWX1ENlQE3EI/gQr0ftwMTGPb4zB+CGE1L2221jtGWDHJox34W0YhUYjUP7pC534EMOjagLk4ok8Sj46nAFwPDlAGJ2DYZrNxFzc8wPoevheWXdhTh6ktJccg3U0lLu8b5DCt+1HoxzQA7Vx4Toc4x8gBsFFgkFdmVhR4Ojy1y4T5RSs2yyEqJn1p3uHUsQ6FuPWd6eNppnVW1xbVFTzzaN6W2krF6+vKrQcXupbNWCUlEvLCwU9KIUrFnlJY+dD4mdn6s3r+fSaJgI9SQGrolN8Zyo5mOxnDfB8Pe9e9fFtKqm1ZHf0v0ewBl0KY9OY7BSH9v9qbaeIMMEqZWqgaDmy3WOCb+76eHl+IZov5+Mr+IeFsi+eauke+CvFWAWoS+QhT+k6Aq//Tb42lhZYby1SQHqb8iO5WJ2gSsM9UfqepyU2JAyAEjzPZCqEp5hASNRDwt9kuTl4PyVROLKfFDmk4hpuscor7TbJlXs6C5ZJbZs22W2ZHn51xSS4Zk54QmtQCsZcYFRWzNJmgOvifdZPJzZyGQ2rsPwJs3TVKEx5scuYuA5ILd4VMwXisVCvtjUCJL+1jQBX8p9H/b24tO6wyWi5/Mqs34CFwKGs4POfNKdP1iZAOxBXGePfTH5C9Ig6ZCbd4AwgYhzt4yW2XJ/5QNgrdmtrX3HeTj8cOA9sgWC033xaXShTXUxqg61smk6LZBJCQomcGEJUGAjDHPQf6A/sa8DdzdBCRqeA6GNr27jIPJ+XhB28F8WLQlap5PvqOhxPqAJO8+QUxIef1zoLMIlcEzb62H8Azq2LzEt5irz+kRcwdlELg0HUDZdmKwA3y/dpjt/NhFmwZAFQqx5i9erabYMgbZNCM0QbAzW0+QoyzT2OnuNxu7dvYb7aDPF+3leM8JK+t3l2dfSihzm/CIXVkVxXQxwvJ/j9YSiWzzn5+PTP0BKfup87eiFV2K/rGZzaeySDXytvbu7eHj5KYvCMmLR3LlMkg1KWkgSIoGEHa9PxY9YFqMcHAb4UCTCbkpIi6btyvLF91JC8salypkPDyQSn/DDfBbUareYTaKHPG6NScLWyiKYZgb9v2noL7JzeCIEy5AqCBt7TyEGhhnaZaho1vNEWNL6FIetENPl8Ok3Fuy1KTkk8z7RJ0UEoRGAXJ0fHzT1GO/3cfrpG5f8HIsRX929/3b14k/LqYw55RVgQ7OjkM/98mdWlhA6U0kaSAzGgpKg+PScNp849ZBlw2EIm/C4/v3XclQ1jNmdt566/5jvvFja+CokjNe1Q550TIsvR6uUPHPsWvZqdvWj7FgC97tbmQufJYYY4At0m3BMxwNwOvog+ymcg24njm5lzv8H6FYYzAAAeJxjYGRgYADiiMOTzOP5bb4ycDMxgMCNg7laMPr/r///mdiZQCo5GMDSAEd5DAAAeJxjYGRgYGIAAj0mhv+//v9kYmdgZEABjHwAXxgEPgB4nGNgYGBgGsWjeETj//+JUPNr4N1JyP3E+IM6YQQAtxYMDAAAAAAAAFAAcACOAOQBMAFUAbICAAJOAoAClgLSAw4DbgQABKoFUgXIBfwGQAbCBt4HBAceB0IHgAeaB7AHwgfQB+YH+AgECBgIKAg0CEoIXAhoCHQIwgkOCVQJhAmmCfwKqgs8C9gMPAywDP4NNA3+Dl4OpA8ED04PkhAIEH4Q1BECESQRpBHkEfoSUBJoErQS1BNOE4wTuBRgFLQUxhTYFOwU+hUaFTIVShVaFcYWNhZuFpwWuBbgFwYXJhdGF2YXlheqF8YX9BgsGF4YphjeGQIZGhk6GZgZ0BpgGtobEhtEG4Yb0hwUHFAciBz4HXYdoh26HfgeHB6IHvYfPh90H6Af4iAEICQgWCCSILYg3iEGITYhbCHcIjwigCLYIxQjaCOiI9QkTCR8JKYlDCWAJegmDiZAJmgmkCbAJvInKCd2J7Yn5CgQKJgozij0KQYpUCm2KeoqJCpmKpQq6CsmK0orYCuiK94sPCx0LKQtHi04LVItbC2GLcot5C3yLmwukC8CL2ovhC+eMAQwaDDQMTAxfDG6MhQyPDJSMmgyzjL6MzYzdjOiM8Q0EDRGNHQ0kjTYNVA1eDWuNeg2QjZqNpI21jboNz43Zjd+N6A31Dg2OGA4fji8OO45Ejk8OXA5pjo2Oxo7TDvCO/Y8IDxqPIw87D04PXg9sj3uPgg+aD6aPrw+3j8cP0o/bj+gP9pAHkCSQLZBPEHSQfhCCgAAeJxjYGRgYORjmMIgyAACTEDMBYQMDP/BfAYAGdsBywB4nG2QTU7DMBCFX/qHaCVUgYTEzmLBBpH+LLroAdp9F9mnqdOkSuLIcSv1ApyAM3AGTsCSM3AUXsIoC6hHsr9588YjG8AYn/BQLw/XzV6vDq6Y/XKXNBbukR+E+xjhUXhA/UV4iGcshEe4Q8gbvF592y2ccAc3eBXuUn8T7pHfhfu4x4fwgPqX8BABvoVHePIWu7BK0sgU1Ubvj1lo27yFQNsqNYWa+dNWW+tC29DpndqeVXXaz52LVWxNrlamcDrLjCqtOejI+Ylz5XIyiUX3I5Njx3dVSJAigkFB3kBjjyMyVuyF+n8lYIflmTa5wgw+phd8a/qKxhvyBzUdClucuVc4ceacqkPMPKbHICetmt7anTEMlbKpHahE1H1OqLtKLDFhxH/8fjM9/wHeV2HqeJxtVgWUI7kRne+x2+wZz+7e5UIXZge8YWZm5kTulm2d1a0+ST0ebzgXZmZmZmZmZmZmZiqpwZ59mffG/lUql0rFW7Wt/K+x9X//MEAN26ijgQBNtNBGB1300KeTHexiiD0cwVEcwyk4FWfDaTg7zoFz4lw4N07HeXBenA/nxwVwQVwIF8ZFcFFcDBfHJTDCJXEpXBqXwRjHcVlcDpfHFXBFXAlXxlVwVVwNV8c1cE1cC9fGdXBdXA/Xxw1wQ9wIN8ZNcFPcDDfHLXBL3Aq3xm1wW9wOt8cdcEfcCXfGXXBX3A13xz1wTzBMECICxxQzzCFwBhaQiJFAIcWZ0DCwyLCPJQ6wwgncC/fGfXBf3A/3xwPwQJyFB+HBeAgeiofh4XgEHolH4dF4DB6Lx+HxeAKeiCfhyXgKnoqn4el4Bp6JZ+HZeA6ei+fh+XgBXogX4cV4CV6Kl+HleAVeiVfh1XgNXovX4fV4A96IN+HNeAveirfh7XgH3ol34d14D96L9+H9+AA+iA/hw/gIPoqP4eP4BD6JT+HT+Aw+i8/h8/gCvogv4cv4Cr6Kr+Hr+Aa+iW/h2/gOvovv4fv4AX6IH+HH+Al+ip/h5/gFfolf4df4DX6L3+H3+AP+iD/hz/gL/oq/4e/4B/6Jf+Hf+A/+W9uqoVarbdfqtUYtqDVrrVq71ql1a71avzao7WztsigWyYilKWeaJSEf5IxQSclSsybjmCfWFOJhZqyKxQmu+zljxhOuRdjJqbmKeTeHUiQLU+CYR4LtFDiTVhhheaEg4Xap9KJQkLJZeZDKbCYSUx4oYwuTDLdWJDNTkqRrxKTdOUyOT6KPd9Z0YZZVSpYmZoZr02ByksU9JsWMnkrP5rqTE5JPbQETlZACD7WYzW2bJUyurAhNk+lwLvbJdVqr5ShSyyQ37BA57qzpQtJp35AsyVLS0cWRv9Gd7Z5Ej7sbjF6Os9Sd9DeJ8V5FRVkqRcgsb5WsbaZtwJZMRyaYsHCRpa2JUgv3u7oDe5MsikSoEjNioRX7wq5OWbMmk1RzY0ZSzdRpG2xCq/XJkfWJS60sISW7a95U6Sw2ww2GFjyJzIbITKssNb01I4035DWnV/FNeatSis2G7VbT2yiBWpNMyIhAd5IZkZCFMUsGJU4pH1TSL8mlosNeyCRZw7RzSaskOiGLuWaOF+SQvsiltk5fTszymdKrTjgncsQ0Z+0cTtxvPaJi4QUzFYSkSCeK4tAIpQoX7jOLBqGK+MhY5u6MTI8KVWkSDxdUjPQwqymbRy5uuxVF7nThHFSMlFGir6VTyVY7FUW+48wOK9osyAzSd/QQp9C5VzH3lcxirqbT4cmspB0xM/cvaUbcLCgUzUiYWBjTcukvFYs61BvIAUzPeN3BPfehnIepwvIa3N1kuWIYbjJ8xncLzkTJqFdi8vTiWEF451Upv1NxE5cNlcK8vblA9AsOP0jJ4aX6OZdpeSKSiKwbVhQ1EBsrzatzS+aFg4I6gzSL6ap83ULYcM4Tyq1Fp2BJW12q5Ehb2a6oUonKrLuz9EdKjXumWTofVgxDzc7yA3uYQw228sqZmbL81ILQPFb7nCIaM99TS1vo9lIDFYKUZCulQcmxWiy4nVMdzualWssmkpeGOQt8epZPyGR5lJHXtEv3fsVwk6JUsy8irto8ZkK6eupUaNzwsMcPQq5TS4J82aJruKbu25uykJetqlUSrSnnkcvfYCokCdanks16+WNHzNBNFZFFQnULgqJvBwWeMSm5XpVyIqbxVBLekf2CoLK0mSmP/CsajjCdmVIzSU0pM+2ZFpE3PMh7WDBnNFx1Y85d452LiIIbkAg9oiaijr9tFGqV9nKYP+NYQVCPoHmrxQnKYSaPbHD3KRMpzeUw51EnopT3U2TvECefFZus/E7jLOiu4bjjcv1gRO0sqotkqtqU7dalXhzQrkBVTV8rSs62uyMfitJ9TjI5IWTycPWolzErlJ+CrZIYuA63rswgZto1NL8yjIqB2i0oF6ZOjl09F0IRnzJaKgYFpcLMbSzDnBSugfhpxQuOoWHEIjPn3Ba6XLoWV+T5F/MZVRXN+RZpypy57RKMK3S87lAnFi5CTrgZC3KJ5Q3aJzLTiIm1qrv6aiY0FchfnWLXoUILEuXDnKhWymRsNeftlNHMca2/S98+k6j/NbzqgWvU3pHeB2vS27tTrEojX6Y8arls81aXYFz3CZgqbadKUq67dapI2rYfznYuTCvVKspCa9q0EEZ+zatrHqkWCdDNqdjW1LgN3RJlkvdNSFYnKnVRNIHhLlhtQ73T71udCo0bHhJDcOmzO8hhYCSZbzo0d7X17wxoNkjymiFDt42iI0vDlsepXXU9pBKQPGp7PGdyGlBXDRerBrVtzQPfhOw2ubpF/35qdi3ZLigWgsm2C7RfMes+5HaexRPjF7F2gbO06xRy693WLHDdkp1dmhSJkT5pG4TNvGuXwlJ65aI5rlODU0dpraEiNIxaVxi61cdtbCczA2p9lPudLI1YvqMGOaQvNxkb+y6t2z7E3qMVGq/hcYJGTISkPapJczmh5NpdcknLFamMIv/cilFu83slQ1LUaCcn5w1LlitVvyUfKzlLEc2cR1y+r3+61G6zntBS13fzJV/xXNJVVHOV949t+t7a+h8qJiExAAA=1

link
stylesheet
https://blog.coroico.mx/wp-includes/css/dist/block-library/style.min.css?ver=5.2.4
200
text/css

1
ok

No Cache-Control - header
GZip: 4767/29295 Bytes




local SRI possible, possible hash-values:

sha256-S4/lw9Dl73plghhcv1xTW102nI3x2pjAPtaYM+VfR00=
sha384-oBuKSJ7gIx8iF7rcdUjzv0wVT3ytAqOVsSQeU+kUnaNxSXidSyM/t65dzyROItR1
sha512-k4ARx0f08DbXZikHs4jFmF0cMgAUUwPmRkN7FDqdr8rZ9fdDFJK77Mt1WRbgqIQ8Ci9Jo1mb6P9RvF6yxkhCag==

<link rel="stylesheet" href="https://blog.coroico.mx/wp-includes/css/dist/block-library/style.min.css?ver=5.2.4" crossorigin="anonymous" integrity="sha256-S4/lw9Dl73plghhcv1xTW102nI3x2pjAPtaYM+VfR00=" />




link
wlwmanifest
https://blog.coroico.mx/wp-includes/wlwmanifest.xml
200
application/xml

1
ok

460 Bytes






meta

UTF-8


1
ok








meta
og:description
Blog del Laboratorio Clínico


1
ok








meta
og:locale
es_MX


1
ok








meta
og:site_name
COROICO


2
ok








meta
og:title
Página no encontrada - COROICO


1
ok








meta
og:type
object


1
ok








meta
og:type
website


1
ok








meta
generator
WordPress 5.2.4


1
ok








meta
msapplication-TileImage
https://blog.coroico.mx/wp-content/uploads/2019/05/cropped-COROICO_LOGO-04-small-1-1-270x270.png
200
image/png

1
ok

No Cache-Control header
No GZip - 38026 Bytes






meta
robots
noindex,follow


1
ok








meta
twitter:card
summary_large_image


1
ok








meta
twitter:title
Página no encontrada - COROICO


1
ok








meta
viewport
width=device-width, initial-scale=1


1
ok








script
src
https://ajax.googleapis.com/ajax/libs/jqueryui/1.11.4/i18n/datepicker-es.min.js?ver=1.11.4
200
text/javascript; charset=UTF-8

1
ok

Cache-Control: public, max-age=31536000, stale-while-revalidate=2592000 - with long duration found.
GZip: 544/888 Bytes




Server-Header Access-Control-Allow-Origin: *
Cross-Origin Resource Sharing (CORS) supported

missing crossorigin=anonymous|use-credentials and integrity - attribute, possible hash-values:

sha256-zSPceStwQmBlpR27udDyrfq0GplUtQIQ4SHIqSk/qi8=
sha384-S6fcDqqNFTWtPaiLo3KC7qIs13WQjZP6/X6klnU36GhdHzf//yIYG3cxjFH8DnRL
sha512-blwzxJ/aAeMToCncUfhUTL8e/K+dQGQmH4vkYWCf1BeBX+4UwPBI5MR2ctO4VzMee0ODJjQnNzVPDPbjelLpuw==

<script src="https://ajax.googleapis.com/ajax/libs/jqueryui/1.11.4/i18n/datepicker-es.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-zSPceStwQmBlpR27udDyrfq0GplUtQIQ4SHIqSk/qi8=" />




script
src
https://blog.coroico.mx/wp-content/plugins/contact-form-7/includes/js/scripts.js?ver=5.1.3
200
application/javascript

1
ok

No Cache-Control - header
GZip: 3993/14440 Bytes




local SRI possible, possible hash-values:

sha256-t+F5JrMDQu3s7os6kwKaxRRi4rR5J32OB3ulcXPrGQA=
sha384-T6rgaNpfFeTL0NpWgcafGckCommecxQeEegXB8W+PvXBhZEhRsC4XIF9V//eOSPq
sha512-Srz/5pqiXStjZUsP3SwZeDNahRyTHQXq8qkr1uD0OieEND49eF/0XCYsKcIQcd1MdmG1DaUwXsdPRwLzxrQTyw==

<script src="https://blog.coroico.mx/wp-content/plugins/contact-form-7/includes/js/scripts.js?ver=5.1.3" crossorigin="anonymous" integrity="sha256-t+F5JrMDQu3s7os6kwKaxRRi4rR5J32OB3ulcXPrGQA=" />




script
src
https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-sliderAccess.js?ver=5.2.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 1160/3052 Bytes




local SRI possible, possible hash-values:

sha256-hFyH6QhCxwFJVGfWdhU6laC8aeRgE6dtJkFouikSeIE=
sha384-lMnyhpVQ3ulACZ7kcxR1+fzVZT7Y8HFd+QSAKpM7jJQyDTGfiQp6KKsF3en7I6my
sha512-f3j1bRPjN96hT0xRuhL1Uw1t1+NMffXBvvyblHlMlz8GDL3UZtRzuk/dcE0dP32A02orGIvPRX0p7yXCIuAxQg==

<script src="https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-sliderAccess.js?ver=5.2.4" crossorigin="anonymous" integrity="sha256-hFyH6QhCxwFJVGfWdhU6laC8aeRgE6dtJkFouikSeIE=" />




script
src
https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/i18n/jquery-ui-timepicker-es.js?ver=5.2.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 339/583 Bytes




local SRI possible, possible hash-values:

sha256-A8pQbwjU26hLDjDtf8Rfzw6NrVsfjgAyF3JqjDMwJbc=
sha384-HdHNV1OgrVOvM9+HVyVvt/Hgh1MLq0cGgpMLR7FcrpI8yMBAAhVWS3IFFHh2oF6q
sha512-C4EHi6kpsiBAlHRz2qgqTva8LCG3Wj8dBexSUpzSNkvxLmmAiet9L71YQpupLyvQCAGC+AAfW9koOVJ4QA8NnA==

<script src="https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/i18n/jquery-ui-timepicker-es.js?ver=5.2.4" crossorigin="anonymous" integrity="sha256-A8pQbwjU26hLDjDtf8Rfzw6NrVsfjgAyF3JqjDMwJbc=" />




script
src
https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/jquery-ui-timepicker-addon.min.js?ver=5.2.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 10101/37820 Bytes




local SRI possible, possible hash-values:

sha256-9mjjxCzfN6wV2SunlDIItLDRn4AQcFyABZ+0cKOSDN0=
sha384-1w+NGz2r5t690MHGyaQmQ6vpURNVRjQIiNRTLPlzGcFWGu6dKMk1C/+kVehwUVcp
sha512-e7dpjeHAdxz3A2pjFI5uRh7ayQBWMNi2QCkKL8+2ZSGVhz6jIKNI9LMDmEWaeLi/jOZLHYpXPWhOlyJS06BfOg==

<script src="https://blog.coroico.mx/wp-content/plugins/contact-form-7-datepicker/js/jquery-ui-timepicker/jquery-ui-timepicker-addon.min.js?ver=5.2.4" crossorigin="anonymous" integrity="sha256-9mjjxCzfN6wV2SunlDIItLDRn4AQcFyABZ+0cKOSDN0=" />




script
src
https://blog.coroico.mx/wp-content/plugins/google-analytics-for-wordpress/assets/js/frontend.min.js?ver=7.10.0
200
application/javascript

1
ok

No Cache-Control - header
GZip: 2766/9298 Bytes




local SRI possible, possible hash-values:

sha256-Y6bZJtJ3o9ZNMONJ+g6isGMOmAHRc+GUf/O9YGAUfvQ=
sha384-nGGf6PqT4D0Ul0Ppy0nqLgLNwuxkh80/Jv62cgP8eNydmCDsknAq9i3qsJVagmsa
sha512-JbsJvcsUr6Os10yxNfbtEgqwZyEIesmFdNEID/wDlYPH0VBCxXfnCGopB0RrIeDEUTVnnF6mJNnOiP6P85YKNw==

<script src="https://blog.coroico.mx/wp-content/plugins/google-analytics-for-wordpress/assets/js/frontend.min.js?ver=7.10.0" crossorigin="anonymous" integrity="sha256-Y6bZJtJ3o9ZNMONJ+g6isGMOmAHRc+GUf/O9YGAUfvQ=" />




script
src
https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/js/social-icons-widget-frontend.js?ver=20170209
200
application/javascript

1
ok

No Cache-Control - header
GZip: 290/860 Bytes




local SRI possible, possible hash-values:

sha256-aFPXKaZ1k3OYYNOZ3HPiE0DeT1e9p5zJMPU25CiWe08=
sha384-1/RlpVhAlyDwUsWyoiHB58zll6BetJXxRpMQJzbxWFC4gtF0WVUo1narl5W+fAoz
sha512-pvF/Dc1hg9XI+uqWb3qxZmA60GYARGN5GeRLPdmh3frjs25TXfvZq29h55JocG6iH1pEeSDHndKE0BvwPbmHRg==

<script src="https://blog.coroico.mx/wp-content/plugins/social-icons-widget-by-wpzoom/assets/js/social-icons-widget-frontend.js?ver=20170209" crossorigin="anonymous" integrity="sha256-aFPXKaZ1k3OYYNOZ3HPiE0DeT1e9p5zJMPU25CiWe08=" />




script
src
https://blog.coroico.mx/wp-content/plugins/trx_addons/js/magnific/jquery.magnific-popup.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 7346/20216 Bytes




local SRI possible, possible hash-values:

sha256-P93G0oq6PBPWTP1IR8Mz/0jHHUpaWL0aBJTKauisG7Q=
sha384-fexNtx3nPE3sjIQuGk8G2X8X/aSEBVMC58R839hkgsY/Xjhvkm7m2otGhwrdESWj
sha512-IsNh5E3eYy3tr/JiX2Yx4vsCujtkhwl7SLqgnwLNgf04Hrt9BT9SXlLlZlWx+OK4ndzAoALhsMNcCmkggjZB1w==

<script src="https://blog.coroico.mx/wp-content/plugins/trx_addons/js/magnific/jquery.magnific-popup.min.js" crossorigin="anonymous" integrity="sha256-P93G0oq6PBPWTP1IR8Mz/0jHHUpaWL0aBJTKauisG7Q=" />




script
src
https://blog.coroico.mx/wp-content/plugins/trx_addons/js/swiper/swiper.jquery.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 21474/86923 Bytes




local SRI possible, possible hash-values:

sha256-Pl63iFzVinaVFc3QqrQvq3DimF1feP6Wqekm5jTabXo=
sha384-jlHgPeYuWu/jSv/itQ4w4p8/ho7cPFxC8a/QOWtBE/TRMomnkqjvfedCkb/foc60
sha512-kZuRlVjyG3pnsZyFvfSlIeXQDOWRvZQo4+81+g+dybUUUHTgI9vtr1259r44u3X5cmlOP3+x5oSeAaMVfE1fyg==

<script src="https://blog.coroico.mx/wp-content/plugins/trx_addons/js/swiper/swiper.jquery.min.js" crossorigin="anonymous" integrity="sha256-Pl63iFzVinaVFc3QqrQvq3DimF1feP6Wqekm5jTabXo=" />




script
src
https://blog.coroico.mx/wp-content/plugins/trx_addons/js/trx_addons.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 19522/80844 Bytes




local SRI possible, possible hash-values:

sha256-8sOmbAjXhBHtMGKT6Q5m2V2t8gGIniSDjz+M1Ld2Rss=
sha384-ByxGONwxXk8kx2iACT/6ROIkxbiiNrdZJHaU8sCWtJGwOQvGQvUtirfGwx0dzzzt
sha512-9Wnu8Qr5n79pCs4DvPVlH4OgLIkdvyP7R5vGqOFzS7S4xsHWzmynlGGl6NS7/2/SgKAVp4Q5wO700ver7Cr7VA==

<script src="https://blog.coroico.mx/wp-content/plugins/trx_addons/js/trx_addons.js" crossorigin="anonymous" integrity="sha256-8sOmbAjXhBHtMGKT6Q5m2V2t8gGIniSDjz+M1Ld2Rss=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/fastclick.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 2617/8756 Bytes




local SRI possible, possible hash-values:

sha256-oATEZS168zttj41DEh6tMucnbn9bF5GrmhQXuFabz2I=
sha384-Ag78mqJL1bkVJ0/oeSsQv8BBk/DSwk3rZfvF70IkjdyDOk3O3/p8smhNX8B5jDFb
sha512-HMKo4Z5/xJ3s45fdbmUQPbHOiwY3OdAoq29Jtb/iJ9IpYZ/XH90t4+xwAI8/CALBCtOBFueNCYwxrrk3RgdZoQ==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/fastclick.js" crossorigin="anonymous" integrity="sha256-oATEZS168zttj41DEh6tMucnbn9bF5GrmhQXuFabz2I=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fitvids.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 1015/2118 Bytes




local SRI possible, possible hash-values:

sha256-SAEwLh10f5vhChz2fCPPsZEKg73pFg3HHHAPXOQto3k=
sha384-vfKVW9+U0s23mktm+jr0jIwGilzo40EVOZMXWV9YCYztWeDeHc1VqfqfjnHfZzg7
sha512-dq9uU2ctgfZzFpE7zoi6fAILSyFwtboV4lIHWd8r5OrriJhaHYpmLAhVPAv96gzlft3IXl8PvxWolzzQxhRu8w==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fitvids.js" crossorigin="anonymous" integrity="sha256-SAEwLh10f5vhChz2fCPPsZEKg73pFg3HHHAPXOQto3k=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fluidbox/jquery.fluidbox.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 1592/4583 Bytes




local SRI possible, possible hash-values:

sha256-YXVEq9RXBolPLZNxn+lJZ0NGmnNi0NcdHO0AsStRETg=
sha384-lsOWql8/9Jgwh5DolifwyjUQyo3BPOMtEbnu8t0g85DesyZEP4LSh1bV/gFRfxrD
sha512-Z+9tF2NbIynHi5xQUrtQOHlpfBqJ3uxhucxZmuQg9hYNcnWzvI3jZrpKJW2cQ4Go28Ze585cs2wEsQc5WZTUng==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.fluidbox/jquery.fluidbox.min.js" crossorigin="anonymous" integrity="sha256-YXVEq9RXBolPLZNxn+lJZ0NGmnNi0NcdHO0AsStRETg=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.isotope.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 9724/35631 Bytes




local SRI possible, possible hash-values:

sha256-f+dvxdhdTlsLfTLHyf+Io/ZVY0LvptKdcBNE/8dq+t0=
sha384-Jc/KA+xhXlIRHQTAIOQUifsFp3z7eN4RJiTNbNpKyMVDT/5GLM5hnsAuj+jBZs/x
sha512-B5QLNQ3jQzxOIkRGb1hPhBgjv0e254IlOfzbzrLT1bkK6dyATOKDJ+U4BYM7RS16SzXw/F+uwzqLV0uxaloiUA==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.isotope.min.js" crossorigin="anonymous" integrity="sha256-f+dvxdhdTlsLfTLHyf+Io/ZVY0LvptKdcBNE/8dq+t0=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.uniform/jquery.uniform.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 3477/9009 Bytes




local SRI possible, possible hash-values:

sha256-tv9qovbzF3CL8rM8LpWH0CVNLlIlITV8Ps3afTHgvtA=
sha384-MbfQgRYkbMYjeVeaWKZzw4qsNKFVQKVD+QmdUujk3livnVW1N3suUPWcAikpwMC8
sha512-C+PV/GRlvB9vO6h96Gx/hIgSX52KwvMaWt4nob9t+eQCXsyo2FRUbI97z+Cz3eKXLqY5lZrUleZBoU6yEtTUiw==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.uniform/jquery.uniform.min.js" crossorigin="anonymous" integrity="sha256-tv9qovbzF3CL8rM8LpWH0CVNLlIlITV8Ps3afTHgvtA=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.validate.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 6758/21528 Bytes




local SRI possible, possible hash-values:

sha256-joSzqjOpT7UnkBP7V1gGHveGoUMtK1vp8EZAQdMunoE=
sha384-uoitRwRkITw0d4QwtYUHdLuVwroCwWRUyP+XcYWpz4ioL32v9kC4HM9ROHhvZ0iW
sha512-/Xyc1FAA9gs7lbw0fRod4c/JCBa0neNWfcv2rNNZCyevxmazdcelZSzP6OKiSWrkQXXfQmiDG8F9Irzsj3OBYQ==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/jquery.validate.min.js" crossorigin="anonymous" integrity="sha256-joSzqjOpT7UnkBP7V1gGHveGoUMtK1vp8EZAQdMunoE=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/main.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 5230/18080 Bytes




local SRI possible, possible hash-values:

sha256-hGyshn1pPpI7XPbXGDuZX0ZL+ximYEa+hT0WVysdvN0=
sha384-4IyO8QgQJXhLw811EJsIAMIWqD98B/38o/aJOs+enfrYSfXPntC4F8KkWDfF2/i7
sha512-n5gTZJO0UJP2OF9XrUDV/JZjbdNPvQL5pmqv2hMCCXIW4afCHvUCKe/k3ahafIMCa0IPpomM3V3x1d+7yTqbAA==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/main.js" crossorigin="anonymous" integrity="sha256-hGyshn1pPpI7XPbXGDuZX0ZL+ximYEa+hT0WVysdvN0=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/modernizr.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 6309/15516 Bytes




local SRI possible, possible hash-values:

sha256-nFdh4i4MGxO2Iger+N827pouiwNSJB3LcLHLu+2uo3g=
sha384-FE6PFdIWdyXip9fiNUG5CGLLgP9OYKivyrdqp0KCQ14xJv31bvmxdduvVAWFJ91w
sha512-EWsixs9Hv68bimy1nXaKD7vzQoVOYna12xzBBw7mvh2FezF5BdtF9rld3ogWSmu4Pefb5aVO6k/qD8ctfC+Ntg==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/modernizr.min.js" crossorigin="anonymous" integrity="sha256-nFdh4i4MGxO2Iger+N827pouiwNSJB3LcLHLu+2uo3g=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/owl-carousel/owl.carousel.min.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 10522/40401 Bytes




local SRI possible, possible hash-values:

sha256-g1U9IszVblV21UT2upNHXHErPALTEok+6irMFt5fz5E=
sha384-fHRZ/BnbZiOVCdwRiM+FDEJNTP/eJCF/DwHH++AVtmMrdBRY3ia7WqFEy0iTiMIa
sha512-TcGVyneWuYD0/x//7H7AaZEFARFrgm4jZR6uTcixVKzECnQBHriq+2CzDQKTV7AHEWpRyQxD2EuRSWxQ1yTeqg==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/owl-carousel/owl.carousel.min.js" crossorigin="anonymous" integrity="sha256-g1U9IszVblV21UT2upNHXHErPALTEok+6irMFt5fz5E=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/readingTime.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 733/1600 Bytes




local SRI possible, possible hash-values:

sha256-l2vRp1WrB/4n9lAGi87HUXygXS+35RMVshGLy638vqY=
sha384-qG9JvBlOzjAM2miHuYUC7bVQIc0vumIm5r2bbKi+a5yJ+lQZG6vtaJHqVYwPVrcc
sha512-E6SDHnmrdwhWlWTJDbqadq5DBz89yfVBGCAHvQpk+6QZlIvzJ2NF8Zwny50it+qh5oN6JDsJnZaj7cC+xmQDMQ==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/readingTime.js" crossorigin="anonymous" integrity="sha256-l2vRp1WrB/4n9lAGi87HUXygXS+35RMVshGLy638vqY=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/responsive-image-gallery/r-gallery.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 4438/13674 Bytes




local SRI possible, possible hash-values:

sha256-WdnssW861hx/UuZ86Yg0/Ik02DXeui0Mk2li8DMaDNY=
sha384-Ce2zddRjBv4C6EMEmyjxNJOSeqS69y4ZBnDeYyK2rpwmWlhbiAJf9RwbOTKr+ZlC
sha512-Ho7rMA3JA+85KIcxQhejW5gIoV5ZQ5xiLS1eJXdo3wwQx6QSEfhcjuPzsyqYdOAOJyhMCb/B6XJEM+xE2LBFgA==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/responsive-image-gallery/r-gallery.js" crossorigin="anonymous" integrity="sha256-WdnssW861hx/UuZ86Yg0/Ik02DXeui0Mk2li8DMaDNY=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/selection-sharer/selection-sharer.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 2739/7552 Bytes




local SRI possible, possible hash-values:

sha256-opszFKmkUNgzH4cmb20N4987a9nl6uoFlT0YtqcSq58=
sha384-VO/E3t4YqAgDzmKt/VlEL51o2qTjOVjcn4bkHQdv6AJbGtctNgyj1Orja3VCmZZ4
sha512-QqS8UEAn/eIbfGtfK2Z5SvYTOiJM+AUCWqe6UYOwIV5g2o/VibRybR44Tk9b8oVkU/GlxI6h0l1RdHjH1J1o0A==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/selection-sharer/selection-sharer.js" crossorigin="anonymous" integrity="sha256-opszFKmkUNgzH4cmb20N4987a9nl6uoFlT0YtqcSq58=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/socialstream.jquery.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 1674/6132 Bytes




local SRI possible, possible hash-values:

sha256-yo6WjRiAMAANHK9CMM/EuLdyjILeX77Uc2qqpAjDOWQ=
sha384-Np9n5HnEHLRXvLIL41fKBaxQyGHQtJ8Ect3qpIO7hqmZE5S0qxkcIUsELZu5qKo7
sha512-Sj3KD+6CvJpPl4r3NnVYamHmII4fyEu+zA41OrNwDnRyG5/MI8UtEQlfKzjRkFE0OiWrF1yzOSDXRa/V4YnU3A==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/socialstream.jquery.js" crossorigin="anonymous" integrity="sha256-yo6WjRiAMAANHK9CMM/EuLdyjILeX77Uc2qqpAjDOWQ=" />




script
src
https://blog.coroico.mx/wp-content/themes/editor-wp/js/wp-fix.js
200
application/javascript

1
ok

No Cache-Control - header
GZip: 113/131 Bytes




local SRI possible, possible hash-values:

sha256-XSDIT6H5giaGhU1sZRZGIaO21K/VQ+atjHzZI4Bpg2w=
sha384-UYdvUTJ2oE0nJ+HprsB3p0mZzvnBnfgY6xk3BAG4/y37WEiqmJG25FyvQpwlY8Y6
sha512-cmLx+Qyr2IYce6Eksn5oCCDsTw0G0Rz8YIqN6DwhkwjloiPZ4VTtDWpHaMtUYPmayzhLtwaUnvymS9qr8Sdy9A==

<script src="https://blog.coroico.mx/wp-content/themes/editor-wp/js/wp-fix.js" crossorigin="anonymous" integrity="sha256-XSDIT6H5giaGhU1sZRZGIaO21K/VQ+atjHzZI4Bpg2w=" />




script
src
https://blog.coroico.mx/wp-includes/js/imagesloaded.min.js?ver=3.2.0
200
application/javascript

1
ok

No Cache-Control - header
GZip: 2551/8113 Bytes




local SRI possible, possible hash-values:

sha256-EeFfHWSmPLSY0NQnIKaI7RW/eDk9jEYNaVoRAkTAZuM=
sha384-iyvLRA+ulj900F1LFHVzVHMTaIwZ0CTlyrk11v1HsxGtzXScaXytDzs3lVgOeXVJ
sha512-zaaLwYFoaF4iXwdhK/IeK++n3kkqS4RdM9Ie85vDc40C94x2kEYtO9mlXFDEEcul/iXA1Ahh1HUGdC21YqPkUA==

<script src="https://blog.coroico.mx/wp-includes/js/imagesloaded.min.js?ver=3.2.0" crossorigin="anonymous" integrity="sha256-EeFfHWSmPLSY0NQnIKaI7RW/eDk9jEYNaVoRAkTAZuM=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/jquery.js?ver=1.12.4-wp
200
application/javascript

1
ok

No Cache-Control - header
GZip: 33776/96873 Bytes




local SRI possible, possible hash-values:

sha256-HbIdgWKW5pObofQpYkluQTSuKwCB4mlwhkxAxtArsd8=
sha384-ntp7teUU/HNBX29EGk78zfJdXnkzOhOq1gG4fdvWTbNnaqqq3mbIPK+0o7rceUiN
sha512-92bfaFtnNle99XVRNUwUm+ICQ4UQKFTSyjUel2aEu4g2Hq6EjxH3FObllzwGFECDHqb1vplbif1b0tRVmg3Epg==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/jquery.js?ver=1.12.4-wp" crossorigin="anonymous" integrity="sha256-HbIdgWKW5pObofQpYkluQTSuKwCB4mlwhkxAxtArsd8=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/jquery-migrate.min.js?ver=1.4.1
200
application/javascript

1
ok

No Cache-Control - header
GZip: 4014/10056 Bytes




local SRI possible, possible hash-values:

sha256-SOuLUArmo4YXtXONKz+uxIGSKneCJG4x0nVcA0pFzV0=
sha384-uQPAXWjjvZGmVjKnobPRQOCEJ0rkCNRXW1GBUsJkjw1w0K7TxLH6Z3zMX7wtx+Lf
sha512-t0ovA8ZOiDuaNN5DaQQpMn37SqIwp6avyoFQoW49hOmEYSRf8mTCY2jZkEVizDT+IZ9x+VHTZPpcaMA5t2d2zQ==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/jquery-migrate.min.js?ver=1.4.1" crossorigin="anonymous" integrity="sha256-SOuLUArmo4YXtXONKz+uxIGSKneCJG4x0nVcA0pFzV0=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/ui/button.min.js?ver=1.11.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 2082/7236 Bytes




local SRI possible, possible hash-values:

sha256-0mXyR+PZldJs8b7+mgKLGZ2YCa0h4CIOYDySrmwI2t8=
sha384-72FnTXmuTSYUqOWTRRlHsxDk9gA9nLmkhfV/huV5tH3HSclwGQ9g0YxYmfQJwUIL
sha512-ukKrt+E98M5e4LAB7wExH+LV86P6zczK+0Zvn2S05gYkOtoTyEtfbYTph89FaD/TDty3LrpWfqDbkuVTMHHLJw==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/ui/button.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-0mXyR+PZldJs8b7+mgKLGZ2YCa0h4CIOYDySrmwI2t8=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/ui/core.min.js?ver=1.11.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 1821/4000 Bytes




local SRI possible, possible hash-values:

sha256-k2VnvHROGZ4Cv8PDP+K8nIYpmeDUeeKmlKp0hUYKOWA=
sha384-I9Fo2588xRUVSo3b1Pm/eoGdXCW1i93g3QvGeOr6l3G7+aPJrovzFr8/AMgWAB9Z
sha512-oo6oxInumbASchdCmTO4SgfNC1PkpWZ1TXuz5sdiv3kJBSzuTeXvP80fgmPKiMKCGnWQzXyzob21RZnHnGq1rg==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/ui/core.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-k2VnvHROGZ4Cv8PDP+K8nIYpmeDUeeKmlKp0hUYKOWA=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/ui/datepicker.min.js?ver=1.11.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 11002/36508 Bytes




local SRI possible, possible hash-values:

sha256-/l0JATzfid0XxRHJCL7iYo5MD5tFUPgC/bH9UIaZnI0=
sha384-7EY8bIFU0KNRIza2x51N5eIoLDFijtdSUcTEL6RGj9Tc9+iYtjw21rXOt1Wlbxb+
sha512-74zAS7nKmH5dUouIkzAMLQU/sSyUd3yFNdzCnkJc76zARtl1Huc7LOuOjHulaZcZQnYEsSgV1yUltxMCAieYcA==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/ui/datepicker.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-/l0JATzfid0XxRHJCL7iYo5MD5tFUPgC/bH9UIaZnI0=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/ui/mouse.min.js?ver=1.11.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 1021/3148 Bytes




local SRI possible, possible hash-values:

sha256-iLA3k0mk3abrzEPFvRIITSMMYQWm/TwvZRxOdxs+q+8=
sha384-OIIES4oBHHWxjC+nUeU28R36Bkzr+bIJNLHd7h1TFWs8n6RINtnShbv6x5CvVKwL
sha512-xpA56jqcZT/mJ7UpOk9o2OhOw3TJv2hinMEZXH/82E3NXkRoI9+FC/D7D5pCVbKkupQpmblQFCUTvK28F+gD8Q==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/ui/mouse.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-iLA3k0mk3abrzEPFvRIITSMMYQWm/TwvZRxOdxs+q+8=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/ui/slider.min.js?ver=1.11.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 3093/10987 Bytes




local SRI possible, possible hash-values:

sha256-CODZE6ra7yAf0yAMpJ+pkaLY0Cs9mlRiESPXGDe7xz8=
sha384-GNfJeDdrkYn8EdHWzvh/WnyT2cMm1/GMXA4NMsLGgNCmvKsjud4lCiPvRYjcnzVD
sha512-Nrd+LeLO6knITOuWjMWwo38ykzFNuWmkOUEn3xiefV4VuFSI6lGGhGKb40gwSQTwcyIQVkCmIxHcC+/111XzyQ==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/ui/slider.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-CODZE6ra7yAf0yAMpJ+pkaLY0Cs9mlRiESPXGDe7xz8=" />




script
src
https://blog.coroico.mx/wp-includes/js/jquery/ui/widget.min.js?ver=1.11.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 2599/6908 Bytes




local SRI possible, possible hash-values:

sha256-OKRI6eA6n2TnYRsZr0u47Jf94scI3FfrvHcBvnrjrwg=
sha384-F1GqOB8Uc6I2qzUhMZiJ7mdcpzLeszsuyT59UIPNxa/AWMhz4TblRgcwHdlr2w39
sha512-C3JkZioMICZEU9WOfGGeUSUZEhJfpMKHt9GiWHCaZx4P0V8fIVycZW6mGHzDIji1K+24nrXfLCCp4tRatspQqA==

<script src="https://blog.coroico.mx/wp-includes/js/jquery/ui/widget.min.js?ver=1.11.4" crossorigin="anonymous" integrity="sha256-OKRI6eA6n2TnYRsZr0u47Jf94scI3FfrvHcBvnrjrwg=" />




script
src
https://blog.coroico.mx/wp-includes/js/wp-embed.min.js?ver=5.2.4
200
application/javascript

1
ok

No Cache-Control - header
GZip: 753/1403 Bytes




local SRI possible, possible hash-values:

sha256-IVJVfKxp4r19bevvUDep9VT5IJzDBbgUGzMprLEMQrc=
sha384-XnSFU7x9V0Dj3v7dHnqVJLtQM6R4foycfqhGECXJXDza0+uOB7Yrvhwc9smLjZkJ
sha512-jFyvvCzjcFc1/xExqzTCrveqUL8luhPwopwHcTVhsOZSLJNZbIBH7DMuf6mFZaneVs8EBjIUmyVbWNC7xD+6ew==

<script src="https://blog.coroico.mx/wp-includes/js/wp-embed.min.js?ver=5.2.4" crossorigin="anonymous" integrity="sha256-IVJVfKxp4r19bevvUDep9VT5IJzDBbgUGzMprLEMQrc=" />




script
src
https://connect.facebook.net/en_US/sdk.js#xfbml=1&version=v3.3
200
application/x-javascript; charset=utf-8

1
ok

Cache-Control: public,max-age=1200,stale-while-revalidate=3600 - max-age too short.
GZip: 1781/3224 Bytes




Server-Header Access-Control-Allow-Origin: *
Cross-Origin Resource Sharing (CORS) supported

missing crossorigin=anonymous|use-credentials and integrity - attribute, possible hash-values:

sha256-nGioH6O7DjEnaef/8ZXcBaPhZxkb/BomUohToC8enyE=
sha384-0tCSVJxDG1O3S9sEgh+FgQIhVTm/XzMtNJMItRsMWTybTOUkuAlKIhnQ6x7V3ras
sha512-g5U4+M4J6orTLVNdWj8bMaihVNgvU+Z837D156WTbhjhP7IP0HPFpIRNmnmzG/N0TQacJecgDCcABsR7MblTog==

<script src="https://connect.facebook.net/en_US/sdk.js#xfbml=1&version=v3.3" crossorigin="anonymous" integrity="sha256-nGioH6O7DjEnaef/8ZXcBaPhZxkb/BomUohToC8enyE=" />




script
src
https://tools.pinpoll.com/global.js
200
application/javascript

1
ok

GZip: 26983/82164 Bytes




Server-Header Access-Control-Allow-Origin: not found
Cross-Origin Resource Sharing (CORS) not supported



11. CAA - Entries

DomainnameflagNameValue∑ Queries∑ Timeout
www.blog.coroico.mx
0

no CAA entry found
1
0
blog.coroico.mx
0

no CAA entry found
1
0
coroico.mx
0

no CAA entry found
1
0
mx
0

no CAA entry found
1
0


12. TXT - Entries

DomainnameTXT EntryStatus∑ Queries∑ Timeout
coroico.mx
google-site-verification=gQWMt0dvAWy_pWXXI6M06wOHwjFa8Bi2oC9nnRC4agc
ok
1
0
blog.coroico.mx

ok
1
0
www.blog.coroico.mx

ok
1
0
_acme-challenge.blog.coroico.mx

Name Error - The domain name does not exist
1
0
_acme-challenge.www.blog.coroico.mx

Name Error - The domain name does not exist
1
0
_acme-challenge.blog.coroico.mx.coroico.mx

Name Error - The domain name does not exist
1
0
_acme-challenge.blog.coroico.mx.blog.coroico.mx

Name Error - The domain name does not exist
1
0
_acme-challenge.www.blog.coroico.mx.blog.coroico.mx

Name Error - The domain name does not exist
1
0
_acme-challenge.www.blog.coroico.mx.www.blog.coroico.mx

Name Error - The domain name does not exist
1
0


13. Portchecks (BETA)

Domain or IPPortDescriptionResultAnswer
blog.coroico.mx
21
FTP



blog.coroico.mx
21
FTP



blog.coroico.mx
22
SSH
open
SSH-2.0-OpenSSH_7.4p1 Debian-10+deb9u6

blog.coroico.mx
22
SSH
open
SSH-2.0-OpenSSH_7.4p1 Debian-10+deb9u6

blog.coroico.mx
25
SMTP



blog.coroico.mx
25
SMTP



blog.coroico.mx
53
DNS



blog.coroico.mx
53
DNS



blog.coroico.mx
110
POP3



blog.coroico.mx
110
POP3



blog.coroico.mx
143
IMAP



blog.coroico.mx
143
IMAP



blog.coroico.mx
465
SMTP (encrypted)



blog.coroico.mx
465
SMTP (encrypted)



blog.coroico.mx
587
SMTP (encrypted, submission)